>TIGR00963 secA preprotein translocase, SecA subunit; InterPro: IPR000185 Secretion across the inner membrane in some Gram-negative bacteria occurs via the preprotein translocase pathway. Proteins are produced in the cytoplasm as precursors, and require a chaperone subunit to direct them to the translocase component. . From there, the mature proteins are either targeted to the outer membrane, or remain as periplasmic proteins. The translocase protein subunits are encoded on the bacterial chromosome. The translocase itself comprises 7 proteins, including a chaperone protein (SecB), an ATPase (SecA), an integral membrane complex (SecCY, SecE and SecG), and two additional membrane proteins that promote the release of the mature peptide into the periplasm (SecD and SecF) . The chaperone protein SecB is a highly acidic homotetrameric protein that exists as a "dimer of dimers" in the bacterial cytoplasm. SecB maintains preproteins in an unfolded state after translation, and targets these to the peripheral membrane protein ATPase SecA for secretion . SecA is a cytoplasmic protein of 800 to 960 amino acid residues. Homologs of secA are also encoded in the chloroplast genome of some algae as well as in the nuclear genome of plants . It could be involved in the intraorganellar protein transport into thylakoids.; GO: 0005524 ATP binding, 0006605 protein targeting, 0006886 intracellular protein transport.

Probab=97.92 E-value=5e-05 Score=58.99 Aligned_cols=138 Identities=24% Similarity=0.324 Sum_probs=106.4 Q ss_pred EEEEC-----CCCCHHHHHHHHHHHHHHHHCCEEEEEHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCHHHHHHHHHHH Q ss_conf 88621-----4422369999997334443054588612799999999862110145786589962464225667687762 Q gi|254780945|r 297 ILQGD-----VGSGKTLVALIAMAAAVEAGGQAVIMAPIGILAQQHYEFIKKYTQNTQIIVEIITGNMPQAHRRKALERI 371 (700) Q Consensus 297 LLQGD-----VGSGKTiVA~~A~l~~~~~G~Q~alMaPTEILA~QH~~~~~~~~~~~~i~v~lLtg~~~~~er~~i~~~i 371 (700) T Consensus 72 LH~G~IAEMkTGEGKTL~AtLpaYLNAL~GkGVHvVTVNdYLA~RD~e~m~~v~~FLGL~VGl~~~~m~~~eRr~aY~-- 149 (904) T TIGR00963 72 LHKGKIAEMKTGEGKTLVATLPAYLNALTGKGVHVVTVNDYLARRDAEWMGQVYRFLGLSVGLILSSMSPEERREAYA-- 149 (904) T ss_pred HCCCCEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHC-- T ss_conf 808966783148862899999999876517962799635044488899878999684936888617998589999854-- Q ss_pred CCCCCEEEEECHHH------------CCCCCCCCCCCEEEECCCCCCCHHHHHHHHHC----------CCCCCCEEE--- Q ss_conf 13475486411120------------13345544441788521013356889987402----------567761010--- Q gi|254780945|r 372 AHGQAHIIIGTHAL------------FQDSIQYYKLILVIVDEQHRFGVQQRLKLTQK----------ATAPHVLLM--- 426 (700) Q Consensus 372 ~~G~~~iiIGTHAL------------~q~~v~F~~LgLvViDEQHRFGV~QR~~L~~K----------g~~ph~L~M--- 426 (700) T Consensus 150 ----cDITY~TNnELGFDYLRDNM~~~~ee~vqR~f~FAIIDE-----VD--SILIDEARTPLIISGpae~~~~~Y~ev~ 218 (904) T TIGR00963 150 ----CDITYGTNNELGFDYLRDNMALSKEEKVQRPFNFAIIDE-----VD--SILIDEARTPLIISGPAEKSTEKYLEVN 218 (904) T ss_pred ----CCEEEECCCCCCHHHHHHHHHCCHHHHHCCCCCCEEEEE-----EC--CEEECCCCCCCCCCCCCCCCCCCHHHHH T ss_conf ----981653265420246667641150121016722268864-----24--4642333686523576678630100178 Q ss_pred -------------CHHHHHHHHHHHHHH-CCCHHHHCCC Q ss_conf -------------101322789999752-0101111023 Q gi|254780945|r 427 -------------TATPIPRTLVLTSLG-DIDISKITEK 451 (700) Q Consensus 427 -------------tATPIPRTLal~~yg-dldvS~i~e~ 451 (700) T Consensus 219 ~~~~~l~e~~~~p~a~~~~~~l~---e~W~~dY-~vDeK 253 (904) T TIGR00963 219 KLVDPLKETDKLPQANEVAKALK---EKWDVDY-EVDEK 253 (904) T ss_pred HHHHHHHCCCCCCCHHHHHHHHH---HHCCCCC-EEECC T ss_conf 78866416655750445689986---3116770-35104

HHsearch alignment for GI: 254780945 and conserved domain: TIGR00963