HHsearch results for GI: 254780946 and protein with PDBid: 1puz_A

>1puz_A Conserved hypothetical protein; NMA1147, MR19, structural genomics, PSI, protein structure initiative; NMR {Neisseria meningitidis MC58} SCOP: a.218.1.1
Probab=99.93  E-value=7e-26  Score=169.12  Aligned_cols=81  Identities=31%  Similarity=0.457  Sum_probs=78.5

Q ss_pred             CCCCHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHCCCCHHHHHHHHCCCCCCCHHHHHHHHHH
Q ss_conf             98658999999999997407899999999999998202999999999999468917999999488999806756999999
Q gi|254780946|r    1 MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPEYLRTPIFKKI   80 (98)
Q Consensus         1 M~~~ld~~~krl~~Rs~rRG~kElDllL~~F~~~~~~~l~~~el~~f~~LL~~~D~dL~~wl~~~~~~p~~~~~~ii~~I   80 (98)
                      ||..-+.++|||+||| ||||+|+|+|||+|+++++++++++++.+|++||+++|+|||+|++|+++||+...++|+++|
T Consensus         1 m~~~dd~~~krl~~rs-rRG~~ElDllL~~F~~~~~~~l~~~el~~f~~LL~~~D~dL~~wl~g~~~~p~~~~~~ii~~I   79 (82)
T 1puz_A            1 MMVFDDIAKRKIRFQT-RRGLLELDLIFGRFMEKEFEHLSDKELSEFSEILEFQDQELLALINGHSETDKGHLIPMLEKI   79 (82)
T ss_dssp             CCCCCHHHHHHHHHHS-CCSCHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHTSCHHHHHHHHHTCSCCSCTTHHHHHHHH
T ss_pred             CCCCCHHHHHHHHHHH-CCCHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHCCCCHHHHHHHHCCCCCCCHHHHHHHHHH
T ss_conf             9746488998999994-132599999999999998987999999999999859909999999489999929999999998


Q ss_pred             HH
Q ss_conf             99
Q gi|254780946|r   81 YD   82 (98)
Q Consensus        81 ~~   82 (98)
                      +.
T Consensus        80 rk   81 (82)
T 1puz_A           80 RR   81 (82)
T ss_dssp             HH
T ss_pred             HC
T ss_conf             70