BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780946|ref|YP_003065359.1| hypothetical protein
CLIBASIA_04225 [Candidatus Liberibacter asiaticus str. psy62]
         (98 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780946|ref|YP_003065359.1| hypothetical protein CLIBASIA_04225 [Candidatus Liberibacter
          asiaticus str. psy62]
 gi|254040623|gb|ACT57419.1| hypothetical protein CLIBASIA_04225 [Candidatus Liberibacter
          asiaticus str. psy62]
          Length = 98

 Score =  204 bits (518), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 98/98 (100%), Positives = 98/98 (100%)

Query: 1  MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
          MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK
Sbjct: 1  MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60

Query: 61 WFTGMEKPPEYLRTPIFKKIYDYYSNNLDRKNMLGSLQ 98
          WFTGMEKPPEYLRTPIFKKIYDYYSNNLDRKNMLGSLQ
Sbjct: 61 WFTGMEKPPEYLRTPIFKKIYDYYSNNLDRKNMLGSLQ 98


>gi|315122359|ref|YP_004062848.1| hypothetical protein CKC_03055 [Candidatus Liberibacter
          solanacearum CLso-ZC1]
 gi|313495761|gb|ADR52360.1| hypothetical protein CKC_03055 [Candidatus Liberibacter
          solanacearum CLso-ZC1]
          Length = 75

 Score =  121 bits (303), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 60/75 (80%), Positives = 66/75 (88%)

Query: 24 MDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPEYLRTPIFKKIYDY 83
          MD ILGSFVD FIL+LS +EL MLESIIEEDDSNLFKWFTG+EK PE+L TPIFKKI DY
Sbjct: 1  MDFILGSFVDQFILDLSPIELDMLESIIEEDDSNLFKWFTGIEKVPEHLCTPIFKKICDY 60

Query: 84 YSNNLDRKNMLGSLQ 98
          YS NL+ KN+LGSLQ
Sbjct: 61 YSINLNHKNILGSLQ 75


>gi|163760201|ref|ZP_02167284.1| hypothetical protein HPDFL43_08064 [Hoeflea phototrophica DFL-43]
 gi|162282600|gb|EDQ32888.1| hypothetical protein HPDFL43_08064 [Hoeflea phototrophica DFL-43]
          Length = 107

 Score = 83.6 bits (205), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 34/83 (40%), Positives = 54/83 (65%)

Query: 4  NMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFT 63
          +++ + R+I+ R WRRG REMDL++G F D  I  L   EL  LE++++EDD ++ KW T
Sbjct: 10 DLDPRRRRILVRAWRRGIREMDLVIGGFADAEIGTLDEAELDQLEALMDEDDGDILKWVT 69

Query: 64 GMEKPPEYLRTPIFKKIYDYYSN 86
          G  + PE  RT +F+++  Y  +
Sbjct: 70 GEAETPERFRTAVFERMRAYVPD 92


>gi|222085972|ref|YP_002544504.1| hypothetical protein Arad_2362 [Agrobacterium radiobacter K84]
 gi|221723420|gb|ACM26576.1| conserved hypothetical protein [Agrobacterium radiobacter K84]
          Length = 104

 Score = 80.1 bits (196), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 35/93 (37%), Positives = 59/93 (63%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
            +++ + R+I++RCW RG REMDL+ G F D+ +  LS  +L   E I++E+D++L +W 
Sbjct: 9   ADLDPRRRRILFRCWHRGLREMDLVFGQFADNELPGLSETDLDEFERIMDEEDNDLVRWI 68

Query: 63  TGMEKPPEYLRTPIFKKIYDYYSNNLDRKNMLG 95
            G    PE+L+TP+FK++  Y  +  +    LG
Sbjct: 69  LGTLPVPEHLQTPLFKRVAAYKPDFEEVAERLG 101


>gi|159184914|ref|NP_354764.2| hypothetical protein Atu1779 [Agrobacterium tumefaciens str. C58]
 gi|159140193|gb|AAK87549.2| conserved hypothetical protein [Agrobacterium tumefaciens str.
          C58]
          Length = 103

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 36/84 (42%), Positives = 55/84 (65%)

Query: 3  KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
           +++ + R+I+YRCW RG REMDL+LG F +  I  LS  +L  LE I+ E+D++L +  
Sbjct: 9  ADLDPRRRRILYRCWHRGIREMDLVLGQFAEDNIAGLSDEQLDELEIIMAEEDNDLVQMV 68

Query: 63 TGMEKPPEYLRTPIFKKIYDYYSN 86
          TG +  PE  +TP+F+KI  Y  +
Sbjct: 69 TGAQPVPEKFQTPLFEKIASYRPD 92


>gi|154248181|ref|YP_001419139.1| hypothetical protein Xaut_4261 [Xanthobacter autotrophicus Py2]
 gi|154162266|gb|ABS69482.1| protein of unknown function DUF339 [Xanthobacter autotrophicus
          Py2]
          Length = 98

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 34/81 (41%), Positives = 50/81 (61%)

Query: 4  NMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFT 63
           ++ + R+I++R W RG REMDLILG F +  I  LS  EL   E+++E DD  +F W +
Sbjct: 10 GLDERRRRILFRAWHRGMREMDLILGGFANVEIETLSDAELDAFEALLEPDDQKVFSWIS 69

Query: 64 GMEKPPEYLRTPIFKKIYDYY 84
            E  P    TP+F+KI D++
Sbjct: 70 ASEPTPAEFDTPLFRKIRDFH 90


>gi|158422844|ref|YP_001524136.1| hypothetical protein AZC_1220 [Azorhizobium caulinodans ORS 571]
 gi|158329733|dbj|BAF87218.1| uncharacterized conserved protein [Azorhizobium caulinodans ORS
          571]
          Length = 98

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 34/83 (40%), Positives = 52/83 (62%)

Query: 2  KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
             ++++ R+I+YR W RGTREMDLI+G F D  I  L+  E+ + E ++E +D +LF W
Sbjct: 8  SAGLDVRRRRIIYRAWHRGTREMDLIMGRFADANIETLTEAEVDIFEHLLEIEDPDLFSW 67

Query: 62 FTGMEKPPEYLRTPIFKKIYDYY 84
           +G    P  L TP F+KI  ++
Sbjct: 68 LSGSLPVPAELDTPFFRKIQTWH 90


>gi|188583861|ref|YP_001927306.1| hypothetical protein Mpop_4675 [Methylobacterium populi BJ001]
 gi|179347359|gb|ACB82771.1| protein of unknown function DUF339 [Methylobacterium populi
          BJ001]
          Length = 98

 Score = 78.6 bits (192), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 32/85 (37%), Positives = 55/85 (64%)

Query: 3  KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
           +++ + R+ ++R W RG REMDLI+G F D  I +LS  EL   E++IE  D +LF+W 
Sbjct: 9  ADLDPRRRRTLFRAWHRGIREMDLIMGRFADAEIGDLSEEELAQFEALIEVPDRDLFRWL 68

Query: 63 TGMEKPPEYLRTPIFKKIYDYYSNN 87
          TG +  PE   TP+++++  ++ ++
Sbjct: 69 TGEDATPENYDTPVYRRLQAFHRHD 93


>gi|325293165|ref|YP_004279029.1| hypothetical protein AGROH133_06781 [Agrobacterium sp. H13-3]
 gi|325061018|gb|ADY64709.1| hypothetical protein AGROH133_06781 [Agrobacterium sp. H13-3]
          Length = 103

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 54/84 (64%)

Query: 3  KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
           +++ + R+I+YRCW RG REMDL+LG F +  I  LS  +L  LE I+ E+D++L K  
Sbjct: 9  ADLDPRRRRILYRCWHRGIREMDLVLGQFAEDNIAGLSDDQLDELEIIMAEEDNDLVKMV 68

Query: 63 TGMEKPPEYLRTPIFKKIYDYYSN 86
          TG    PE  +TP+F+KI  Y  +
Sbjct: 69 TGALPVPEKFQTPLFEKIASYRPD 92


>gi|190891738|ref|YP_001978280.1| hypothetical protein RHECIAT_CH0002144 [Rhizobium etli CIAT 652]
 gi|190697017|gb|ACE91102.1| hypothetical conserved protein [Rhizobium etli CIAT 652]
          Length = 127

 Score = 76.6 bits (187), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 32/77 (41%), Positives = 48/77 (62%)

Query: 10  RKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPP 69
           R+I++RCW RG REMDL+ G F +  I  LS  EL   E+I+ E+D++L +W  G    P
Sbjct: 42  RRILFRCWHRGIREMDLVFGQFAEAEIATLSDAELDEFETIMAEEDNDLVRWIMGTWPVP 101

Query: 70  EYLRTPIFKKIYDYYSN 86
           E  +TP+F ++  Y  +
Sbjct: 102 ERFQTPMFARLAAYTPD 118


>gi|241204638|ref|YP_002975734.1| hypothetical protein Rleg_1913 [Rhizobium leguminosarum bv.
          trifolii WSM1325]
 gi|240858528|gb|ACS56195.1| protein of unknown function DUF339 [Rhizobium leguminosarum bv.
          trifolii WSM1325]
          Length = 101

 Score = 76.6 bits (187), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 51/84 (60%)

Query: 3  KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
            ++ + R+I++RCW RG REMDL+ G F +  +  LS  EL   E+I+ E+D++L +W 
Sbjct: 9  AGLDPRRRRILFRCWHRGIREMDLVFGQFAEAEVARLSEAELDEFETIMAEEDNDLVRWI 68

Query: 63 TGMEKPPEYLRTPIFKKIYDYYSN 86
           G    PE  +TP+F +I  Y  +
Sbjct: 69 MGTWPVPERFQTPMFARIAAYKPD 92


>gi|86357713|ref|YP_469605.1| hypothetical protein RHE_CH02094 [Rhizobium etli CFN 42]
 gi|86281815|gb|ABC90878.1| hypothetical conserved protein [Rhizobium etli CFN 42]
          Length = 127

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 47/74 (63%)

Query: 10  RKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPP 69
           R+I++RCW RG REMDL+ G F +  I  LS  EL   E+I+ E+D++L +W  G    P
Sbjct: 42  RRILFRCWHRGIREMDLVFGQFAEAEIATLSDAELDEFETIMAEEDNDLVRWIMGTWPVP 101

Query: 70  EYLRTPIFKKIYDY 83
           E  +TP+F ++  Y
Sbjct: 102 ERFQTPMFARLAAY 115


>gi|254469769|ref|ZP_05083174.1| TPR repeat region superfamily protein [Pseudovibrio sp. JE062]
 gi|211961604|gb|EEA96799.1| TPR repeat region superfamily protein [Pseudovibrio sp. JE062]
          Length = 103

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 51/80 (63%)

Query: 10  RKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPP 69
           ++IV+RC  RG +EMD++LG +V+  I +++  EL  LE  ++  D +LF WF G +  P
Sbjct: 23  KRIVFRCHHRGMKEMDIMLGGYVEKHIAQMNDEELNELEVFLQHHDQDLFSWFIGTKPVP 82

Query: 70  EYLRTPIFKKIYDYYSNNLD 89
           +   T +F+KI DYY +  D
Sbjct: 83  DEANTELFRKILDYYKDKSD 102


>gi|218462027|ref|ZP_03502118.1| hypothetical protein RetlK5_22233 [Rhizobium etli Kim 5]
          Length = 101

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 32/85 (37%), Positives = 51/85 (60%)

Query: 2  KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
             ++ + R+I++RCW RG REMDL+ G F +  I  LS  EL   E+I+ E+D++L +W
Sbjct: 8  SAGLDPRRRRILFRCWHRGIREMDLVFGQFAEAEIATLSDAELDEFETIMAEEDNDLLRW 67

Query: 62 FTGMEKPPEYLRTPIFKKIYDYYSN 86
            G    PE  +TP+F ++  Y  +
Sbjct: 68 IMGTWPVPERFQTPMFARLAAYTPD 92


>gi|218532419|ref|YP_002423235.1| hypothetical protein Mchl_4531 [Methylobacterium chloromethanicum
          CM4]
 gi|218524722|gb|ACK85307.1| protein of unknown function DUF339 [Methylobacterium
          chloromethanicum CM4]
          Length = 98

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 55/84 (65%)

Query: 4  NMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFT 63
          +++ + R+ ++R W RG REMDLI+G F D  I  LS  ELT  E++IE  D +LF+W T
Sbjct: 10 DLDPRRRRTLFRAWHRGIREMDLIMGRFADAEIGALSEEELTQFEALIEVPDRDLFRWLT 69

Query: 64 GMEKPPEYLRTPIFKKIYDYYSNN 87
          G ++ PE   T +++++  ++ ++
Sbjct: 70 GEDETPENYDTAVYRRLKAFHRHD 93


>gi|218514910|ref|ZP_03511750.1| hypothetical protein Retl8_15022 [Rhizobium etli 8C-3]
 gi|327188303|gb|EGE55522.1| hypothetical protein RHECNPAF_92009 [Rhizobium etli CNPAF512]
          Length = 101

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 32/85 (37%), Positives = 51/85 (60%)

Query: 2  KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
             ++ + R+I++RCW RG REMDL+ G F +  I  LS  EL   E+I+ E+D++L +W
Sbjct: 8  SAGLDPRRRRILFRCWHRGIREMDLVFGQFAEAEIATLSDAELDEFETIMAEEDNDLVRW 67

Query: 62 FTGMEKPPEYLRTPIFKKIYDYYSN 86
            G    PE  +TP+F ++  Y  +
Sbjct: 68 IMGTWPVPERFQTPMFARLAAYTPD 92


>gi|163853559|ref|YP_001641602.1| hypothetical protein Mext_4162 [Methylobacterium extorquens PA1]
 gi|254563489|ref|YP_003070584.1| hypothetical protein METDI5158 [Methylobacterium extorquens DM4]
 gi|163665164|gb|ABY32531.1| protein of unknown function DUF339 [Methylobacterium extorquens
          PA1]
 gi|254270767|emb|CAX26772.1| conserved hypothetical protein [Methylobacterium extorquens DM4]
          Length = 98

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 54/84 (64%)

Query: 4  NMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFT 63
          +++ + R+ ++R W RG REMDLI+G F D  I  LS  ELT  E++IE  D +LF+W T
Sbjct: 10 DLDPRRRRTLFRAWHRGIREMDLIMGRFADSEIGALSEEELTQFEALIEVPDRDLFRWLT 69

Query: 64 GMEKPPEYLRTPIFKKIYDYYSNN 87
          G +  PE   T +++++  ++ ++
Sbjct: 70 GEDATPENYDTAVYRRLKAFHRHD 93


>gi|209549325|ref|YP_002281242.1| hypothetical protein Rleg2_1729 [Rhizobium leguminosarum bv.
          trifolii WSM2304]
 gi|209535081|gb|ACI55016.1| protein of unknown function DUF339 [Rhizobium leguminosarum bv.
          trifolii WSM2304]
          Length = 101

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 32/85 (37%), Positives = 51/85 (60%)

Query: 2  KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
             ++ + R+I++RCW RG REMDL+ G F +  I  LS  EL   E+I+ E+D++L +W
Sbjct: 8  SAGLDPRRRRILFRCWHRGIREMDLVFGQFAEAEIATLSEAELDEFETIMAEEDNDLVRW 67

