BLAST/PSIBLAST alignment of GI: 254780944 and GI: 327188305 at iteration 1
>gi|327188305|gb|EGE55524.1| hypothetical protein RHECNPAF_920011 [Rhizobium etli CNPAF512] Length = 228
 Score =  264 bits (674), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 119/213 (55%), Positives = 160/213 (75%), Gaps = 1/213 (0%)

Query: 10  ISAKVRNNFFAGFIICAPIAITIWLSLSLIHWFDGFIVPYIPMQYNPEYYCDFSIPGFGL 69
           ++ ++RNNF AG IICAPIAITIWL+ + IHW D ++ PYIP ++NPE Y +F+IPGFGL
Sbjct: 3   VATRLRNNFLAGLIICAPIAITIWLTWTFIHWSDSWVRPYIPARWNPESYLNFAIPGFGL 62

Query: 70  LVVIVGINIVGFFGRNLLGRFVFFLSESILNNTPIVRHLYKSTKQIIRTLLKEDSTSFKN 129
           L+ +V I +VGF G+NL+G+ +    ESI+   P+VR +YKS KQI  T+LKE + SFK 
Sbjct: 63  LIAVVLITVVGFLGKNLIGQSIVRFGESIVQRMPLVRTIYKSVKQIFETVLKEQANSFKK 122

Query: 130 ACLVEYPSAGFWSLCFLTTEVKGEIKEKFSNIGCEDMVTVFIPPTPLPTAGMLVFVPRNK 189
             L+EYPS G W+L F+ T+ KGEI  KF+ +G +DMV VF+PPTP+PTAG LVFVPR K
Sbjct: 123 VGLIEYPSPGLWALVFVATDAKGEIASKFNAMG-QDMVAVFLPPTPVPTAGFLVFVPREK 181

Query: 190 VIMLKMSAEDSAKMLISGGLLIPDNISYDAQPE 222
           ++ML MS ED+AK LISGGL+ P +   + +P+
Sbjct: 182 IVMLDMSPEDAAKFLISGGLVAPGHTPSEPKPK 214