RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254780944|ref|YP_003065357.1| hypothetical protein CLIBASIA_04215 [Candidatus Liberibacter asiaticus str. psy62] (228 letters) >d1guqa2 d.13.1.2 (A:178-348) Galactose-1-phosphate uridylyltransferase {Escherichia coli [TaxId: 562]} Length = 171 Score = 25.4 bits (55), Expect = 4.1 Identities = 6/61 (9%), Positives = 21/61 (34%), Gaps = 2/61 (3%) Query: 144 CFLTTEVKGEIKEKFSNIGCEDMVTVFIPPTPLPTAGMLVFVPRNKVIML-KMSAEDSAK 202 L V+ E+ + + + +P + +P+ V+ + ++ + Sbjct: 19 PMLVDYVQRELADGSRTVVETEHWLAVVPYWAA-WPFETLLLPKAHVLRITDLTDAQRSD 77 Query: 203 M 203 + Sbjct: 78 L 78 >d1ioua_ d.110.4.1 (A:) Synaptobrevin homolog 1 ykt6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 140 Score = 25.2 bits (55), Expect = 4.4 Identities = 13/59 (22%), Positives = 25/59 (42%), Gaps = 1/59 (1%) Query: 80 GFFGRNLLGRFVFFLSESILNNTPI-VRHLYKSTKQIIRTLLKEDSTSFKNACLVEYPS 137 GFF R+ +G+F+ F +E++ + T R + I + + +YP Sbjct: 29 GFFERSSVGQFMTFFAETVASRTGAGERQSIEEGNYIGHVYARSEGICGVLITDKQYPV 87 >d1ryaa_ d.113.1.5 (A:) GDP-mannose mannosyl hydrolase NudD {Escherichia coli [TaxId: 562]} Length = 160 Score = 24.8 bits (53), Expect = 7.1 Identities = 10/34 (29%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 161 IGCEDMVTVFIPPTPLPTAGMLVFVPRNKVIMLK 194 + ED TV + TPL + +V R + ++ K Sbjct: 4 LRQEDFATV-VRSTPLVSLDFIVENSRGEFLLGK 36 >d1ffta_ f.24.1.1 (A:) Cytochrome O ubiquinol oxidase, subunit I {Escherichia coli [TaxId: 562]} Length = 501 Score = 24.2 bits (52), Expect = 9.7 Identities = 19/93 (20%), Positives = 28/93 (30%), Gaps = 12/93 (12%) Query: 18 FFAGFIICAPIAI-----TIWLSLSLIHWFDGFIVPYIPMQY-----NPEYYCDFSIPGF 67 FAG P A W + W GF V ++P+ P F Sbjct: 381 CFAGMTYWWPKAFGFKLNETWGKRAFWFWIIGFFVAFMPLYALGFMGMTRRLSQQIDPQF 440 Query: 68 GLLVVIVGINIVGFFGRNLLGRFVFFLSESILN 100 +++I V L V + SI + Sbjct: 441 HTMLMIAASGAVLIALGILC--LVIQMYVSIRD 471 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.325 0.141 0.434 Gapped Lambda K H 0.267 0.0659 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 868,223 Number of extensions: 41186 Number of successful extensions: 112 Number of sequences better than 10.0: 1 Number of HSP's gapped: 112 Number of HSP's successfully gapped: 7 Length of query: 228 Length of database: 2,407,596 Length adjustment: 82 Effective length of query: 146 Effective length of database: 1,281,736 Effective search space: 187133456 Effective search space used: 187133456 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 51 (23.6 bits)