Query: 62 FTGMEKPPEYLRTPIFKKIYDYYSN 86
            G    PE  +TP+F ++  Y  +
Sbjct: 68 IMGTWPVPERFQTPMFARLAAYTPD 92


>gi|240140978|ref|YP_002965458.1| hypothetical protein MexAM1_META1p4551 [Methylobacterium
          extorquens AM1]
 gi|240010955|gb|ACS42181.1| conserved hypothetical protein [Methylobacterium extorquens AM1]
          Length = 98

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 54/84 (64%)

Query: 4  NMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFT 63
          +++ + R+ ++R W RG REMDLI+G F D  I  LS  ELT  E++IE  D +LF+W T
Sbjct: 10 DLDPRRRRTLFRAWHRGIREMDLIMGRFADAEIGALSEEELTQFEALIEVPDRDLFRWLT 69

Query: 64 GMEKPPEYLRTPIFKKIYDYYSNN 87
          G +  PE   T +++++  ++ ++
Sbjct: 70 GEDATPENYDTAVYRRLKAFHRHD 93


>gi|218670942|ref|ZP_03520613.1| hypothetical protein RetlG_04428 [Rhizobium etli GR56]
          Length = 92

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 32/85 (37%), Positives = 51/85 (60%)

Query: 2  KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
             ++ + R+I++RCW RG REMDL+ G F +  I  LS  EL   E+I+ E+D++L +W
Sbjct: 8  SAGLDPRRRRILFRCWHRGIREMDLVFGQFAEAEIATLSETELDEFETIMAEEDNDLVRW 67

Query: 62 FTGMEKPPEYLRTPIFKKIYDYYSN 86
            G    PE  +TP+F ++  Y  +
Sbjct: 68 IMGTWPVPERFQTPMFARLAAYTPD 92


>gi|37728038|gb|AAO43499.1| unknown [Rhizobium etli]
          Length = 101

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 51/84 (60%)

Query: 3  KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
            ++ + R+I++RCW RG REMDL+ G F +  I  LS  EL   E+I+ E+D++L +W 
Sbjct: 9  AGLDPRRRRILFRCWHRGIREMDLVFGQFAEAEIATLSDAELDEFETIMAEEDNDLVRWI 68

Query: 63 TGMEKPPEYLRTPIFKKIYDYYSN 86
           G    PE  +TP+F ++  Y  +
Sbjct: 69 MGTWPVPERFQTPMFARLAAYKPD 92


>gi|46204975|ref|ZP_00049218.2| COG2938: Uncharacterized conserved protein [Magnetospirillum
          magnetotacticum MS-1]
          Length = 98

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 55/84 (65%)

Query: 4  NMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFT 63
          +++ + R+ ++R W RG REMDLI+G F D  I +LS  ELT  E++IE  D +LF+W T
Sbjct: 10 DLDPRRRRTLFRAWHRGIREMDLIMGRFADSEIGDLSEEELTEFEALIEVPDRDLFRWLT 69

Query: 64 GMEKPPEYLRTPIFKKIYDYYSNN 87
          G  + PE   T +++++  ++ ++
Sbjct: 70 GEAETPENYDTAVYRRLKAFHKHD 93


>gi|116252137|ref|YP_767975.1| hypothetical protein RL2385 [Rhizobium leguminosarum bv. viciae
          3841]
 gi|115256785|emb|CAK07875.1| conserved hypothetical protein [Rhizobium leguminosarum bv.
          viciae 3841]
          Length = 101

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 50/84 (59%)

Query: 3  KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
            ++ + R+I++RCW RG REMDL+ G F +  I  LS  EL   E+I+ E+D++L +W 
Sbjct: 9  AGLDPRRRRILFRCWHRGLREMDLVFGQFAEAEIAMLSEAELDEFETIMAEEDNDLVRWI 68

Query: 63 TGMEKPPEYLRTPIFKKIYDYYSN 86
           G    PE   TP+F +I  Y  +
Sbjct: 69 MGTWPVPERFHTPMFARIAAYKPD 92


>gi|49474196|ref|YP_032238.1| hypothetical protein BQ05830 [Bartonella quintana str. Toulouse]
 gi|49239700|emb|CAF26075.1| hypothetical protein BQ05830 [Bartonella quintana str. Toulouse]
          Length = 96

 Score = 75.5 bits (184), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 33/83 (39%), Positives = 54/83 (65%)

Query: 2  KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
          +  ++++ R++++R W RG RE+DLILG +VD  I E+S+  L+ LE I+  DD +L  W
Sbjct: 8  ENQLDIRRRRLIFRAWHRGIREIDLILGHYVDAHIGEMSNKMLSELEYIMSFDDRDLLTW 67

Query: 62 FTGMEKPPEYLRTPIFKKIYDYY 84
           TG   PP  +  P+F+ I +Y+
Sbjct: 68 ITGEISPPSEVDGPLFRDIINYH 90


>gi|182677885|ref|YP_001832031.1| hypothetical protein Bind_0893 [Beijerinckia indica subsp. indica
          ATCC 9039]
 gi|182633768|gb|ACB94542.1| protein of unknown function DUF339 [Beijerinckia indica subsp.
          indica ATCC 9039]
          Length = 98

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 53/84 (63%)

Query: 4  NMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFT 63
          +++ + R+I +R W RG REMDL+LG FVD  + +LS  EL  LE +++  D +LF W T
Sbjct: 10 HLDTRRRRIQFRAWHRGMREMDLLLGGFVDSELAKLSDAELDDLEHLMDALDRDLFTWLT 69

Query: 64 GMEKPPEYLRTPIFKKIYDYYSNN 87
          G    P    TP+F KI  +++++
Sbjct: 70 GEVALPADYDTPMFHKILAFHTHS 93


>gi|170748063|ref|YP_001754323.1| hypothetical protein Mrad2831_1645 [Methylobacterium
          radiotolerans JCM 2831]
 gi|170654585|gb|ACB23640.1| protein of unknown function DUF339 [Methylobacterium
          radiotolerans JCM 2831]
          Length = 98

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 32/85 (37%), Positives = 54/85 (63%)

Query: 3  KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
           +++ + R+++YR W RG REMDLI+G F D  I +LS  EL   E++IE  D +LFKW 
Sbjct: 9  ADLDPRRRRLLYRAWHRGIREMDLIMGRFADAEIGDLSEAELDQFEALIEVPDRDLFKWL 68

Query: 63 TGMEKPPEYLRTPIFKKIYDYYSNN 87
          TG  + P    T +++++  ++ ++
Sbjct: 69 TGEVETPSNYDTSVWQRVRAFHRHD 93


>gi|319408598|emb|CBI82253.1| conserved hypothetical protein [Bartonella schoenbuchensis R1]
          Length = 96

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 52/82 (63%)

Query: 2  KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
          K  +N + R++++R W RG REMDLILG +VD  I+E+S   ++ LE I+  +D +L  W
Sbjct: 8  KNQLNARRRRLIFRAWHRGIREMDLILGQYVDSHIIEMSDETISELEYIMSFEDRDLLMW 67

Query: 62 FTGMEKPPEYLRTPIFKKIYDY 83
           TG    P  + +P+F+ I +Y
Sbjct: 68 ITGEIPTPSEVDSPLFRDIANY 89


>gi|49475639|ref|YP_033680.1| hypothetical protein BH08760 [Bartonella henselae str. Houston-1]
 gi|49238446|emb|CAF27674.1| hypothetical protein BH08760 [Bartonella henselae str. Houston-1]
          Length = 96

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 33/83 (39%), Positives = 53/83 (63%)

Query: 2  KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
          +  ++L+ R++++R W RG REMDLILG +VD  I  +S  +++ LE I+  DD +L  W
Sbjct: 8  ENQLDLRRRRLIFRAWHRGIREMDLILGRYVDAHISGMSVKKISELEYIMSFDDRDLLTW 67

Query: 62 FTGMEKPPEYLRTPIFKKIYDYY 84
           TG   PP  +  P+F+ I +Y+
Sbjct: 68 ITGEISPPSEVDGPLFRDIINYH 90


>gi|240850602|ref|YP_002972002.1| hypothetical protein Bgr_10510 [Bartonella grahamii as4aup]
 gi|240267725|gb|ACS51313.1| hypothetical protein Bgr_10510 [Bartonella grahamii as4aup]
          Length = 95

 Score = 74.3 bits (181), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 51/82 (62%)

Query: 2  KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
          K  ++++ R++++R W RG REMDLI G +VD  I  ++   L+ LE I+  DD +L  W
Sbjct: 8  KNQLDVRRRRLIFRAWHRGIREMDLIFGHYVDAHITGMNDKTLSELEYIMSFDDRDLLTW 67

Query: 62 FTGMEKPPEYLRTPIFKKIYDY 83
           TG   PP  + +P+F+ I +Y
Sbjct: 68 ITGEVSPPSEVDSPLFRDIANY 89


>gi|150396614|ref|YP_001327081.1| hypothetical protein Smed_1400 [Sinorhizobium medicae WSM419]
 gi|150028129|gb|ABR60246.1| protein of unknown function DUF339 [Sinorhizobium medicae WSM419]
          Length = 103

 Score = 73.9 bits (180), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 34/83 (40%), Positives = 53/83 (63%)

Query: 4  NMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFT 63
          +++ + R+I++R W RG REMDLILG F +  +  LS  EL  LE+I+ E+D++L +W T
Sbjct: 10 DLDPRRRRILFRAWHRGIREMDLILGQFAEAELATLSEAELDELEAIMGEEDNDLVRWIT 69

Query: 64 GMEKPPEYLRTPIFKKIYDYYSN 86
          G +  PE   T +F +I  Y  +
Sbjct: 70 GEKPLPERYATELFLRIAAYRPD 92


>gi|222148734|ref|YP_002549691.1| hypothetical protein Avi_2364 [Agrobacterium vitis S4]
 gi|221735720|gb|ACM36683.1| conserved hypothetical protein [Agrobacterium vitis S4]
          Length = 115

 Score = 73.6 bits (179), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 31/80 (38%), Positives = 51/80 (63%)

Query: 2  KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
            +++ + R+I++RCW RG REMDL+LG F +  I  L+  EL  LE I+ E+D++L  W
Sbjct: 8  SADLDPRRRRILFRCWHRGIREMDLMLGQFAEAEISALNDAELDDLELIMAEEDNDLISW 67

Query: 62 FTGMEKPPEYLRTPIFKKIY 81
            G    P +++ P+F++I 
Sbjct: 68 INGAAPVPVHMQIPLFERIA 87


>gi|220926925|ref|YP_002502227.1| hypothetical protein Mnod_7184 [Methylobacterium nodulans ORS
          2060]
 gi|219951532|gb|ACL61924.1| protein of unknown function DUF339 [Methylobacterium nodulans ORS
          2060]
          Length = 98

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 51/85 (60%)

Query: 3  KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
           +++ + R+ ++R W RG REMDLI+G F D  I  L+  EL   E +IE  D +LF+W 
Sbjct: 9  ADLDPRRRRTLFRSWHRGIREMDLIMGRFADAEIGTLTDAELDEFERLIEVPDRDLFRWI 68

Query: 63 TGMEKPPEYLRTPIFKKIYDYYSNN 87
           G E+ P    TP+F+++  ++ + 
Sbjct: 69 CGEEEAPANYDTPVFRRLKGFHQHG 93


>gi|15965405|ref|NP_385758.1| hypothetical protein SMc00227 [Sinorhizobium meliloti 1021]
 gi|307308796|ref|ZP_07588492.1| protein of unknown function DUF339 [Sinorhizobium meliloti
          BL225C]
 gi|307317269|ref|ZP_07596710.1| protein of unknown function DUF339 [Sinorhizobium meliloti AK83]
 gi|15074586|emb|CAC46231.1| Conserved hypothetical protein [Sinorhizobium meliloti 1021]
 gi|306897357|gb|EFN28102.1| protein of unknown function DUF339 [Sinorhizobium meliloti AK83]
 gi|306900802|gb|EFN31413.1| protein of unknown function DUF339 [Sinorhizobium meliloti
          BL225C]
          Length = 101

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 34/83 (40%), Positives = 53/83 (63%)

Query: 4  NMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFT 63
          +++ + R+I++R W RG REMDLILG F +  +  LS  EL  LE+I+ E+D++L +W T
Sbjct: 10 DLDPRRRRILFRAWHRGIREMDLILGQFAEAELATLSEAELDELEAIMGEEDNDLVRWIT 69

Query: 64 GMEKPPEYLRTPIFKKIYDYYSN 86
          G +  PE   T +F +I  Y  +
Sbjct: 70 GEKPLPERYATELFFRIAAYRPD 92


>gi|170744354|ref|YP_001773009.1| hypothetical protein M446_6309 [Methylobacterium sp. 4-46]
 gi|168198628|gb|ACA20575.1| protein of unknown function DUF339 [Methylobacterium sp. 4-46]
          Length = 98

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 31/84 (36%), Positives = 52/84 (61%)

Query: 4  NMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFT 63
          +++ + R+ ++R W RG REMDLI+G F D  I  L+  EL   E +IE  D +LF+W +
Sbjct: 10 DLDPRRRRTLFRSWHRGIREMDLIMGRFADAEIGTLTEEELDNFERLIEVPDRDLFRWIS 69

Query: 64 GMEKPPEYLRTPIFKKIYDYYSNN 87
          G E+ P    TP+F+++  ++ + 
Sbjct: 70 GEEEAPSNYDTPVFRRLKGFHQHG 93


>gi|163868354|ref|YP_001609563.1| hypothetical protein Btr_1198 [Bartonella tribocorum CIP 105476]
 gi|161018010|emb|CAK01568.1| conserved hypothetical protein [Bartonella tribocorum CIP 105476]
          Length = 95

 Score = 72.8 bits (177), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 50/82 (60%)

Query: 2  KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
          K  ++ + R++++R W RG REMDLI G +VD  I  ++   L+ LE I+  DD +L  W
Sbjct: 8  KNQLDARRRRLIFRAWHRGIREMDLIFGHYVDAHITGMNDKTLSELEYIMSFDDRDLLTW 67

Query: 62 FTGMEKPPEYLRTPIFKKIYDY 83
           TG   PP  + +P+F+ I +Y
Sbjct: 68 ITGEILPPSEIDSPLFRDIANY 89


>gi|153010962|ref|YP_001372176.1| hypothetical protein Oant_3641 [Ochrobactrum anthropi ATCC 49188]
 gi|151562850|gb|ABS16347.1| protein of unknown function DUF339 [Ochrobactrum anthropi ATCC
          49188]
          Length = 95

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 32/81 (39%), Positives = 50/81 (61%)

Query: 3  KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
          +N++++ RK+++R W RG REMDLILG + D +I+  +  +L   E I+E  D +L KW 
Sbjct: 9  ENLDVRRRKLLFRAWHRGMREMDLILGQYADEYIVGFTDPQLNEFEHILEVLDRDLLKWV 68

Query: 63 TGMEKPPEYLRTPIFKKIYDY 83
          TG    P    TP+F+ I  +
Sbjct: 69 TGESPIPADYDTPLFRDIVAF 89


>gi|294853623|ref|ZP_06794295.1| hypothetical protein BAZG_02599 [Brucella sp. NVSL 07-0026]
 gi|294819278|gb|EFG36278.1| hypothetical protein BAZG_02599 [Brucella sp. NVSL 07-0026]
          Length = 110

