RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780944|ref|YP_003065357.1| hypothetical protein CLIBASIA_04215 [Candidatus Liberibacter asiaticus str. psy62] (228 letters) >gnl|CDD|32752 COG2928, COG2928, Uncharacterized conserved protein [Function unknown]. Length = 222 Score = 203 bits (519), Expect = 3e-53 Identities = 81/205 (39%), Positives = 128/205 (62%), Gaps = 4/205 (1%) Query: 9 SISAKVRNNFFAGFIICAPIAITIWLSLSLIHWFDGFIVPYIPMQYNPEYYCDFSIPGFG 68 + +++ F G ++ P+AIT+W+ + D F+ P +P + P Y F+IPG G Sbjct: 1 KGAKRLKKYFLTGLLVLLPLAITLWVVSWIFGLLDQFVGPLLPDRLRPAVYFPFNIPGLG 60 Query: 69 LLVVIVGINIVGFFGRNLLGRFVFFLSESILNNTPIVRHLYKSTKQIIRTLLKEDSTSFK 128 +++ I+ I ++GF RN++GR + L +S+L P+V+ +YKS KQ++ TLL + S SFK Sbjct: 61 VILAIILIFLLGFLARNMIGRSLLSLGDSLLRRIPLVKSIYKSAKQVVETLLSDQSGSFK 120 Query: 129 NACLVEYPSAGFWSLCFLTTEVKGEIKEKFSNIGCEDMVTVFIPPTPLPTAGMLVFVPRN 188 LVE+P G W++ F+T E GE+KEK MV VF+P TP PT+G L+ VP+ Sbjct: 121 QVVLVEFPRRGIWAIAFVTGEKAGELKEKEG----RPMVAVFVPTTPNPTSGFLLLVPKE 176 Query: 189 KVIMLKMSAEDSAKMLISGGLLIPD 213 ++ L M+ ED+ K +ISGG++ PD Sbjct: 177 DIVPLDMTVEDALKYIISGGVVAPD 201 >gnl|CDD|146814 pfam04367, DUF502, Protein of unknown function (DUF502). Predicted to be an integral membrane protein. Length = 108 Score = 121 bits (306), Expect = 2e-28 Identities = 50/112 (44%), Positives = 72/112 (64%), Gaps = 4/112 (3%) Query: 69 LLVVIVGINIVGFFGRNLLGRFVFFLSESILNNTPIVRHLYKSTKQIIRTLLKEDSTSFK 128 L++ ++ I +VG RN +GR++ L E +LN P+VR +Y S KQI+ TLL + SF+ Sbjct: 1 LILTLLLIFLVGLLARNFIGRWLLSLGERLLNRIPLVRSIYSSVKQIVETLLGDKKKSFR 60 Query: 129 NACLVEYPSAGFWSLCFLTTEVKGEIKEKFSNIGCEDMVTVFIPPTPLPTAG 180 LVEYP G W++ F+T EV GE+ E+ ED+V VF+P TP PT+G Sbjct: 61 KVVLVEYPRPGLWAIGFVTGEVGGELAERLG----EDLVAVFVPTTPNPTSG 108 >gnl|CDD|39725 KOG4525, KOG4525, KOG4525, Jacalin-like lectin domain-containing protein [General function prediction only]. Length = 614 Score = 30.0 bits (67), Expect = 0.55 Identities = 15/65 (23%), Positives = 24/65 (36%), Gaps = 3/65 (4%) Query: 27 PIAITIWLSLSLIHWFDGFIVPYIPMQYNPEYYCDFSIPGFGLLVVIVGINIVGFFGRNL 86 P ++ + W DG + + S G +V G +VGF+G Sbjct: 545 PGSLIHGFAERCGAWVDGISILTTSGDTKR-LSGNSSGGGLKSYLVPKGFQLVGFYGT-- 601 Query: 87 LGRFV 91 LG F+ Sbjct: 602 LGPFM 606 >gnl|CDD|153323 cd07639, BAR_ACAP1, The Bin/Amphiphysin/Rvs (BAR) domain of ArfGAP with Coiled-coil, ANK repeat and PH domain containing protein 1. BAR domains are dimerization, lipid binding and curvature sensing modules found in many different proteins with diverse functions. ACAP1 (ArfGAP with Coiled-coil, ANK repeat and PH domain containing protein 1), also called centaurin beta-1, is an Arf6-specific GTPase activating protein (GAP) which mediates Arf6 signaling. Arf6 is involved in the regulation of endocytosis, phagocytosis, cell adhesion and migration. ACAP1 also participates in the cargo sorting and recycling of the transferrin receptor and integrin beta1. It may also play a role in innate immune responses. ACAP1 contains an N-terminal BAR domain, followed by a Pleckstrin homology (PH) domain, an Arf GAP domain, and C-terminal ankyrin (ANK) repeats. BAR domains form dimers that bind to membranes, induce membrane bending and curvature, and may also be involved in protein-protein interactions. Length = 200 Score = 28.3 bits (63), Expect = 1.7 Identities = 12/44 (27%), Positives = 24/44 (54%) Query: 87 LGRFVFFLSESILNNTPIVRHLYKSTKQIIRTLLKEDSTSFKNA 130 L +F L+ + ++ ++ S KQ ++ L+KED F++A Sbjct: 63 LEKFSDGLNHILDSHAELLEATQFSFKQQLQLLVKEDLRGFRDA 106 >gnl|CDD|31996 COG1811, COG1811, Uncharacterized membrane protein, possible Na+ channel or pump [General function prediction only]. Length = 228 Score = 25.9 bits (57), Expect = 8.5 Identities = 18/53 (33%), Positives = 27/53 (50%), Gaps = 5/53 (9%) Query: 28 IAITIWLSLSLIHWFDGFIVPYIPMQYNPEYYCDFSIPGFGLLVVIVGINIVG 80 AI + L LI F I+P P+ DF+ G GLL++ +G+ I+G Sbjct: 153 SAIPVLLIQGLIALFAAQILPLTT----PDLMADFTAVG-GLLILAIGLRILG 200 >gnl|CDD|36491 KOG1277, KOG1277, KOG1277, Endosomal membrane proteins, EMP70 [Intracellular trafficking, secretion, and vesicular transport]. Length = 593 Score = 26.0 bits (57), Expect = 9.8 Identities = 16/86 (18%), Positives = 29/86 (33%), Gaps = 26/86 (30%) Query: 14 VRNNFFAGFIICAPIAITIWLSLSLIHWFDGFIVPYIPMQYNPEYYCDFSIPGFGLLVVI 73 ++N + P+ T L+ + Y ++P FG +VV+ Sbjct: 360 IKNMLLTASLFPVPVFGT-AFLLNTVAIA---------------YGATAALP-FGTIVVV 402 Query: 74 VGI---------NIVGFFGRNLLGRF 90 + I + G G+N G F Sbjct: 403 LLIWLFVISPLTVLGGIAGKNRSGEF 428 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.325 0.141 0.434 Gapped Lambda K H 0.267 0.0848 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 2,909,123 Number of extensions: 160385 Number of successful extensions: 521 Number of sequences better than 10.0: 1 Number of HSP's gapped: 517 Number of HSP's successfully gapped: 28 Length of query: 228 Length of database: 6,263,737 Length adjustment: 90 Effective length of query: 138 Effective length of database: 4,318,927 Effective search space: 596011926 Effective search space used: 596011926 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 56 (25.1 bits)