BLAST/PSIBLAST alignment of GI: 254780944 and GI: 241204636 at iteration 1
>gi|241204636|ref|YP_002975732.1| hypothetical protein Rleg_1911 [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 235
>gi|240858526|gb|ACS56193.1| protein of unknown function DUF502 [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 235
 Score =  261 bits (668), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 118/220 (53%), Positives = 160/220 (72%), Gaps = 1/220 (0%)

Query: 1   MKKKSFHTSISAKVRNNFFAGFIICAPIAITIWLSLSLIHWFDGFIVPYIPMQYNPEYYC 60
           M   +    ++ ++RNNF AG IICAPIAITIWL+ + IHW D ++ PYIP ++NPE Y 
Sbjct: 1   MTDNTPRMPVATRLRNNFLAGLIICAPIAITIWLTWTFIHWSDSWVRPYIPARWNPESYL 60

Query: 61  DFSIPGFGLLVVIVGINIVGFFGRNLLGRFVFFLSESILNNTPIVRHLYKSTKQIIRTLL 120
           +F+IPGFGLL+ IV I +VGF G+NL+G+ +    ESI+   P+VR +Y+S KQI  T+L
Sbjct: 61  NFAIPGFGLLIAIVLITVVGFLGKNLIGQSIVRFGESIVQRMPLVRTIYRSVKQIFETVL 120

Query: 121 KEDSTSFKNACLVEYPSAGFWSLCFLTTEVKGEIKEKFSNIGCEDMVTVFIPPTPLPTAG 180
           KE + SFK   L+EYP  G W+L F+ T+ KGEI  KF+ +G +DMV VF+PPTP+PTAG
Sbjct: 121 KEQANSFKKVGLIEYPGPGLWALIFIATDAKGEIASKFNAMG-QDMVAVFLPPTPVPTAG 179

Query: 181 MLVFVPRNKVIMLKMSAEDSAKMLISGGLLIPDNISYDAQ 220
            L+FVPR K++ML MS ED+AK LISGGL+ P++   D +
Sbjct: 180 FLIFVPREKIVMLDMSPEDAAKFLISGGLVAPEHKPADPK 219