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 32/81 (39%), Positives = 50/81 (61%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
           +N++++ RK+++R W RG REMDLILG + D +I+  +  +L   E I+E  D +L KW 
Sbjct: 24  ENLDVRRRKLLFRAWHRGMREMDLILGQYADKYIVSFNDDQLNEFEHILEVLDRDLLKWV 83

Query: 63  TGMEKPPEYLRTPIFKKIYDY 83
           TG    P    TP+F+ I  +
Sbjct: 84  TGESPIPAEYDTPLFRDIVAF 104


>gi|23500324|ref|NP_699764.1| hypothetical protein BRA0580 [Brucella suis 1330]
 gi|62317563|ref|YP_223416.1| hypothetical protein BruAb2_0644 [Brucella abortus bv. 1 str.
          9-941]
 gi|83269544|ref|YP_418835.1| hypothetical protein BAB2_0660 [Brucella melitensis biovar
          Abortus 2308]
 gi|148558220|ref|YP_001257568.1| hypothetical protein BOV_A0545 [Brucella ovis ATCC 25840]
 gi|161620642|ref|YP_001594528.1| hypothetical protein BCAN_B0580 [Brucella canis ATCC 23365]
 gi|163844732|ref|YP_001622387.1| hypothetical protein BSUIS_B0576 [Brucella suis ATCC 23445]
 gi|189022817|ref|YP_001932558.1| Protein of unknown function DUF339 [Brucella abortus S19]
 gi|225686366|ref|YP_002734338.1| hypothetical protein BMEA_B0554 [Brucella melitensis ATCC 23457]
 gi|254691060|ref|ZP_05154314.1| hypothetical protein Babob68_13104 [Brucella abortus bv. 6 str.
          870]
 gi|254695634|ref|ZP_05157462.1| hypothetical protein Babob3T_13532 [Brucella abortus bv. 3 str.
          Tulya]
 gi|254698845|ref|ZP_05160673.1| hypothetical protein Babob28_14417 [Brucella abortus bv. 2 str.
          86/8/59]
 gi|254699817|ref|ZP_05161645.1| hypothetical protein Bsuib55_03001 [Brucella suis bv. 5 str. 513]
 gi|254702955|ref|ZP_05164783.1| hypothetical protein Bsuib36_03259 [Brucella suis bv. 3 str. 686]
 gi|254705927|ref|ZP_05167755.1| hypothetical protein BpinM_02696 [Brucella pinnipedialis
          M163/99/10]
 gi|254711151|ref|ZP_05172962.1| hypothetical protein BpinB_12992 [Brucella pinnipedialis B2/94]
 gi|254712391|ref|ZP_05174202.1| hypothetical protein BcetM6_03231 [Brucella ceti M644/93/1]
 gi|254715463|ref|ZP_05177274.1| hypothetical protein BcetM_03251 [Brucella ceti M13/05/1]
 gi|254720433|ref|ZP_05182244.1| hypothetical protein Bru83_13077 [Brucella sp. 83/13]
 gi|254732292|ref|ZP_05190870.1| hypothetical protein Babob42_14205 [Brucella abortus bv. 4 str.
          292]
 gi|256015356|ref|YP_003105365.1| hypothetical protein BMI_II574 [Brucella microti CCM 4915]
 gi|256029532|ref|ZP_05443146.1| hypothetical protein BpinM2_02555 [Brucella pinnipedialis
          M292/94/1]
 gi|256059227|ref|ZP_05449433.1| hypothetical protein Bneo5_02547 [Brucella neotomae 5K33]
 gi|256111503|ref|ZP_05452517.1| hypothetical protein Bmelb3E_02664 [Brucella melitensis bv. 3
          str. Ether]
 gi|256157727|ref|ZP_05455645.1| hypothetical protein BcetM4_02580 [Brucella ceti M490/95/1]
 gi|256253302|ref|ZP_05458838.1| hypothetical protein BcetB_03181 [Brucella ceti B1/94]
 gi|256256245|ref|ZP_05461781.1| hypothetical protein Babob9C_02540 [Brucella abortus bv. 9 str.
          C68]
 gi|256262493|ref|ZP_05465025.1| conserved hypothetical protein [Brucella melitensis bv. 2 str.
          63/9]
 gi|260167378|ref|ZP_05754189.1| hypothetical protein BruF5_03139 [Brucella sp. F5/99]
 gi|260544800|ref|ZP_05820621.1| conserved hypothetical protein [Brucella abortus NCTC 8038]
 gi|260568133|ref|ZP_05838602.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40]
 gi|260756657|ref|ZP_05869005.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870]
 gi|260760088|ref|ZP_05872436.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292]
 gi|260763326|ref|ZP_05875658.1| conserved hypothetical protein [Brucella abortus bv. 2 str.
          86/8/59]
 gi|260882474|ref|ZP_05894088.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68]
 gi|261216032|ref|ZP_05930313.1| conserved hypothetical protein [Brucella abortus bv. 3 str.
          Tulya]
 gi|261217196|ref|ZP_05931477.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261220416|ref|ZP_05934697.1| conserved hypothetical protein [Brucella ceti B1/94]
 gi|261313355|ref|ZP_05952552.1| conserved hypothetical protein [Brucella pinnipedialis
          M163/99/10]
 gi|261318743|ref|ZP_05957940.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261320067|ref|ZP_05959264.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|261323177|ref|ZP_05962374.1| conserved hypothetical protein [Brucella neotomae 5K33]
 gi|261750289|ref|ZP_05993998.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513]
 gi|261753562|ref|ZP_05997271.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686]
 gi|261756786|ref|ZP_06000495.1| conserved hypothetical protein [Brucella sp. F5/99]
 gi|265985453|ref|ZP_06098188.1| conserved hypothetical protein [Brucella sp. 83/13]
 gi|265986541|ref|ZP_06099098.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1]
 gi|265993001|ref|ZP_06105558.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
          Ether]
 gi|265996233|ref|ZP_06108790.1| conserved hypothetical protein [Brucella ceti M490/95/1]
 gi|297249603|ref|ZP_06933304.1| hypothetical protein BAYG_02362 [Brucella abortus bv. 5 str.
          B3196]
 gi|306838990|ref|ZP_07471811.1| protein of unknown function DUF339 [Brucella sp. NF 2653]
 gi|306841772|ref|ZP_07474458.1| protein of unknown function DUF339 [Brucella sp. BO2]
 gi|306845911|ref|ZP_07478479.1| protein of unknown function DUF339 [Brucella sp. BO1]
 gi|23463937|gb|AAN33769.1| conserved hypothetical protein [Brucella suis 1330]
 gi|62197756|gb|AAX76055.1| conserved hypothetical protein [Brucella abortus bv. 1 str.
          9-941]
 gi|82939818|emb|CAJ12826.1| Protein of unknown function DUF339 [Brucella melitensis biovar
          Abortus 2308]
 gi|148369505|gb|ABQ62377.1| conserved hypothetical protein [Brucella ovis ATCC 25840]
 gi|161337453|gb|ABX63757.1| protein of unknown function DUF339 [Brucella canis ATCC 23365]
 gi|163675455|gb|ABY39565.1| Hypothetical protein, conserved [Brucella suis ATCC 23445]
 gi|189021391|gb|ACD74112.1| Protein of unknown function DUF339 [Brucella abortus S19]
 gi|225642471|gb|ACO02384.1| protein of unknown function DUF339 [Brucella melitensis ATCC
          23457]
 gi|255998016|gb|ACU49703.1| hypothetical protein BMI_II574 [Brucella microti CCM 4915]
 gi|260098071|gb|EEW81945.1| conserved hypothetical protein [Brucella abortus NCTC 8038]
 gi|260154798|gb|EEW89879.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40]
 gi|260670406|gb|EEX57346.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292]
 gi|260673747|gb|EEX60568.1| conserved hypothetical protein [Brucella abortus bv. 2 str.
          86/8/59]
 gi|260676765|gb|EEX63586.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870]
 gi|260872002|gb|EEX79071.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68]
 gi|260917639|gb|EEX84500.1| conserved hypothetical protein [Brucella abortus bv. 3 str.
          Tulya]
 gi|260919000|gb|EEX85653.1| conserved hypothetical protein [Brucella ceti B1/94]
 gi|260922285|gb|EEX88853.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261292757|gb|EEX96253.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|261297966|gb|EEY01463.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261299157|gb|EEY02654.1| conserved hypothetical protein [Brucella neotomae 5K33]
 gi|261302381|gb|EEY05878.1| conserved hypothetical protein [Brucella pinnipedialis
          M163/99/10]
 gi|261736770|gb|EEY24766.1| conserved hypothetical protein [Brucella sp. F5/99]
 gi|261740042|gb|EEY27968.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513]
 gi|261743315|gb|EEY31241.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686]
 gi|262550530|gb|EEZ06691.1| conserved hypothetical protein [Brucella ceti M490/95/1]
 gi|262763871|gb|EEZ09903.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
          Ether]
 gi|263092230|gb|EEZ16527.1| conserved hypothetical protein [Brucella melitensis bv. 2 str.
          63/9]
 gi|264658738|gb|EEZ28999.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1]
 gi|264664045|gb|EEZ34306.1| conserved hypothetical protein [Brucella sp. 83/13]
 gi|297173472|gb|EFH32836.1| hypothetical protein BAYG_02362 [Brucella abortus bv. 5 str.
          B3196]
 gi|306273803|gb|EFM55641.1| protein of unknown function DUF339 [Brucella sp. BO1]
 gi|306288177|gb|EFM59564.1| protein of unknown function DUF339 [Brucella sp. BO2]
 gi|306405896|gb|EFM62154.1| protein of unknown function DUF339 [Brucella sp. NF 2653]
 gi|326410737|gb|ADZ67801.1| conserved hypothetical protein [Brucella melitensis M28]
 gi|326554030|gb|ADZ88669.1| conserved hypothetical protein [Brucella melitensis M5-90]
          Length = 95

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 32/81 (39%), Positives = 50/81 (61%)

Query: 3  KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
          +N++++ RK+++R W RG REMDLILG + D +I+  +  +L   E I+E  D +L KW 
Sbjct: 9  ENLDVRRRKLLFRAWHRGMREMDLILGQYADKYIVSFNDDQLNEFEHILEVLDRDLLKWV 68

Query: 63 TGMEKPPEYLRTPIFKKIYDY 83
          TG    P    TP+F+ I  +
Sbjct: 69 TGESPIPAEYDTPLFRDIVAF 89


>gi|225629076|ref|ZP_03787109.1| Hypothetical protein, conserved [Brucella ceti str. Cudo]
 gi|237817110|ref|ZP_04596102.1| Hypothetical protein, conserved [Brucella abortus str. 2308 A]
 gi|225615572|gb|EEH12621.1| Hypothetical protein, conserved [Brucella ceti str. Cudo]
 gi|237787923|gb|EEP62139.1| Hypothetical protein, conserved [Brucella abortus str. 2308 A]
          Length = 110

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 32/81 (39%), Positives = 50/81 (61%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
           +N++++ RK+++R W RG REMDLILG + D +I+  +  +L   E I+E  D +L KW 
Sbjct: 24  ENLDVRRRKLLFRAWHRGMREMDLILGQYADKYIVSFNDDQLNEFEHILEVLDRDLLKWV 83

Query: 63  TGMEKPPEYLRTPIFKKIYDY 83
           TG    P    TP+F+ I  +
Sbjct: 84  TGESPIPAEYDTPLFRDIVAF 104


>gi|239833943|ref|ZP_04682271.1| Hypothetical protein, conserved [Ochrobactrum intermedium LMG 3301]
 gi|239822006|gb|EEQ93575.1| Hypothetical protein, conserved [Ochrobactrum intermedium LMG 3301]
          Length = 178

 Score = 72.0 bits (175), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 32/81 (39%), Positives = 50/81 (61%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
           +N++++ RK+++R W RG REMDLILG + D +I+  +  +L   E I+E  D +L KW 
Sbjct: 92  ENLDVRRRKLLFRAWHRGMREMDLILGQYADAYIVGFTDPQLDEFEHILEVLDRDLLKWV 151

Query: 63  TGMEKPPEYLRTPIFKKIYDY 83
           TG    P    TP+F+ I  +
Sbjct: 152 TGESPIPADYDTPLFRDIVAF 172


>gi|298291680|ref|YP_003693619.1| hypothetical protein Snov_1695 [Starkeya novella DSM 506]
 gi|296928191|gb|ADH89000.1| protein of unknown function DUF339 [Starkeya novella DSM 506]
          Length = 98

 Score = 72.0 bits (175), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 48/82 (58%), Gaps = 1/82 (1%)

Query: 2  KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
             ++ + R+I+YR W RGTREMDL++G F D  I ++S  ++   E +IE +D +LF W
Sbjct: 8  SAGLDARRRRILYRSWHRGTREMDLLMGRFADKLIADMSDEDVADFEQLIEVEDPDLFGW 67

Query: 62 FTGMEKPPEYLRTPIFKKIYDY 83
                 PEY  TPIF +   +
Sbjct: 68 LASGIPAPEY-DTPIFHRFRQF 88


>gi|114704428|ref|ZP_01437336.1| hypothetical protein FP2506_05826 [Fulvimarina pelagi HTCC2506]
 gi|114539213|gb|EAU42333.1| hypothetical protein FP2506_05826 [Fulvimarina pelagi HTCC2506]
          Length = 148

 Score = 71.2 bits (173), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 29/83 (34%), Positives = 52/83 (62%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
           ++++ + +K ++R W RGTREMDL+ G F D  I  LS  ++   E+++   D  +FKW 
Sbjct: 52  EDLDTRRKKALFRSWHRGTREMDLVFGRFADAEIATLSDEDMDHYEALMLAPDPEIFKWV 111

Query: 63  TGMEKPPEYLRTPIFKKIYDYYS 85
           +G +  P    TP+F++I ++Y+
Sbjct: 112 SGEKAVPGNYDTPVFRRIKEFYT 134


>gi|115524795|ref|YP_781706.1| hypothetical protein RPE_2789 [Rhodopseudomonas palustris BisA53]
 gi|115518742|gb|ABJ06726.1| protein of unknown function DUF339 [Rhodopseudomonas palustris
          BisA53]
          Length = 96

 Score = 70.9 bits (172), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 50/82 (60%), Gaps = 2/82 (2%)

Query: 10 RKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPP 69
          +++++RCW RGTREMDLILG F D  I  LS VE+  LE + E +D +L+   TG    P
Sbjct: 16 KRLLFRCWHRGTREMDLILGQFADAEIGTLSEVEVDELEGLTELNDHDLYAAVTGHGTLP 75

Query: 70 EYLRTPIFKKIYDYYSNNLDRK 91
             +  +F+++  Y   N DR+
Sbjct: 76 PQFQGGLFERVKTY--GNWDRQ 95


>gi|316934178|ref|YP_004109160.1| hypothetical protein Rpdx1_2844 [Rhodopseudomonas palustris DX-1]
 gi|315601892|gb|ADU44427.1| protein of unknown function DUF339 [Rhodopseudomonas palustris
          DX-1]
          Length = 96

