BLAST/PSIBLAST alignment of GI: 254780944 and GI: 222085968 at iteration 1
>gi|222085968|ref|YP_002544500.1| hypothetical protein Arad_2358 [Agrobacterium radiobacter K84] Length = 233
>gi|221723416|gb|ACM26572.1| conserved hypothetical protein [Agrobacterium radiobacter K84] Length = 233
 Score =  258 bits (659), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 115/213 (53%), Positives = 158/213 (74%), Gaps = 1/213 (0%)

Query: 1   MKKKSFHTSISAKVRNNFFAGFIICAPIAITIWLSLSLIHWFDGFIVPYIPMQYNPEYYC 60
           M  K    S++A++RNNF AG IICAPIAIT+WL+ S+IHW D ++ PYIP +Y+PE Y 
Sbjct: 1   MTDKPIKVSVAARIRNNFLAGLIICAPIAITLWLTWSVIHWADSWVRPYIPARYDPESYL 60

Query: 61  DFSIPGFGLLVVIVGINIVGFFGRNLLGRFVFFLSESILNNTPIVRHLYKSTKQIIRTLL 120
           +F++PG G+++ ++ I I+GF  +NL+G+ +    ESI+   P+VR +YKS KQI  T+L
Sbjct: 61  NFAVPGTGVVIAMIFITIIGFLAKNLIGQSIVRFGESIVQRVPLVRTIYKSLKQIFETVL 120

Query: 121 KEDSTSFKNACLVEYPSAGFWSLCFLTTEVKGEIKEKFSNIGCEDMVTVFIPPTPLPTAG 180
           KE  TSFK   L+EYPS G WS+ F++T+ KGEI  KF+ +G  DMV VF+PPTP+PTAG
Sbjct: 121 KEQGTSFKKVGLIEYPSPGLWSMVFISTDAKGEIASKFNAMG-HDMVAVFLPPTPVPTAG 179

Query: 181 MLVFVPRNKVIMLKMSAEDSAKMLISGGLLIPD 213
            L+FVPR K+ +L MS ED AK+LISGGL+ P+
Sbjct: 180 FLIFVPREKITILDMSPEDGAKLLISGGLVSPE 212