RPSBLAST alignment for GI: 254780944 and conserved domain: COG2928

>gnl|CDD|32752 COG2928, COG2928, Uncharacterized conserved protein [Function unknown]. Length = 222
 Score =  203 bits (519), Expect = 3e-53
 Identities = 81/205 (39%), Positives = 128/205 (62%), Gaps = 4/205 (1%)

Query: 9   SISAKVRNNFFAGFIICAPIAITIWLSLSLIHWFDGFIVPYIPMQYNPEYYCDFSIPGFG 68
             + +++  F  G ++  P+AIT+W+   +    D F+ P +P +  P  Y  F+IPG G
Sbjct: 1   KGAKRLKKYFLTGLLVLLPLAITLWVVSWIFGLLDQFVGPLLPDRLRPAVYFPFNIPGLG 60

Query: 69  LLVVIVGINIVGFFGRNLLGRFVFFLSESILNNTPIVRHLYKSTKQIIRTLLKEDSTSFK 128
           +++ I+ I ++GF  RN++GR +  L +S+L   P+V+ +YKS KQ++ TLL + S SFK
Sbjct: 61  VILAIILIFLLGFLARNMIGRSLLSLGDSLLRRIPLVKSIYKSAKQVVETLLSDQSGSFK 120

Query: 129 NACLVEYPSAGFWSLCFLTTEVKGEIKEKFSNIGCEDMVTVFIPPTPLPTAGMLVFVPRN 188
              LVE+P  G W++ F+T E  GE+KEK        MV VF+P TP PT+G L+ VP+ 
Sbjct: 121 QVVLVEFPRRGIWAIAFVTGEKAGELKEKEG----RPMVAVFVPTTPNPTSGFLLLVPKE 176

Query: 189 KVIMLKMSAEDSAKMLISGGLLIPD 213
            ++ L M+ ED+ K +ISGG++ PD
Sbjct: 177 DIVPLDMTVEDALKYIISGGVVAPD 201