 Score = 70.9 bits (172), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 46/74 (62%)

Query: 10 RKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPP 69
          +++++RCW RGTREMDLILG F D  I  LS  EL  LE +IE +D +L+    G +  P
Sbjct: 16 KRLLFRCWHRGTREMDLILGQFADAEIGTLSEAELDELERLIEVNDHDLYAAVAGGDTLP 75

Query: 70 EYLRTPIFKKIYDY 83
             +  +F++I  Y
Sbjct: 76 AEFKGGLFERIKTY 89


>gi|192291315|ref|YP_001991920.1| hypothetical protein Rpal_2937 [Rhodopseudomonas palustris TIE-1]
 gi|192285064|gb|ACF01445.1| protein of unknown function DUF339 [Rhodopseudomonas palustris
          TIE-1]
          Length = 96

 Score = 70.9 bits (172), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 46/74 (62%)

Query: 10 RKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPP 69
          +++++RCW RGTREMDLILG F D  I  LS  EL  LE +IE +D +L+    G +  P
Sbjct: 16 KRLLFRCWHRGTREMDLILGQFADAEIGTLSEAELDELERLIEVNDHDLYAAVAGGDTLP 75

Query: 70 EYLRTPIFKKIYDY 83
             +  +F++I  Y
Sbjct: 76 AEFKGGLFERIKTY 89


>gi|254502253|ref|ZP_05114404.1| hypothetical protein SADFL11_2291 [Labrenzia alexandrii DFL-11]
 gi|222438324|gb|EEE45003.1| hypothetical protein SADFL11_2291 [Labrenzia alexandrii DFL-11]
          Length = 105

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 47/75 (62%)

Query: 10 RKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPP 69
          +KI++RCW RG +EMDL+LG F +  I EL+  EL  LE ++   D +L+ W TG +  P
Sbjct: 21 KKILFRCWHRGMKEMDLLLGGFANAKIDELNEDELRELEHLLTAHDQDLYAWMTGRKSLP 80

Query: 70 EYLRTPIFKKIYDYY 84
               P++++I  Y+
Sbjct: 81 AEWDGPLYRRIIAYH 95


>gi|17989032|ref|NP_541665.1| putative cytoplasmic protein [Brucella melitensis bv. 1 str. 16M]
 gi|256043475|ref|ZP_05446404.1| putative cytoplasmic protein [Brucella melitensis bv. 1 str.
          Rev.1]
 gi|260564671|ref|ZP_05835156.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
          16M]
 gi|265989893|ref|ZP_06102450.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
          Rev.1]
 gi|17984873|gb|AAL53929.1| hypothetical cytosolic protein [Brucella melitensis bv. 1 str.
          16M]
 gi|260152314|gb|EEW87407.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
          16M]
 gi|263000562|gb|EEZ13252.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
          Rev.1]
          Length = 97

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 52/84 (61%), Gaps = 4/84 (4%)

Query: 3  KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
          +N++++ RK+++R W RG REMDLILG + D +I+  +  +L   E I+E  D +L KW 
Sbjct: 9  ENLDVRRRKLLFRAWHRGMREMDLILGQYADKYIVSFNDDQLNEFEHILEVLDRDLLKWV 68

Query: 63 TGMEKP---PEYLRTPIFKKIYDY 83
          TG E P   P    TP+F+ I  +
Sbjct: 69 TG-ESPSPIPAEYDTPLFRDIVAF 91


>gi|121602633|ref|YP_989089.1| hypothetical protein BARBAKC583_0797 [Bartonella bacilliformis
          KC583]
 gi|120614810|gb|ABM45411.1| conserved hypothetical protein [Bartonella bacilliformis KC583]
          Length = 97

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 51/81 (62%)

Query: 3  KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
          + ++++ R++++R W RG REMDL+ G +VD  I ++S   ++ LE I+  +D +L  W 
Sbjct: 10 QQLDIRRRRLIFRAWHRGIREMDLVFGPYVDAHISKMSDKAISELEYIMSFEDRDLLTWI 69

Query: 63 TGMEKPPEYLRTPIFKKIYDY 83
          TG    P  + TP+F+ + +Y
Sbjct: 70 TGEAITPPKVDTPLFRDVINY 90


>gi|91977092|ref|YP_569751.1| hypothetical protein RPD_2621 [Rhodopseudomonas palustris BisB5]
 gi|91683548|gb|ABE39850.1| protein of unknown function DUF339 [Rhodopseudomonas palustris
          BisB5]
          Length = 96

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 31/74 (41%), Positives = 45/74 (60%)

Query: 10 RKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPP 69
          +++++RCW RGTREMDLILG F D  I  L   EL  LE +IE +D +L+    G +  P
Sbjct: 16 KRLLFRCWHRGTREMDLILGQFADAEIGTLEDAELDELERLIELNDHDLYNAVAGADTLP 75

Query: 70 EYLRTPIFKKIYDY 83
             +  +F++I  Y
Sbjct: 76 AEFQGGLFERIKTY 89


>gi|90424108|ref|YP_532478.1| hypothetical protein RPC_2609 [Rhodopseudomonas palustris BisB18]
 gi|90106122|gb|ABD88159.1| protein of unknown function DUF339 [Rhodopseudomonas palustris
          BisB18]
          Length = 96

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 32/87 (36%), Positives = 53/87 (60%), Gaps = 2/87 (2%)

Query: 4  NMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFT 63
           ++++ ++++++CW RGTREMDLILG F D  I  L+  E+  LE +IE  D +L+   T
Sbjct: 10 GLDVRRKRLLFQCWHRGTREMDLILGQFADAEIGSLTDGEVDELERLIELTDHDLYAAVT 69

Query: 64 GMEKPPEYLRTPIFKKIYDYYSNNLDR 90
          G    P   +  +F+++  Y   N+DR
Sbjct: 70 GDAALPAPFQGGLFERVKTY--GNMDR 94


>gi|319898901|ref|YP_004158994.1| hypothetical protein BARCL_0735 [Bartonella clarridgeiae 73]
 gi|319402865|emb|CBI76416.1| conserved protein of unknown function [Bartonella clarridgeiae
          73]
          Length = 96

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 48/76 (63%)

Query: 10 RKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPP 69
          R++++R W RG REMDLILG +VD  I +++   ++ LE I+  +D +L  W TG    P
Sbjct: 16 RRLIFRAWHRGIREMDLILGQYVDAHIAKMNDQTVSELEYIMSFEDRDLLTWITGEVSVP 75

Query: 70 EYLRTPIFKKIYDYYS 85
            + +P+F+ I +Y S
Sbjct: 76 YKVDSPLFRDIINYRS 91


>gi|294678198|ref|YP_003578813.1| hypothetical protein [Rhodobacter capsulatus SB 1003]
 gi|294477018|gb|ADE86406.1| TPR repeat domain protein [Rhodobacter capsulatus SB 1003]
          Length = 90

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 30/91 (32%), Positives = 54/91 (59%), Gaps = 3/91 (3%)

Query: 1  MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
          M +    + +++  R WRRG REMDLILG + D  +    + +L + ++++EE+D +L+ 
Sbjct: 1  MSETHEARIKRMKMRSWRRGIREMDLILGPYADAKLEGFDTAQLDLFDTLLEENDQDLYP 60

Query: 61 WFTGMEK-PPEYLRTPIFKKIYDYYSNNLDR 90
          WF+G +  PP+Y+   +F +I  +    L R
Sbjct: 61 WFSGAQPCPPQYVD--LFAEIATFMQGKLAR 89


>gi|323136888|ref|ZP_08071968.1| protein of unknown function DUF339 [Methylocystis sp. ATCC 49242]
 gi|322397649|gb|EFY00171.1| protein of unknown function DUF339 [Methylocystis sp. ATCC 49242]
          Length = 100

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 30/82 (36%), Positives = 49/82 (59%), Gaps = 1/82 (1%)

Query: 6  NLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGM 65
           L+ R+I  R WRRG RE+D++LG FVD  +  LS  EL+  E +++  D+ L  W +G 
Sbjct: 16 ELRRRRIKIRAWRRGMRELDILLGGFVDAQLSALSDPELSEFEGLLDLPDAELLDWLSGA 75

Query: 66 EKPPEYLRTPIFKKIYDYYSNN 87
            PPE   T + ++I  ++++ 
Sbjct: 76 TPPPER-DTALLRRIIAFHTHE 96


>gi|319405679|emb|CBI79302.1| conserved hypothetical protein [Bartonella sp. AR 15-3]
          Length = 96

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 47/76 (61%)

Query: 10 RKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPP 69
          R++++R W RG RE+DLI G +VD  I ++S   ++ LE I+  +D +L  W TG    P
Sbjct: 16 RRLIFRAWHRGIREIDLIFGQYVDAHINKMSDQTVSKLEYIMSFEDRDLLTWITGEVSVP 75

Query: 70 EYLRTPIFKKIYDYYS 85
            + +P+F+ I +Y S
Sbjct: 76 SEVDSPLFRDIINYCS 91


>gi|110634055|ref|YP_674263.1| hypothetical protein Meso_1703 [Mesorhizobium sp. BNC1]
 gi|110285039|gb|ABG63098.1| protein of unknown function DUF339 [Chelativorans sp. BNC1]
          Length = 120

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 49/82 (59%), Gaps = 2/82 (2%)

Query: 1   MKKNMNLQCRK--IVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNL 58
           M+ + NL+ R+  I+ R WRRG REMDL+LG F D  I +LS  EL   E++++  D+ L
Sbjct: 30  MRSSANLEPRRRRILVRSWRRGMREMDLVLGGFADAHIEQLSDEELAQFEALLDVPDATL 89

Query: 59  FKWFTGMEKPPEYLRTPIFKKI 80
            +W TG         T +F++I
Sbjct: 90  LQWVTGEMPVTAPHDTALFERI 111


>gi|86749968|ref|YP_486464.1| hypothetical protein RPB_2851 [Rhodopseudomonas palustris HaA2]
 gi|86572996|gb|ABD07553.1| Protein of unknown function DUF339 [Rhodopseudomonas palustris
          HaA2]
          Length = 96

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 30/74 (40%), Positives = 44/74 (59%)

Query: 10 RKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPP 69
          +++++RCW RGTREMDLILG F D  I  L+  EL  LE +IE +D +L+      +  P
Sbjct: 16 KRLLFRCWHRGTREMDLILGQFADAEIGTLTDAELDELERLIELNDHDLYNAVADADTLP 75

Query: 70 EYLRTPIFKKIYDY 83
             +  +F +I  Y
Sbjct: 76 AEFKGGLFDRIKTY 89


>gi|159043316|ref|YP_001532110.1| hypothetical protein Dshi_0764 [Dinoroseobacter shibae DFL 12]
 gi|157911076|gb|ABV92509.1| protein of unknown function DUF339 [Dinoroseobacter shibae DFL
          12]
          Length = 99

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 42/63 (66%)

Query: 8  QCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEK 67
          + +++  R WRRG +EMDLILG + D  +  +S  EL   +++++E+D +L++W +G   
Sbjct: 23 RIKRMKIRAWRRGIKEMDLILGPYADTHLAGMSEAELDAFDALLKENDQDLYQWVSGQAA 82

Query: 68 PPE 70
          PPE
Sbjct: 83 PPE 85


>gi|92117583|ref|YP_577312.1| hypothetical protein Nham_2054 [Nitrobacter hamburgensis X14]
 gi|91800477|gb|ABE62852.1| protein of unknown function DUF339 [Nitrobacter hamburgensis X14]
          Length = 96

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 33/79 (41%), Positives = 49/79 (62%), Gaps = 2/79 (2%)

Query: 10 RKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEK-P 68
          +++++RCW RG RE+DLILG F D  I  L+  EL  LES+IE  D +L+   +G     
Sbjct: 16 KRLLFRCWHRGMREVDLILGRFADAEIGSLTDSELIDLESLIEVPDPDLYAALSGGAPLA 75

Query: 69 PEYLRTPIFKKIYDYYSNN 87
          PEY RT +F +I  + ++ 
Sbjct: 76 PEY-RTALFNRIKSFRTSG 93


>gi|57239551|ref|YP_180687.1| hypothetical protein Erum8240 [Ehrlichia ruminantium str.
          Welgevonden]
 gi|58579537|ref|YP_197749.1| hypothetical protein ERWE_CDS_08730 [Ehrlichia ruminantium str.
          Welgevonden]
 gi|58617591|ref|YP_196790.1| hypothetical protein ERGA_CDS_08640 [Ehrlichia ruminantium str.
          Gardel]
 gi|57161630|emb|CAH58559.1| conserved hypothetical protein [Ehrlichia ruminantium str.
          Welgevonden]
 gi|58417203|emb|CAI28316.1| Conserved hypothetical protein [Ehrlichia ruminantium str.
          Gardel]
 gi|58418163|emb|CAI27367.1| Conserved hypothetical protein [Ehrlichia ruminantium str.
          Welgevonden]
          Length = 93

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 46/74 (62%)

Query: 10 RKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPP 69
          ++++YR   RG +EMD+ILG+F  H I  LS  ++   E II  +D  L+K+ TG E  P
Sbjct: 9  KRLLYRSLHRGCKEMDIILGNFALHHIYLLSIEDVDEYEKIINTNDYQLYKYITGEELVP 68

Query: 70 EYLRTPIFKKIYDY 83
          EYL + I K I D+
Sbjct: 69 EYLSSNIIKNIVDF 82


>gi|114570036|ref|YP_756716.1| hypothetical protein Mmar10_1486 [Maricaulis maris MCS10]
 gi|114340498|gb|ABI65778.1| protein of unknown function DUF339 [Maricaulis maris MCS10]
          Length = 97

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 45/80 (56%)

Query: 1  MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
          M  +  +Q +K+  R WRRG +E DLILG F D  +  LS  E+   E +++E+D++++ 
Sbjct: 1  MTDDTEIQRKKLRIRAWRRGFKEADLILGRFADARLDGLSPAEVDDFERLLDENDADIYA 60

Query: 61 WFTGMEKPPEYLRTPIFKKI 80
          W  G E  P+    P+   +
Sbjct: 61 WIIGKEPTPDQFDGPVMDAL 80


>gi|103487137|ref|YP_616698.1| hypothetical protein Sala_1652 [Sphingopyxis alaskensis RB2256]
 gi|98977214|gb|ABF53365.1| protein of unknown function DUF339 [Sphingopyxis alaskensis
          RB2256]
          Length = 86

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 39/71 (54%)

Query: 5  MNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTG 64
          M  + +++ +R W RGTRE D ++G F D +       EL   E+++EEDD ++  W  G
Sbjct: 1  MTDRLKRLKFRAWHRGTREADYMIGGFFDRYSPAWGETELAWFEAVVEEDDVDIMAWALG 60

Query: 65 MEKPPEYLRTP 75
             PP +L  P
Sbjct: 61 TAAPPAHLDKP 71


>gi|75675706|ref|YP_318127.1| hypothetical protein Nwi_1514 [Nitrobacter winogradskyi Nb-255]
 gi|74420576|gb|ABA04775.1| Protein of unknown function DUF339 [Nitrobacter winogradskyi
           Nb-255]
          Length = 122

