BLAST/PSIBLAST alignment of GI: 254780946 and GI: 190891738 at iteration 1
>gi|190891738|ref|YP_001978280.1| hypothetical protein RHECIAT_CH0002144 [Rhizobium etli CIAT 652] Length = 127
>gi|190697017|gb|ACE91102.1| hypothetical conserved protein [Rhizobium etli CIAT 652] Length = 127
 Score = 76.6 bits (187), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 32/77 (41%), Positives = 48/77 (62%)

Query: 10  RKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPP 69
           R+I++RCW RG REMDL+ G F +  I  LS  EL   E+I+ E+D++L +W  G    P
Sbjct: 42  RRILFRCWHRGIREMDLVFGQFAEAEIATLSDAELDEFETIMAEEDNDLVRWIMGTWPVP 101

Query: 70  EYLRTPIFKKIYDYYSN 86
           E  +TP+F ++  Y  +
Sbjct: 102 ERFQTPMFARLAAYTPD 118