HHsearch alignment for GI: 254780946 and conserved domain: COG2938

>COG2938 Uncharacterized conserved protein [Function unknown].
Probab=99.92  E-value=6.2e-25  Score=164.89  Aligned_cols=86  Identities=33%  Similarity=0.573  Sum_probs=81.5

Q ss_pred             CCCCHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHCCCCHHHHHHHHCCCCCCCHHHHHHHHHH
Q ss_conf             98658999999999997407899999999999998202999999999999468917999999488999806756999999
Q gi|254780946|r    1 MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPEYLRTPIFKKI   80 (98)
Q Consensus         1 M~~~ld~~~krl~~Rs~rRG~kElDllL~~F~~~~~~~l~~~el~~f~~LL~~~D~dL~~wl~~~~~~p~~~~~~ii~~I   80 (98)
T Consensus         7 ~~~~~d~~~~RL~~rsr-RGmrElDlil~~Fae~~~~~lsd~e~~~f~~LLe~~D~dL~~Wi~g~~~~~~~~~~~mv~~I   85 (94)
T COG2938           7 STEDDDARKARLRWRSR-RGMRELDLILGPFAEKEFDSLSDEELDEFERLLECEDNDLFNWIMGHGEPPDAELTPMVRKI   85 (94)
T ss_pred             CCCCCHHHHHHHHHHHH-HCHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHCCCCHHHHHHHHCCCCCCCHHHHHHHHHH
T ss_conf             66567799999999998-03099999989999999851999999999999858858999998589999837889999999


Q ss_pred             HHHHHHH
Q ss_conf             9999822
Q gi|254780946|r   81 YDYYSNN   87 (98)
Q Consensus        81 ~~f~~~~   87 (98)
T Consensus        86 ~~~~~~~   92 (94)
T COG2938          86 QARRRIR   92 (94)
T ss_pred             HHHHHHC
T ss_conf             9986641