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 35/82 (42%), Positives = 51/82 (62%), Gaps = 2/82 (2%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
           + M+ + ++++YRCW RG REMDLILG FVD  I  L+  EL  LE++IE  D +L+   
Sbjct: 36  EGMDDRRKRLLYRCWHRGMREMDLILGRFVDEEIGSLTEAELKDLENLIEVPDPDLYAAL 95

Query: 63  T-GMEKPPEYLRTPIFKKIYDY 83
           + G     EY RT +F +I  +
Sbjct: 96  SDGAPLASEY-RTALFDRIKSF 116


>gi|77464337|ref|YP_353841.1| hypothetical protein RSP_0761 [Rhodobacter sphaeroides 2.4.1]
 gi|77388755|gb|ABA79940.1| conserved hypothetical protein [Rhodobacter sphaeroides 2.4.1]
          Length = 89

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 49/85 (57%), Gaps = 1/85 (1%)

Query: 6  NLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGM 65
          + + +++  R WRRGT+EMDLILG + D  +  LS   L + +S++ E+D +L  W  G 
Sbjct: 6  DARLKRMSMRSWRRGTKEMDLILGPWSDAHLAGLSEERLALYDSLLNENDQDLLPWVLGQ 65

Query: 66 EKPPEYLRTPIFKKIYDYYSNNLDR 90
           +PP +L   +  +I  +  + L R
Sbjct: 66 REPPAHL-AALIAEIGAFARSRLAR 89


>gi|85717290|ref|ZP_01048244.1| hypothetical protein NB311A_19335 [Nitrobacter sp. Nb-311A]
 gi|85695879|gb|EAQ33783.1| hypothetical protein NB311A_19335 [Nitrobacter sp. Nb-311A]
          Length = 95

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 35/82 (42%), Positives = 50/82 (60%), Gaps = 2/82 (2%)

Query: 3  KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
          + ++ + ++++YRCW RG REMDLILG FVD  I  L+  EL  LES+IE  D +L+   
Sbjct: 9  QGLDDRRKRLLYRCWHRGMREMDLILGRFVDEEIGSLTDGELNDLESLIEVPDPDLYAAL 68

Query: 63 T-GMEKPPEYLRTPIFKKIYDY 83
            G     EY RT +F +I  +
Sbjct: 69 NDGAPLASEY-RTALFDRIKSF 89


>gi|126463180|ref|YP_001044294.1| hypothetical protein Rsph17029_2420 [Rhodobacter sphaeroides ATCC
          17029]
 gi|332559229|ref|ZP_08413551.1| hypothetical protein RSWS8N_09240 [Rhodobacter sphaeroides WS8N]
 gi|126104844|gb|ABN77522.1| protein of unknown function DUF339 [Rhodobacter sphaeroides ATCC
          17029]
 gi|332276941|gb|EGJ22256.1| hypothetical protein RSWS8N_09240 [Rhodobacter sphaeroides WS8N]
          Length = 89

 Score = 64.3 bits (155), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 48/85 (56%), Gaps = 1/85 (1%)

Query: 6  NLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGM 65
          + + +++  R WRRGT+EMDLILG + D  +  LS   L + +S++ E+D +L  W  G 
Sbjct: 6  DARLKRMSMRSWRRGTKEMDLILGPWSDAHLAGLSEERLALYDSLLNENDQDLLPWVLGQ 65

Query: 66 EKPPEYLRTPIFKKIYDYYSNNLDR 90
           +PP +L   +  +I  +    L R
Sbjct: 66 REPPAHL-AALIAEIGAFARTRLAR 89


>gi|119383688|ref|YP_914744.1| hypothetical protein Pden_0937 [Paracoccus denitrificans PD1222]
 gi|119373455|gb|ABL69048.1| protein of unknown function DUF339 [Paracoccus denitrificans
          PD1222]
          Length = 81

 Score = 64.3 bits (155), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 31/80 (38%), Positives = 45/80 (56%), Gaps = 3/80 (3%)

Query: 15 RCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFT---GMEKPPEY 71
          R WRRGT+EMDLILG F D  +  L+  EL + E+++ E+D +L+ W T   G  +P   
Sbjct: 2  RSWRRGTKEMDLILGPFSDSELERLTEAELDLYEALLTENDQDLYPWITARLGDARPGPQ 61

Query: 72 LRTPIFKKIYDYYSNNLDRK 91
             PI  ++  +    L RK
Sbjct: 62 ALLPILDRVASFAHARLARK 81


>gi|146340718|ref|YP_001205766.1| hypothetical protein BRADO3770 [Bradyrhizobium sp. ORS278]
 gi|146193524|emb|CAL77540.1| conserved hypothetical protein [Bradyrhizobium sp. ORS278]
          Length = 77

 Score = 63.9 bits (154), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 48/79 (60%), Gaps = 4/79 (5%)

Query: 13 VYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEK-PPEY 71
          ++RCW RGTREMDLILG F D  I  L+  EL  LE ++E  D + +   TG    PPE 
Sbjct: 1  MFRCWHRGTREMDLILGRFADAEIGTLTESELDQLEQLLEVSDPDFYAAITGARPLPPE- 59

Query: 72 LRTP-IFKKIYDYYSNNLD 89
           +TP +F++I  + + + D
Sbjct: 60 -QTPALFERIKSFRAVDAD 77


>gi|146276466|ref|YP_001166625.1| hypothetical protein Rsph17025_0414 [Rhodobacter sphaeroides ATCC
          17025]
 gi|145554707|gb|ABP69320.1| protein of unknown function DUF339 [Rhodobacter sphaeroides ATCC
          17025]
          Length = 89

 Score = 63.5 bits (153), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 29/83 (34%), Positives = 47/83 (56%), Gaps = 1/83 (1%)

Query: 8  QCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEK 67
          + +++  R WRRGT+EMDLILG + D  +  LS   L + +S++ E+D +L  W  G  +
Sbjct: 8  RLKRMSMRSWRRGTKEMDLILGPWSDAHLAHLSEERLALYDSLLNENDQDLLPWILGQRE 67

Query: 68 PPEYLRTPIFKKIYDYYSNNLDR 90
          PP  L   +  +I ++    L R
Sbjct: 68 PPAPL-AALISEIGEFARTRLAR 89


>gi|221640223|ref|YP_002526485.1| hypothetical protein RSKD131_2124 [Rhodobacter sphaeroides KD131]
 gi|221161004|gb|ACM01984.1| Hypothetical Protein RSKD131_2124 [Rhodobacter sphaeroides KD131]
          Length = 89

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 48/85 (56%), Gaps = 1/85 (1%)

Query: 6  NLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGM 65
          + + +++  R WRRGT+EMDLILG + D  +  LS   L + +S++ E+D +L  W  G 
Sbjct: 6  DARLKRMSMRSWRRGTKEMDLILGPWSDAHLAGLSEDRLALYDSLLNENDQDLLPWVLGQ 65

Query: 66 EKPPEYLRTPIFKKIYDYYSNNLDR 90
           +PP +L   +  +I  +    L R
Sbjct: 66 REPPAHL-AGLIAEIGAFARTRLAR 89


>gi|217978361|ref|YP_002362508.1| protein of unknown function DUF339 [Methylocella silvestris BL2]
 gi|217503737|gb|ACK51146.1| protein of unknown function DUF339 [Methylocella silvestris BL2]
          Length = 98

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 28/83 (33%), Positives = 48/83 (57%)

Query: 4  NMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFT 63
          +++ + R+I +R W RG  E DL+LG F D  + +LS  EL   ++++E  D ++F W T
Sbjct: 10 SVDARRRRIKFRAWHRGMLETDLLLGRFADAEVEKLSLSELDDFDALLEALDRDVFAWAT 69

Query: 64 GMEKPPEYLRTPIFKKIYDYYSN 86
          G    P    TP+F++I  ++  
Sbjct: 70 GETPTPVEFDTPLFRRIVAFHGG 92


>gi|224136360|ref|XP_002322310.1| predicted protein [Populus trichocarpa]
 gi|222869306|gb|EEF06437.1| predicted protein [Populus trichocarpa]
          Length = 186

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 49/81 (60%), Gaps = 1/81 (1%)

Query: 9   CRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKP 68
           C +++YR  +RG  E+DL+LG +V+  I  +    +  L  +++ ++ +L+KW TG E+P
Sbjct: 71  CNRLLYRSRQRGFLELDLVLGKWVEEHIYSMDENGVKALIDVLDLENPDLWKWLTGQEQP 130

Query: 69  PEYLR-TPIFKKIYDYYSNNL 88
           PE +   P+F  + D   NNL
Sbjct: 131 PEAVSINPVFSAVRDKIMNNL 151


>gi|254421029|ref|ZP_05034753.1| TPR repeat region superfamily [Brevundimonas sp. BAL3]
 gi|196187206|gb|EDX82182.1| TPR repeat region superfamily [Brevundimonas sp. BAL3]
          Length = 109

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 42/78 (53%)

Query: 11  KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
           +I +R WRRG RE D++LG F D     L+  EL  LE +I+E+D  L+ W    +  P 
Sbjct: 23  RIQFRSWRRGFREADMVLGPFSDQVAPTLTDAELDQLELLIDEEDQWLYGWIIERDPTPP 82

Query: 71  YLRTPIFKKIYDYYSNNL 88
              TP+  K+  +   ++
Sbjct: 83  EFETPVMAKVRAFMREHV 100


>gi|319407248|emb|CBI80887.1| conserved hypothetical protein [Bartonella sp. 1-1C]
          Length = 96

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 28/76 (36%), Positives = 46/76 (60%)

Query: 10 RKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPP 69
          R++++R W RG RE+DLILG +VD  I ++S   ++ LE I+  +D +L  W T     P
Sbjct: 16 RRLIFRAWHRGIREIDLILGQYVDAHIAKMSDQTVSELEYIMSFEDRDLLGWITREVSIP 75

Query: 70 EYLRTPIFKKIYDYYS 85
            + + +F+ I +Y S
Sbjct: 76 AEVDSALFRDIINYCS 91


>gi|330994821|ref|ZP_08318743.1| Succinate dehydrogenase assembly factor 2 [Gluconacetobacter sp.
          SXCC-1]
 gi|329758082|gb|EGG74604.1| Succinate dehydrogenase assembly factor 2 [Gluconacetobacter sp.
          SXCC-1]
          Length = 103

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 27/76 (35%), Positives = 46/76 (60%)

Query: 5  MNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTG 64
          ++ + RKI YR   RGT E D+++G FV   +  ++  +L  LE++++  D++L  W +G
Sbjct: 11 LDTRRRKIYYRATHRGTHETDVLIGGFVAPRLEGMTEAQLDALEAVMDLPDADLADWLSG 70

Query: 65 MEKPPEYLRTPIFKKI 80
              PE L TP+ K+I
Sbjct: 71 RRPVPEELNTPMMKEI 86


>gi|319404240|emb|CBI77833.1| conserved hypothetical protein [Bartonella rochalimae ATCC
          BAA-1498]
          Length = 96

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 28/76 (36%), Positives = 46/76 (60%)

Query: 10 RKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPP 69
          R++++R W RG RE+DLILG +VD  I ++S   ++ LE I+  +D +L  W T     P
Sbjct: 16 RRLIFRAWHRGIREVDLILGQYVDAHIAKMSDQTVSELEYIMSFEDRDLLGWITREVSIP 75

Query: 70 EYLRTPIFKKIYDYYS 85
            + + +F+ I +Y S
Sbjct: 76 PKVDSALFRDIINYCS 91


>gi|255540023|ref|XP_002511076.1| conserved hypothetical protein [Ricinus communis]
 gi|223550191|gb|EEF51678.1| conserved hypothetical protein [Ricinus communis]
          Length = 188

 Score = 61.2 bits (147), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 49/80 (61%), Gaps = 1/80 (1%)

Query: 11  KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
           +++YR  +RG  E+DL+LG +V+  I  +    +  L  +++ ++ +L+KW TG E+PPE
Sbjct: 75  RLLYRSRQRGFLELDLVLGKWVEGHIHSMDENGIKALVHVLDLENPDLWKWLTGQEQPPE 134

Query: 71  YLR-TPIFKKIYDYYSNNLD 89
            +   P+F  + D   NNLD
Sbjct: 135 AVNINPVFSAVRDKIMNNLD 154


>gi|260575729|ref|ZP_05843726.1| protein of unknown function DUF339 [Rhodobacter sp. SW2]
 gi|259022127|gb|EEW25426.1| protein of unknown function DUF339 [Rhodobacter sp. SW2]
          Length = 90

 Score = 61.2 bits (147), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 44/81 (54%), Gaps = 1/81 (1%)

Query: 8  QCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEK 67
          + +++  R WRRGT+EMDLILG + D  +  L +  L + E ++ E+D +L  W  G   
Sbjct: 7  RLKRLGMRSWRRGTKEMDLILGPWSDAHLAGLDAPTLALFEVLLAENDQDLLPWVLGHVP 66

Query: 68 PPEYLRTPIFKKIYDYYSNNL 88
          PP  L   +  +I  +  N L
Sbjct: 67 PPPALAD-LIAEIGQFARNRL 86


>gi|154253520|ref|YP_001414344.1| hypothetical protein Plav_3080 [Parvibaculum lavamentivorans
          DS-1]
 gi|154157470|gb|ABS64687.1| protein of unknown function DUF339 [Parvibaculum lavamentivorans
          DS-1]
          Length = 101

 Score = 60.8 bits (146), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 28/67 (41%), Positives = 43/67 (64%), Gaps = 1/67 (1%)

Query: 6  NLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGM 65
          +++ R++ +R W RG +EMDLILG F D  +  L+  EL   E++IE +D+ L+ W TG 
Sbjct: 14 DVRLRRLKFRSWHRGIKEMDLILGHFADSALESLTDSELDQYEALIEVEDTVLYNWVTGR 73

Query: 66 EK-PPEY 71
          E   PE+
Sbjct: 74 ENVAPEH 80


>gi|68171454|ref|ZP_00544842.1| Protein of unknown function DUF339 [Ehrlichia chaffeensis str.
          Sapulpa]
 gi|88657579|ref|YP_507854.1| TPR repeat-containing protein [Ehrlichia chaffeensis str.
          Arkansas]
 gi|67999135|gb|EAM85797.1| Protein of unknown function DUF339 [Ehrlichia chaffeensis str.
          Sapulpa]
 gi|88599036|gb|ABD44505.1| TPR repeat protein [Ehrlichia chaffeensis str. Arkansas]
          Length = 98

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 43/71 (60%)

Query: 10 RKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPP 69
          ++++YR   RG +EMD+ILG+F  H I  LSS ++   E I+   D  L+K+ TG E  P
Sbjct: 14 KRLLYRSLHRGCKEMDIILGNFALHCIHLLSSKDVDEYEKIVNTSDYQLYKYITGEELIP 73

Query: 70 EYLRTPIFKKI 80
          +YL   I K I
Sbjct: 74 QYLDNNIMKDI 84


>gi|254461912|ref|ZP_05075328.1| TPR repeat family protein [Rhodobacterales bacterium HTCC2083]
 gi|206678501|gb|EDZ42988.1| TPR repeat family protein [Rhodobacteraceae bacterium HTCC2083]
          Length = 86

