RPSBLAST alignment for GI: 254780944 and conserved domain: pfam04367

>gnl|CDD|146814 pfam04367, DUF502, Protein of unknown function (DUF502). Predicted to be an integral membrane protein. Length = 108
 Score =  121 bits (306), Expect = 2e-28
 Identities = 50/112 (44%), Positives = 72/112 (64%), Gaps = 4/112 (3%)

Query: 69  LLVVIVGINIVGFFGRNLLGRFVFFLSESILNNTPIVRHLYKSTKQIIRTLLKEDSTSFK 128
           L++ ++ I +VG   RN +GR++  L E +LN  P+VR +Y S KQI+ TLL +   SF+
Sbjct: 1   LILTLLLIFLVGLLARNFIGRWLLSLGERLLNRIPLVRSIYSSVKQIVETLLGDKKKSFR 60

Query: 129 NACLVEYPSAGFWSLCFLTTEVKGEIKEKFSNIGCEDMVTVFIPPTPLPTAG 180
              LVEYP  G W++ F+T EV GE+ E+      ED+V VF+P TP PT+G
Sbjct: 61  KVVLVEYPRPGLWAIGFVTGEVGGELAERLG----EDLVAVFVPTTPNPTSG 108