>cd00141 NT_POLXc Nucleotidyltransferase (NT) domain of family X DNA Polymerases. X family polymerases fill in short gaps during DNA repair. They are relatively inaccurate enzymes and play roles in base excision repair, in non-homologous end joining (NHEJ) which acts mainly to repair damage due to ionizing radiation, and in V(D)J recombination. This family includes eukaryotic Pol beta, Pol lambda, Pol mu, and terminal deoxyribonucleotidyl transferase (TdT). Pol beta and Pol lambda are primarily DNA template-dependent polymerases. TdT is a DNA template-independent polymerase. Pol mu has both template dependent and template independent activities. This subgroup belongs to the Pol beta-like NT superfamily. In the majority of enzymes in this superfamily, two carboxylates, Dx[D/E], together with a third more distal carboxylate, coordinate two divalent metal cations involved in a two-metal ion mechanism of nucleotide addition. These three carboxylate residues are fairly well conserved in this

Probab=90.14  E-value=0.27  Score=29.70  Aligned_cols=29  Identities=28%  Similarity=0.316  Sum_probs=13.4

Q ss_pred             HHHHHHHHHHHHHCHHHHHHHHHHHHCCCC
Q ss_conf             879999999984142589999998520630
Q gi|254780945|r  602 KNSYTRLSVLKNTEDGFLIAEEDLKQRKEG  631 (700)
Q Consensus       602 ~~~~~Rl~~l~~~~dGf~iAe~Dl~lRG~G  631 (700)
T Consensus       254 ~~fn~~lR~~A~-~kG~~Lne~GL~~~~~~  282 (307)
T cd00141         254 KQFNRALRRLAK-EKGLKLNEYGLFDGVDG  282 (307)
T ss_pred             HHHHHHHHHHHH-HCCCCCCCCCCCCCCCC
T ss_conf             999999999999-85996542017458899