 Score = 60.5 bits (145), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 46/70 (65%)

Query: 1  MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
          M +  + + +++  R  RRG +EMD+IL ++ D+ + ++S  ++T+ ++++ E+D +L+ 
Sbjct: 2  MPETSDTRIKRLKMRSMRRGIKEMDIILSAYADNSLAQMSESDITLYDTLLNENDQDLYS 61

Query: 61 WFTGMEKPPE 70
          W TG   PPE
Sbjct: 62 WVTGQTVPPE 71


>gi|294011406|ref|YP_003544866.1| hypothetical protein SJA_C1-14200 [Sphingobium japonicum UT26S]
 gi|292674736|dbj|BAI96254.1| conserved hypothetical protein [Sphingobium japonicum UT26S]
          Length = 89

 Score = 60.5 bits (145), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 41/77 (53%)

Query: 4  NMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFT 63
          N + + R++ +R W RG +E DL +G F D +  E    EL   E  IEE D+++  W  
Sbjct: 2  NEDPRIRRLQFRAWHRGIKEADLAVGGFFDRYHAEWGEEELDWFERFIEEQDADIMAWAL 61

Query: 64 GMEKPPEYLRTPIFKKI 80
          G    PE  R P++++ 
Sbjct: 62 GTLPLPEQWRGPMWERF 78


>gi|295689523|ref|YP_003593216.1| hypothetical protein Cseg_2134 [Caulobacter segnis ATCC 21756]
 gi|295431426|gb|ADG10598.1| protein of unknown function DUF339 [Caulobacter segnis ATCC 21756]
          Length = 123

 Score = 60.5 bits (145), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 43/83 (51%)

Query: 1   MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
           M  + + + R++ +R W RG RE DLILG F D     L+  +   LE+++E+ D  ++ 
Sbjct: 27  MTIDHDSRLRRLRFRAWHRGFREADLILGPFADIHGPNLTPEQFDTLETLLEQSDREIYA 86

Query: 61  WFTGMEKPPEYLRTPIFKKIYDY 83
           W  G E  PE   T +   I  +
Sbjct: 87  WIVGQEPTPERFETDVLAMIRAF 109


>gi|326495936|dbj|BAJ90590.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 175

 Score = 60.5 bits (145), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 50/80 (62%), Gaps = 1/80 (1%)

Query: 12  IVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPEY 71
           ++YR  +RG  E+DL+LG++V+  +  +    +  L  I++ ++ +L+KW TG E+PPE 
Sbjct: 64  LMYRSKQRGFLELDLVLGTWVEQHVRSMDEANIRSLLQILDLENPDLWKWLTGQEQPPET 123

Query: 72  LRT-PIFKKIYDYYSNNLDR 90
           + + P+F  I    ++NL +
Sbjct: 124 VNSNPVFAAIKSKVTDNLSK 143


>gi|326525791|dbj|BAJ88942.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 174

 Score = 60.1 bits (144), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 50/80 (62%), Gaps = 1/80 (1%)

Query: 12  IVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPEY 71
           ++YR  +RG  E+DL+LG++V+  +  +    +  L  I++ ++ +L+KW TG E+PPE 
Sbjct: 63  LMYRSKQRGFLELDLVLGTWVEQHVRSMDEANIRSLLQILDLENPDLWKWLTGQEQPPET 122

Query: 72  LRT-PIFKKIYDYYSNNLDR 90
           + + P+F  I    ++NL +
Sbjct: 123 VNSNPVFAAIKSKVTDNLSK 142


>gi|254455903|ref|ZP_05069332.1| conserved hypothetical protein [Candidatus Pelagibacter sp.
          HTCC7211]
 gi|207082905|gb|EDZ60331.1| conserved hypothetical protein [Candidatus Pelagibacter sp.
          HTCC7211]
          Length = 89

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/89 (34%), Positives = 54/89 (60%)

Query: 1  MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
          M  N++   +KI+YR   RGT+EMD +LG+F   +I +L+  EL  LE +++ DD++L+ 
Sbjct: 1  MNFNIDQLKKKIIYRSNYRGTKEMDKLLGAFTKKYINQLNQDELIDLEKLLDIDDTSLYN 60

Query: 61 WFTGMEKPPEYLRTPIFKKIYDYYSNNLD 89
          +F G++   +   T + K   ++  NN D
Sbjct: 61 FFNGIDNEIKIDETNVLKLFKNFKYNNED 89


>gi|255632444|gb|ACU16572.1| unknown [Glycine max]
          Length = 177

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 50/80 (62%), Gaps = 1/80 (1%)

Query: 11  KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
           +++YR  +RG  E+DL+LG +V+  I  L  + +  L  +++ ++ +L+KW +G E+PPE
Sbjct: 64  QLLYRSKQRGFLELDLVLGKWVEDNIHSLDEIRIKALIHVLDLENPDLWKWISGQEQPPE 123

Query: 71  YLRT-PIFKKIYDYYSNNLD 89
            + T P+F  + +    NLD
Sbjct: 124 SVSTNPVFAAVRERVMKNLD 143


>gi|195608742|gb|ACG26201.1| TPR repeat region family protein [Zea mays]
 gi|224033271|gb|ACN35711.1| unknown [Zea mays]
          Length = 180

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 50/81 (61%), Gaps = 1/81 (1%)

Query: 11  KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
           ++VYR  +RG  E+DL+LG++V+  +  +    +  L  +++ ++ +L+KW T  E+PPE
Sbjct: 67  RLVYRSKQRGFLELDLVLGTWVEQHVHAMDEANIRALLQVLDLENPDLWKWLTSQEQPPE 126

Query: 71  YLRT-PIFKKIYDYYSNNLDR 90
            L + P+F  I    ++NL +
Sbjct: 127 DLNSNPVFAAIKSKVTDNLTK 147


>gi|328543942|ref|YP_004304051.1| TPR repeat region superfamily protein [polymorphum gilvum
          SL003B-26A1]
 gi|326413686|gb|ADZ70749.1| TPR repeat region superfamily protein [Polymorphum gilvum
          SL003B-26A1]
          Length = 100

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 49/78 (62%)

Query: 10 RKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPP 69
          ++I++RCW RG +EMDL+LG F    I  L++ EL  LE +++ +D +LF W TG    P
Sbjct: 21 KRILFRCWHRGMKEMDLLLGGFAQAQIETLTTAELDELEDLLDINDQDLFSWMTGRTPVP 80

Query: 70 EYLRTPIFKKIYDYYSNN 87
               P++++I  ++++ 
Sbjct: 81 AERDRPLYRRILAFHADK 98


>gi|317106611|dbj|BAJ53118.1| JHL07K02.8 [Jatropha curcas]
          Length = 188

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 50/81 (61%), Gaps = 1/81 (1%)

Query: 11  KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
           +++YR  +RG  E+DL+LG +V+  I  +    +  L  +++ ++ +L+KW T  E+PPE
Sbjct: 75  RLLYRSKQRGFLELDLVLGKWVEEHISSMDENGIKALVHLLDLENPDLWKWLTCQEQPPE 134

Query: 71  YLRT-PIFKKIYDYYSNNLDR 90
            + T P+F  + D   NNL+R
Sbjct: 135 AVSTNPVFSAVRDKVMNNLNR 155


>gi|329850696|ref|ZP_08265541.1| hypothetical protein ABI_36070 [Asticcacaulis biprosthecum C19]
 gi|328841011|gb|EGF90582.1| hypothetical protein ABI_36070 [Asticcacaulis biprosthecum C19]
          Length = 107

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 43/77 (55%)

Query: 8  QCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEK 67
          + +K+ +R WRRG +E D+ILG F D  +  +S  +L + E ++E  D +L+ W    E 
Sbjct: 22 RLKKLSFRAWRRGFKEADIILGHFADEHLGRMSDADLDIFEVLLEVPDHDLYGWIIEREP 81

Query: 68 PPEYLRTPIFKKIYDYY 84
           P    + I K++  +Y
Sbjct: 82 APADFDSEIMKQLNQFY 98


>gi|157828770|ref|YP_001495012.1| hypothetical protein A1G_05045 [Rickettsia rickettsii str.
          'Sheila Smith']
 gi|165933498|ref|YP_001650287.1| hypothetical protein RrIowa_1086 [Rickettsia rickettsii str.
          Iowa]
 gi|238650717|ref|YP_002916570.1| hypothetical protein RPR_04120 [Rickettsia peacockii str. Rustic]
 gi|13235396|emb|CAC33673.1| hypothetical protein [Rickettsia rickettsii]
 gi|157801251|gb|ABV76504.1| hypothetical protein A1G_05045 [Rickettsia rickettsii str.
          'Sheila Smith']
 gi|165908585|gb|ABY72881.1| hypothetical protein RrIowa_1086 [Rickettsia rickettsii str.
          Iowa]
 gi|238624815|gb|ACR47521.1| hypothetical protein RPR_04120 [Rickettsia peacockii str. Rustic]
          Length = 87

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 44/80 (55%)

Query: 2  KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
          K N N   +K+VYR   RG REMD ILGSF + ++  +   +L     I++++D++L+ W
Sbjct: 3  KLNKNSLQKKLVYRSKNRGCREMDYILGSFAEKYLSLMDEKKLGSYSLILDQNDNDLYNW 62

Query: 62 FTGMEKPPEYLRTPIFKKIY 81
                 P YL   I  K++
Sbjct: 63 INNKSSAPSYLDAEIIDKLH 82


>gi|242068643|ref|XP_002449598.1| hypothetical protein SORBIDRAFT_05g019780 [Sorghum bicolor]
 gi|241935441|gb|EES08586.1| hypothetical protein SORBIDRAFT_05g019780 [Sorghum bicolor]
          Length = 179

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 50/81 (61%), Gaps = 1/81 (1%)

Query: 11  KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
           ++VYR  +RG  E+DL+LG++V+  +  +    +  L  +++ ++ +L+KW T  E+PPE
Sbjct: 66  RLVYRSKQRGFLELDLVLGTWVEQHVHGMDEANIRALLQVLDLENPDLWKWLTSQEQPPE 125

Query: 71  YLRT-PIFKKIYDYYSNNLDR 90
            L + P+F  I    ++NL +
Sbjct: 126 DLNSNPVFAAIKSKVTDNLTK 146


>gi|167646580|ref|YP_001684243.1| hypothetical protein Caul_2618 [Caulobacter sp. K31]
 gi|167349010|gb|ABZ71745.1| protein of unknown function DUF339 [Caulobacter sp. K31]
          Length = 97

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 41/80 (51%)

Query: 1  MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
          M  + + + R++ +R W RG RE DLILG F D     L+  +L   E ++EE D  ++ 
Sbjct: 1  MTIDHDSRLRRLKFRAWHRGFREADLILGPFADTHGPNLTPEQLDTFEILMEESDREIYA 60

Query: 61 WFTGMEKPPEYLRTPIFKKI 80
          W  G E  PE   T +   I
Sbjct: 61 WIVGQEPTPEKFDTDVLTLI 80


>gi|118589911|ref|ZP_01547315.1| hypothetical protein SIAM614_14640 [Stappia aggregata IAM 12614]
 gi|118437408|gb|EAV44045.1| hypothetical protein SIAM614_14640 [Stappia aggregata IAM 12614]
          Length = 105

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 47/75 (62%)

Query: 10 RKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPP 69
          +KI++RCW RG +EMDL+LG F D  I  LS  EL  LE ++   D +L+ W TG +  P
Sbjct: 21 KKILFRCWHRGMKEMDLLLGGFADAKIDSLSEEELRELEHLLTAHDQDLYAWMTGRKPLP 80

Query: 70 EYLRTPIFKKIYDYY 84
          +    P++++I  Y+
Sbjct: 81 QEWDGPLYRRIIAYH 95


>gi|87199998|ref|YP_497255.1| hypothetical protein Saro_1981 [Novosphingobium aromaticivorans
          DSM 12444]
 gi|87135679|gb|ABD26421.1| protein of unknown function DUF339 [Novosphingobium
          aromaticivorans DSM 12444]
          Length = 93

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 35/61 (57%)

Query: 10 RKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPP 69
          R++ +R W RGTRE D ++G F D +    S+ ++   E +IEEDD  +  W  G E  P
Sbjct: 13 RRLHFRAWHRGTREADYMIGCFFDRYHASWSAADVAWFEELIEEDDVEIMAWALGTEAVP 72

Query: 70 E 70
          E
Sbjct: 73 E 73


>gi|221234858|ref|YP_002517294.1| TPR repeat containing protein [Caulobacter crescentus NA1000]
 gi|220964030|gb|ACL95386.1| TPR repeat containing protein [Caulobacter crescentus NA1000]
          Length = 97

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 42/83 (50%)

Query: 1  MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
          M  + + + R++ +R W RG RE DLILG F D     L+  +   LE+++E+ D  ++ 
Sbjct: 1  MTIDHDSRLRRLRFRAWHRGFREADLILGPFADTHGPNLTPEQFDTLETLLEQSDREIYA 60

Query: 61 WFTGMEKPPEYLRTPIFKKIYDY 83
          W  G E  P    T +   I  +
Sbjct: 61 WIVGQEPTPAKFETDVMAMIRTF 83


>gi|16126088|ref|NP_420652.1| hypothetical protein CC_1845 [Caulobacter crescentus CB15]
 gi|13423284|gb|AAK23820.1| hypothetical protein CC_1845 [Caulobacter crescentus CB15]
          Length = 116

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 42/83 (50%)

Query: 1   MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
           M  + + + R++ +R W RG RE DLILG F D     L+  +   LE+++E+ D  ++ 
Sbjct: 20  MTIDHDSRLRRLRFRAWHRGFREADLILGPFADTHGPNLTPEQFDTLETLLEQSDREIYA 79

Query: 61  WFTGMEKPPEYLRTPIFKKIYDY 83
           W  G E  P    T +   I  +
Sbjct: 80  WIVGQEPTPAKFETDVMAMIRTF 102


>gi|307942227|ref|ZP_07657578.1| conserved hypothetical protein [Roseibium sp. TrichSKD4]
 gi|307774513|gb|EFO33723.1| conserved hypothetical protein [Roseibium sp. TrichSKD4]
          Length = 101

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 48/77 (62%)

Query: 10 RKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPP 69
          +KI++RCW RG +EMDL+LG F    I  L+  EL  LE I+   D +L+ W TG +  P
Sbjct: 21 KKILFRCWHRGIKEMDLLLGGFAKDHIDLLNEEELAELEHILTAHDQDLYAWMTGRKPLP 80

Query: 70 EYLRTPIFKKIYDYYSN 86
          E    P++++I  Y+++
Sbjct: 81 EEWDGPLYRRIIAYHAD 97


>gi|114763960|ref|ZP_01443201.1| TPR repeat family protein [Pelagibaca bermudensis HTCC2601]
 gi|114543552|gb|EAU46566.1| TPR repeat family protein [Roseovarius sp. HTCC2601]
          Length = 86

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 44/77 (57%), Gaps = 1/77 (1%)

Query: 10 RKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPP 69
          +++  R  RRG +EMD+IL  + D  +  + + +L   E+++EE+D +L++W +G    P
Sbjct: 10 KRLTMRSMRRGIKEMDIILMRYADARLAAMDAAQLDAYEALLEENDQDLYQWVSGQRPAP 69

