BLAST/PSIBLAST alignment of GI: 254780946 and GI: 159184914 at iteration 1
>gi|159184914|ref|NP_354764.2| hypothetical protein Atu1779 [Agrobacterium tumefaciens str. C58] Length = 103
>gi|159140193|gb|AAK87549.2| conserved hypothetical protein [Agrobacterium tumefaciens str. C58] Length = 103
 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 36/84 (42%), Positives = 55/84 (65%)

Query: 3  KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
           +++ + R+I+YRCW RG REMDL+LG F +  I  LS  +L  LE I+ E+D++L +  
Sbjct: 9  ADLDPRRRRILYRCWHRGIREMDLVLGQFAEDNIAGLSDEQLDELEIIMAEEDNDLVQMV 68

Query: 63 TGMEKPPEYLRTPIFKKIYDYYSN 86
          TG +  PE  +TP+F+KI  Y  +
Sbjct: 69 TGAQPVPEKFQTPLFEKIASYRPD 92