Query: 70 EYLRTPIFKKIYDYYSN 86
          E LR P+   I     N
Sbjct: 70 EALR-PLITDISQVACN 85


>gi|159471722|ref|XP_001694005.1| predicted protein [Chlamydomonas reinhardtii]
 gi|158277172|gb|EDP02941.1| predicted protein [Chlamydomonas reinhardtii]
          Length = 173

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 50/81 (61%), Gaps = 1/81 (1%)

Query: 9   CRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKP 68
             K++YR  +RG  E+DL++G + +  I +++  EL  +  +++E++ +LFKW TG  + 
Sbjct: 53  ANKLLYRSKQRGFLELDLLMGLWAEANIPKMTMAELNQMAFVLDEENPDLFKWLTGQLQA 112

Query: 69  PEYL-RTPIFKKIYDYYSNNL 88
           PE++ + P+F  I  + +  L
Sbjct: 113 PEHMQKNPVFVAIQSHVAQQL 133


>gi|114768936|ref|ZP_01446562.1| TPR repeat family protein [alpha proteobacterium HTCC2255]
 gi|114549853|gb|EAU52734.1| TPR repeat family protein [alpha proteobacterium HTCC2255]
          Length = 86

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 48/81 (59%), Gaps = 3/81 (3%)

Query: 8  QCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTG-ME 66
          + +++  R W RG +EMDLILG F D+ + +LS  EL   E ++ E+D +L+ W +G  E
Sbjct: 7  RLKRLRMRSWHRGIKEMDLILGGFADNEMSKLSIEELNEHELMMSENDHDLYNWVSGKSE 66

Query: 67 KPPEYLRTPIFKKIYDYYSNN 87
           PPE L      +I +Y+  N
Sbjct: 67 IPPELLSA--INRITNYFLKN 85


>gi|301108613|ref|XP_002903388.1| conserved hypothetical protein [Phytophthora infestans T30-4]
 gi|262097760|gb|EEY55812.1| conserved hypothetical protein [Phytophthora infestans T30-4]
          Length = 172

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 46/74 (62%)

Query: 10  RKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPP 69
           ++I+YR  +RG  E+DL+LG +    +++LSS EL   E I+ E+  ++F + +G    P
Sbjct: 76  KRIIYRSKQRGWLEVDLLLGRWASQNVMQLSSDELKQYEDILNEETIDIFNYISGKSAVP 135

Query: 70  EYLRTPIFKKIYDY 83
             L TP+ K++ +Y
Sbjct: 136 HRLDTPMMKRLQEY 149


>gi|73667474|ref|YP_303490.1| hypothetical protein Ecaj_0861 [Ehrlichia canis str. Jake]
 gi|72394615|gb|AAZ68892.1| protein of unknown function DUF339 [Ehrlichia canis str. Jake]
          Length = 93

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 45/71 (63%)

Query: 10 RKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPP 69
          +K++YR   RG +EMD+ILG+F  ++I  LS  ++ + E I++ +D  L+K+ TG E  P
Sbjct: 9  KKLLYRSLHRGCKEMDIILGNFASYYIHLLSDEDINIYEKIVDTNDHQLYKYITGEEFIP 68

Query: 70 EYLRTPIFKKI 80
          + L   + + I
Sbjct: 69 QDLDGNVMRSI 79


>gi|195607848|gb|ACG25754.1| TPR repeat region family protein [Zea mays]
          Length = 175

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 49/79 (62%), Gaps = 1/79 (1%)

Query: 11  KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
           ++VYR  +RG  E+DL+LG++V+  +  +    +  L  +++ ++ +L+KW T  E+PPE
Sbjct: 62  RLVYRSKQRGFLELDLVLGTWVEQHVHAMDEPNIRALLQVLDLENPDLWKWLTSQEQPPE 121

Query: 71  YLRT-PIFKKIYDYYSNNL 88
            L + P+F  I    ++NL
Sbjct: 122 DLNSNPVFSAIKSKVTDNL 140


>gi|114797711|ref|YP_760686.1| TPR repeat-containing protein [Hyphomonas neptunium ATCC 15444]
 gi|114737885|gb|ABI76010.1| TPR repeat protein [Hyphomonas neptunium ATCC 15444]
          Length = 87

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 41/73 (56%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          K+ +R WRRG RE+DL++GSF D  +  +S   L   E +++  D  +F W  G E  P+
Sbjct: 8  KLKFRAWRRGFRELDLLMGSFADQSLESMSQDGLDEFERLLDVPDWEIFAWLVGQEPVPD 67

Query: 71 YLRTPIFKKIYDY 83
            + P+  ++  +
Sbjct: 68 KHKGPVLDQLIGF 80


>gi|89055143|ref|YP_510594.1| hypothetical protein Jann_2652 [Jannaschia sp. CCS1]
 gi|88864692|gb|ABD55569.1| protein of unknown function DUF339 [Jannaschia sp. CCS1]
          Length = 91

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 42/72 (58%)

Query: 1  MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
          M +   ++ +++  R W RG +EMDLILG + D  + + +  +L   E+++ E D +L++
Sbjct: 1  MSEPREIRLKRLRLRAWHRGIKEMDLILGGWADRNLSDATDADLDAFEAVMAEADHDLYQ 60

Query: 61 WFTGMEKPPEYL 72
          W +G  + P  L
Sbjct: 61 WISGQAEAPSEL 72


>gi|115485717|ref|NP_001068002.1| Os11g0528300 [Oryza sativa Japonica Group]
 gi|77551232|gb|ABA94029.1| TPR repeat region family protein, expressed [Oryza sativa Japonica
           Group]
 gi|113645224|dbj|BAF28365.1| Os11g0528300 [Oryza sativa Japonica Group]
 gi|125577345|gb|EAZ18567.1| hypothetical protein OsJ_34096 [Oryza sativa Japonica Group]
          Length = 186

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 50/81 (61%), Gaps = 1/81 (1%)

Query: 11  KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
           ++VYR  +RG  E+DL+LG++V+  I  +    +  L  +++ ++ +L+KW T  E+PPE
Sbjct: 74  RLVYRSKQRGFLELDLVLGTWVEQHIHSMDEANIRALLQVLDLENPDLWKWLTSQEQPPE 133

Query: 71  YLRT-PIFKKIYDYYSNNLDR 90
            + + P+F  +    ++NL +
Sbjct: 134 AVNSNPVFIAVKSKVTDNLSK 154


>gi|34581454|ref|ZP_00142934.1| hypothetical protein [Rickettsia sibirica 246]
 gi|229586941|ref|YP_002845442.1| Tetratricopeptide repeat-containing protein [Rickettsia africae
          ESF-5]
 gi|28262839|gb|EAA26343.1| unknown [Rickettsia sibirica 246]
 gi|228021991|gb|ACP53699.1| Tetratricopeptide repeat-containing protein [Rickettsia africae
          ESF-5]
          Length = 87

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 43/80 (53%)

Query: 2  KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
          K N N   +K+ YR   RG REMD ILGSF + ++  +   +L     I++++D++L+ W
Sbjct: 3  KLNKNSLQKKLFYRSKNRGCREMDYILGSFAEKYLSLMDETKLGSYSLILDQNDNDLYNW 62

Query: 62 FTGMEKPPEYLRTPIFKKIY 81
                 P YL   I  K++
Sbjct: 63 INNKSSAPSYLDAEIIDKLH 82


>gi|262370548|ref|ZP_06063873.1| conserved hypothetical protein [Acinetobacter johnsonii SH046]
 gi|262314348|gb|EEY95390.1| conserved hypothetical protein [Acinetobacter johnsonii SH046]
          Length = 85

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 43/69 (62%), Gaps = 1/69 (1%)

Query: 1  MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
          M + M+L+ RK++YR  RRG +E+D+    +V ++ L+    E  M  +++E++D +L  
Sbjct: 1  MTEEMSLEERKVIYRA-RRGLKEIDVYFDPYVKNYYLQADPAEKAMFAALVEQEDPDLLD 59

Query: 61 WFTGMEKPP 69
          WF  + +PP
Sbjct: 60 WFMEVSEPP 68


>gi|296535471|ref|ZP_06897660.1| TPR repeat region superfamily protein [Roseomonas cervicalis ATCC
          49957]
 gi|296264192|gb|EFH10628.1| TPR repeat region superfamily protein [Roseomonas cervicalis ATCC
          49957]
          Length = 112

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 47/86 (54%)

Query: 2  KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
            +++ + R++V+R   RGT+E DL++G FV   I   S  EL  LE ++E  D +L  W
Sbjct: 12 APDLSPRRRRLVFRATHRGTKETDLMVGGFVTRNIAAFSEAELDELEGVLELLDVDLADW 71

Query: 62 FTGMEKPPEYLRTPIFKKIYDYYSNN 87
           +G    P  + TP+  ++ +  S +
Sbjct: 72 LSGRRPIPPEVMTPMLARMAEECSRS 97


>gi|88608736|ref|YP_506805.1| hypothetical protein NSE_0941 [Neorickettsia sennetsu str.
          Miyayama]
 gi|88600905|gb|ABD46373.1| conserved hypothetical protein [Neorickettsia sennetsu str.
          Miyayama]
          Length = 82

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 50/77 (64%), Gaps = 2/77 (2%)

Query: 4  NMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFT 63
          N++L+ ++I+YR   RG +E+D++LGSF+   + +L+  E+  +E I+E  DS +F  + 
Sbjct: 2  NIDLRKKRILYRSTHRGCKEIDILLGSFITKNLSKLTEQEVEQVECILELSDSFIFDCYQ 61

Query: 64 GMEKPPEYLRTPIFKKI 80
          G  +PPE    PI K++
Sbjct: 62 GKVEPPEEF--PILKRM 76


>gi|260426903|ref|ZP_05780882.1| TPR repeat protein [Citreicella sp. SE45]
 gi|260421395|gb|EEX14646.1| TPR repeat protein [Citreicella sp. SE45]
          Length = 86

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 45/77 (58%), Gaps = 1/77 (1%)

Query: 10 RKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPP 69
          +++  R  RRG +EMD+IL  +VD  +  +S+ EL   E+++EE+D +L++W +G    P
Sbjct: 10 KRLTMRSMRRGIKEMDIILMRYVDVRLAGMSAAELDAYEALLEENDQDLYQWVSGQRPAP 69

Query: 70 EYLRTPIFKKIYDYYSN 86
            L+ P+   I     N
Sbjct: 70 ASLQ-PLIADITAVACN 85


>gi|304391610|ref|ZP_07373552.1| putative protein EMI5-like protein [Ahrensia sp. R2A130]
 gi|303295839|gb|EFL90197.1| putative protein EMI5-like protein [Ahrensia sp. R2A130]
          Length = 93

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 52/88 (59%), Gaps = 4/88 (4%)

Query: 1  MKKNMNLQCRK--IVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNL 58
          M+ +  L  R+  +++R W RG REMD +LG+F +  I ++S  +L   E +++  D ++
Sbjct: 5  MRSSAGLDARRKRLLFRSWHRGMREMDYVLGTFANAAIEDMSDEQLAEFEMLMQVPDPDM 64

Query: 59 FKWFTG-MEKPPEYLRTPIFKKIYDYYS 85
          +KW +G +E PP +    + ++I  ++ 
Sbjct: 65 YKWLSGTIEVPPNW-NNEVVRRIRKFHG 91


>gi|254464263|ref|ZP_05077674.1| TPR repeat family protein [Rhodobacterales bacterium Y4I]
 gi|206685171|gb|EDZ45653.1| TPR repeat family protein [Rhodobacterales bacterium Y4I]
          Length = 85

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 47/76 (61%)

Query: 1  MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
          M+++  ++ +++  R  RRG +EMD++L +F    + ++ + +L + + ++ E+D +L++
Sbjct: 1  MQEDRTIRLKRLQMRSMRRGIKEMDILLSAFAAANLEQMDAAQLDLYDQLLHENDQDLYQ 60

Query: 61 WFTGMEKPPEYLRTPI 76
          W TG  +P E  R  +
Sbjct: 61 WVTGQAEPQERFRALV 76


>gi|288958062|ref|YP_003448403.1| hypothetical protein AZL_012210 [Azospirillum sp. B510]
 gi|288910370|dbj|BAI71859.1| hypothetical protein AZL_012210 [Azospirillum sp. B510]
          Length = 107

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 36/60 (60%)

Query: 10 RKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPP 69
          +++ +R W RGTREMDL++GSF D  +       L   E+++E  D +L+ W +G E  P
Sbjct: 26 KRLRFRSWHRGTREMDLLMGSFADAHVGGFDHAMLDRFEALLELGDPDLYDWMSGREPVP 85


>gi|254797261|ref|YP_003082103.1| TPR repeat region superfamily [Neorickettsia risticii str.
          Illinois]
 gi|254590502|gb|ACT69864.1| TPR repeat region superfamily [Neorickettsia risticii str.
          Illinois]
          Length = 82

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 50/77 (64%), Gaps = 2/77 (2%)

Query: 4  NMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFT 63
          N++L+ ++I+YR   RG +E+D++LGSF+   + +L+  E+  +E I+E  DS +F  + 
Sbjct: 2  NIDLRKKRILYRSTHRGCKEIDILLGSFITKNLSKLTEQEVEQVECILELSDSFIFDCYQ 61

Query: 64 GMEKPPEYLRTPIFKKI 80
          G  +PPE    PI K++
Sbjct: 62 GKLEPPEEF--PILKQM 76


>gi|125534599|gb|EAY81147.1| hypothetical protein OsI_36329 [Oryza sativa Indica Group]
          Length = 186

 Score = 57.0 bits (136), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 49/81 (60%), Gaps = 1/81 (1%)

Query: 11  KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
           ++VYR  +RG  E+DL+LG++V+  I  +    +  L  +++ ++ +L+KW T  E+PPE
Sbjct: 74  RLVYRSKQRGFLELDLVLGTWVEQHIHSMDEANIRALLQVLDLENPDLWKWLTDQEQPPE 133

Query: 71  YLRT-PIFKKIYDYYSNNLDR 90
            + + P+F  +    + NL +
Sbjct: 134 AMNSNPVFIAVKSKVTENLSK 154


>gi|13235410|emb|CAC33610.1| hypothetical protein [Rickettsia montanensis]
          Length = 87

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 42/79 (53%)

Query: 2  KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
          K N N   +K+ YR   RG REMD ILGSF + ++  +   +L     I++++D++L+ W
Sbjct: 3  KLNKNSLQKKLFYRSKNRGCREMDYILGSFAEKYLSLMDEKKLGSYSLILDQNDNDLYNW 62

Query: 62 FTGMEKPPEYLRTPIFKKI 80
                 P YL   I  K+
Sbjct: 63 INNKSSAPSYLDAKIIDKL 81


>gi|260463948|ref|ZP_05812144.1| protein of unknown function DUF339 [Mesorhizobium opportunistum
          WSM2075]
 gi|259030323|gb|EEW31603.1| protein of unknown function DUF339 [Mesorhizobium opportunistum
          WSM2075]
          Length = 95

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 44/78 (56%)

Query: 3  KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
          + +++  RK+++R W RG REMDLILG+F D  I  L++ E+   E +++  D+      
Sbjct: 9  EGLDVHRRKLLFRSWHRGLREMDLILGTFADAEIGALTAEEIDQYERLLDIPDTEFLPLI 68

Query: 63 TGMEKPPEYLRTPIFKKI 80
          TG    P  +   + +KI
Sbjct: 69 TGERPVPADIDCAVLQKI 86


>gi|296088155|emb|CBI35625.3| unnamed protein product [Vitis vinifera]
          Length = 174

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 49/80 (61%), Gaps = 1/80 (1%)

Query: 11  KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
           +++YR  +RG  E+DL+LG +V+  I  +    +  L  +++ ++ +L+KW TG E+PPE
Sbjct: 61  RLLYRSKQRGFLELDLVLGKWVEEHIHSMDHNGIKSLVHVLDLENPDLWKWLTGQEQPPE 120

Query: 71  YLR-TPIFKKIYDYYSNNLD 89
            +   P+F  + +   NNL+
Sbjct: 121 AVSINPVFCAVREKVMNNLN 140


>gi|157964741|ref|YP_001499565.1| TPR repeat-containing protein [Rickettsia massiliae MTU5]
 gi|239947626|ref|ZP_04699379.1| tetratricopeptide repeat-containing protein [Rickettsia
          endosymbiont of Ixodes scapularis]
 gi|157844517|gb|ABV85018.1| Tetratricopeptide repeat-containing protein [Rickettsia massiliae
          MTU5]
 gi|239921902|gb|EER21926.1| tetratricopeptide repeat-containing protein [Rickettsia
          endosymbiont of Ixodes scapularis]
          Length = 87

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 42/79 (53%)

Query: 2  KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
          K N N   +K+ YR   RG REMD ILGSF + ++  +   +L     I++++D++L+ W
Sbjct: 3  KLNKNSLQKKLFYRSKNRGCREMDYILGSFAEKYLSLMDEKKLGSYSLILDQNDNDLYNW 62

Query: 62 FTGMEKPPEYLRTPIFKKI 80
                 P YL   I  K+
Sbjct: 63 INNKSSAPSYLDAEIIDKL 81


>gi|225447729|ref|XP_002277790.1| PREDICTED: hypothetical protein [Vitis vinifera]
          Length = 187

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 49/80 (61%), Gaps = 1/80 (1%)

Query: 11  KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
           +++YR  +RG  E+DL+LG +V+  I  +    +  L  +++ ++ +L+KW TG E+PPE
Sbjct: 74  RLLYRSKQRGFLELDLVLGKWVEEHIHSMDHNGIKSLVHVLDLENPDLWKWLTGQEQPPE 133

Query: 71  YLR-TPIFKKIYDYYSNNLD 89
            +   P+F  + +   NNL+
Sbjct: 134 AVSINPVFCAVREKVMNNLN 153


>gi|197105083|ref|YP_002130460.1| hypothetical protein PHZ_c1620 [Phenylobacterium zucineum HLK1]
 gi|196478503|gb|ACG78031.1| conserved hypothetical protein [Phenylobacterium zucineum HLK1]
          Length = 95

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 43/87 (49%), Gaps = 1/87 (1%)

Query: 10 RKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPP 69
          +K+  R WRRG RE DLILG F D  +   S  EL   E ++E+ D +L+ W    E  P
Sbjct: 9  KKLKLRAWRRGFREADLILGPFADKHVSTFSPEELDWFERLLEQPDQDLYAWIVDREPVP 68

Query: 70 EYLRTPIFKKIYDYYSNNLDRKNMLGS 96
                + +++   + + +  K M G 
Sbjct: 69 AAFDGELMRRLK-TFRDEVYAKGMTGG 94


>gi|326427862|gb|EGD73432.1| hypothetical protein PTSG_05135 [Salpingoeca sp. ATCC 50818]
          Length = 211

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 52/79 (65%), Gaps = 3/79 (3%)

Query: 11  KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDS--NLFKWFTGMEKP 68
           +++Y+  +RG +EMDLIL ++ D ++  ++  +L   +SI+ + D+  ++FKW TG E+ 
Sbjct: 116 RLLYQSRKRGIKEMDLILATYADQYLDTMTEQQLEEYDSILNDHDNEWDMFKWLTGKEEL 175

Query: 69  PEYLR-TPIFKKIYDYYSN 86
           PEYL+ + + + + ++  N
Sbjct: 176 PEYLQGSGVMQHLMEFTKN 194


>gi|83858281|ref|ZP_00951803.1| hypothetical protein OA2633_02241 [Oceanicaulis alexandrii
          HTCC2633]
 gi|83853104|gb|EAP90956.1| hypothetical protein OA2633_02241 [Oceanicaulis alexandrii
          HTCC2633]
          Length = 107

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 45/77 (58%), Gaps = 4/77 (5%)

Query: 10 RKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTG-MEKP 68
          +++ +R WRRG +E DLI+G F D  +  LS+ E+   E +++  D+ ++ W  G +E P
Sbjct: 20 KRLTFRAWRRGFKEADLIMGRFADTKLYSLSAEEVDEFERLLDAPDTEVYGWICGTIETP 79

Query: 69 PEYLRTPIFK--KIYDY 83
          P Y   P+    K +D+
Sbjct: 80 PNY-EGPVLDALKAFDF 95


>gi|15892837|ref|NP_360551.1| hypothetical protein RC0914 [Rickettsia conorii str. Malish 7]
 gi|15620022|gb|AAL03452.1| unknown [Rickettsia conorii str. Malish 7]
          Length = 87

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 42/80 (52%)

Query: 2  KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
          K N N   +K+ YR   RG REMD IL SF + ++  +   +L     I++++D++L+ W
Sbjct: 3  KLNKNSLQKKLFYRSKNRGCREMDYILSSFAEKYLSLMDETQLGSYSLILDQNDNDLYNW 62

Query: 62 FTGMEKPPEYLRTPIFKKIY 81
                 P YL   I  K++
Sbjct: 63 INNKSSAPSYLDAEIIDKLH 82


>gi|262280196|ref|ZP_06057980.1| conserved hypothetical protein [Acinetobacter calcoaceticus
          RUH2202]
 gi|262257974|gb|EEY76708.1| conserved hypothetical protein [Acinetobacter calcoaceticus
          RUH2202]
          Length = 85

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 41/69 (59%), Gaps = 1/69 (1%)

Query: 1  MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
          M   M L+ RK++YR  RRG +E+D+    +V ++ L+  S E  +   ++E++D +L  
Sbjct: 1  MSDEMTLEERKVIYRA-RRGLKEIDVYFDPYVKNYYLKADSAEKALFAELVEQEDPDLLD 59

Query: 61 WFTGMEKPP 69
          WF  + +PP
Sbjct: 60 WFMEVSEPP 68


>gi|162147669|ref|YP_001602130.1| hypothetical protein GDI_1885 [Gluconacetobacter diazotrophicus
          PAl 5]
 gi|209542294|ref|YP_002274523.1| hypothetical protein Gdia_0108 [Gluconacetobacter diazotrophicus
          PAl 5]
 gi|161786246|emb|CAP55828.1| conserved hypothetical protein [Gluconacetobacter diazotrophicus
          PAl 5]
 gi|209529971|gb|ACI49908.1| protein of unknown function DUF339 [Gluconacetobacter
          diazotrophicus PAl 5]
          Length = 103

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 44/77 (57%)

Query: 4  NMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFT 63
          N++ + R++ +R   RGT E D+++G FV   +  L+  E+  LE ++E  D++L  W +
Sbjct: 10 NLDPRRRRLYFRATHRGTHETDILIGGFVAPRLAGLTDAEMDALEEVMELPDADLADWLS 69

Query: 64 GMEKPPEYLRTPIFKKI 80
          G +  P  +  P+ + I
Sbjct: 70 GRKPVPAEVDGPMMRAI 86


>gi|51473777|ref|YP_067534.1| hypothetical protein RT0587 [Rickettsia typhi str. Wilmington]
 gi|13235383|emb|CAC33733.1| hypothetical protein [Rickettsia typhi]
 gi|51460089|gb|AAU04052.1| conserved hypothetical protein [Rickettsia typhi str. Wilmington]
          Length = 90

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 43/79 (54%)

Query: 2  KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
          K N N   +K+ YR  +RG REMD ILGSF + ++  +    L     I++++D++L+ W
Sbjct: 3  KLNKNALQKKLFYRSKKRGCREMDYILGSFAEKYLSFMDEKTLKRYTLILDQNDNDLYNW 62

Query: 62 FTGMEKPPEYLRTPIFKKI 80
                 P Y+ + I  K+
Sbjct: 63 INNKSSAPSYIDSEIIDKL 81


>gi|148255540|ref|YP_001240125.1| hypothetical protein BBta_4158 [Bradyrhizobium sp. BTAi1]
 gi|146407713|gb|ABQ36219.1| hypothetical protein BBta_4158 [Bradyrhizobium sp. BTAi1]
          Length = 95

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 54/89 (60%), Gaps = 4/89 (4%)

Query: 3  KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
          + ++ + +++++RCW RGTREMDLILG F D  I  LS  EL  LE ++E  D + +   
Sbjct: 9  QGLDDRRKRLLFRCWHRGTREMDLILGRFADAEIGTLSEGELAELEQLLEVPDPDFYAAV 68

Query: 63 TGMEK-PPEYLRTP-IFKKIYDYYSNNLD 89
          TG    PPE  +TP +F +I  + + + D
Sbjct: 69 TGARPLPPE--QTPALFARIKAFRAADAD 95


>gi|260549811|ref|ZP_05824027.1| UPF0350 protein [Acinetobacter sp. RUH2624]
 gi|260407061|gb|EEX00538.1| UPF0350 protein [Acinetobacter sp. RUH2624]
          Length = 85

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 41/69 (59%), Gaps = 1/69 (1%)

Query: 1  MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
          M + M L+ RK+VYR  RRG +E+D+    +V ++ L+    E  +   ++E++D +L  
Sbjct: 1  MSEEMTLEERKVVYRA-RRGLKEIDVYFDPYVKNYYLKADPAEKALFAELVEQEDPDLLD 59

Query: 61 WFTGMEKPP 69
          WF  + +PP
Sbjct: 60 WFMEVSEPP 68


>gi|27379713|ref|NP_771242.1| hypothetical protein bsl4602 [Bradyrhizobium japonicum USDA 110]
 gi|27352865|dbj|BAC49867.1| bsl4602 [Bradyrhizobium japonicum USDA 110]
          Length = 96

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 31/71 (43%), Positives = 45/71 (63%)

Query: 10 RKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPP 69
          +++++RCW RGTREMDLILG F D  I  LS  EL  LE ++E +D +L+   TG +  P
Sbjct: 16 KRLLFRCWHRGTREMDLILGRFADAEIGNLSDAELDELEHLLEVNDPDLYAAITGDKVLP 75

Query: 70 EYLRTPIFKKI 80
            +   +F +I
Sbjct: 76 ADVTGALFARI 86


>gi|319783817|ref|YP_004143293.1| hypothetical protein Mesci_4131 [Mesorhizobium ciceri biovar
          biserrulae WSM1271]
 gi|317169705|gb|ADV13243.1| protein of unknown function DUF339 [Mesorhizobium ciceri biovar
          biserrulae WSM1271]
          Length = 95

 Score = 55.5 bits (132), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 46/81 (56%)

Query: 3  KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
          + ++++ RK+++R W RG REMDLILG+F D  I  L++ E+   E +++  D+      
Sbjct: 9  EGLDVRRRKLLFRSWHRGMREMDLILGTFADAEIGVLTNEEIDQYERLLDIPDTEFLPMV 68

Query: 63 TGMEKPPEYLRTPIFKKIYDY 83
          TG    P  +   + +KI  +
Sbjct: 69 TGERPVPADIDCAVLRKILAF 89


>gi|13470980|ref|NP_102549.1| hypothetical protein msl0828 [Mesorhizobium loti MAFF303099]
 gi|14021723|dbj|BAB48335.1| msl0828 [Mesorhizobium loti MAFF303099]
          Length = 95

 Score = 55.5 bits (132), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 42/78 (53%)

Query: 3  KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
          + ++   RK+++R W RG REMDLILG+F D  I  L+  E+   E +++  D+      
Sbjct: 9  EGLDAHRRKLLFRSWHRGMREMDLILGTFADAEIGALTGEEIEQYERLLDISDTEFLPLI 68

Query: 63 TGMEKPPEYLRTPIFKKI 80
          TG    P  +   + +KI
Sbjct: 69 TGERPIPADIDCAVLQKI 86


>gi|15604449|ref|NP_220967.1| hypothetical protein RP599 [Rickettsia prowazekii str. Madrid E]
 gi|3861143|emb|CAA15043.1| unknown [Rickettsia prowazekii]
 gi|292572221|gb|ADE30136.1| Tetratricopeptide repeat-containing protein [Rickettsia
          prowazekii Rp22]
          Length = 87

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 41/77 (53%)

Query: 4  NMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFT 63
          N N   +K+ YR  +RG REMD ILG F + ++  +   +L     I++++D++L+ W  
Sbjct: 5  NKNALQKKLFYRSKKRGCREMDYILGRFAEKYLSSMDEKKLKSYTLILDQNDNDLYNWIN 64

Query: 64 GMEKPPEYLRTPIFKKI 80
               P YL   I  K+
Sbjct: 65 NKPSAPSYLDPEIIDKL 81


>gi|299133933|ref|ZP_07027127.1| protein of unknown function DUF339 [Afipia sp. 1NLS2]
 gi|298591769|gb|EFI51970.1| protein of unknown function DUF339 [Afipia sp. 1NLS2]
          Length = 134

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 44/74 (59%), Gaps = 6/74 (8%)

Query: 10  RKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF---TGME 66
           +++++RCW RGT+EMD I G F D  I +LS  E+   E +I+  D +L+  F   T +E
Sbjct: 54  KRLLFRCWHRGTKEMDYIFGRFADAHIADLSEEEVADFERLIDLPDPDLYNAFNDKTPLE 113

Query: 67  KPPEYLRTPIFKKI 80
             P Y    IF++I
Sbjct: 114 --PAYAEG-IFRRI 124


>gi|88607462|ref|YP_505743.1| TPR repeat-containing protein [Anaplasma phagocytophilum HZ]
 gi|88598525|gb|ABD43995.1| TPR repeat protein [Anaplasma phagocytophilum HZ]
          Length = 88

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 45/76 (59%)

Query: 10 RKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPP 69
          R+++YR   RG +EMD++LGSF  H +  LS  ++   E+I+E DD+ L+ +  G    P
Sbjct: 11 RRLLYRSVHRGCKEMDILLGSFAQHHLHLLSDEQVANYEAIVELDDALLYSYVVGRVPIP 70

Query: 70 EYLRTPIFKKIYDYYS 85
          + + + + + I  + S
Sbjct: 71 QGIDSALIELISGFAS 86


>gi|302383041|ref|YP_003818864.1| hypothetical protein Bresu_1930 [Brevundimonas subvibrioides ATCC
          15264]
 gi|302193669|gb|ADL01241.1| protein of unknown function DUF339 [Brevundimonas subvibrioides
          ATCC 15264]
          Length = 106

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 40/74 (54%), Gaps = 1/74 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEED-DSNLFKWFTGMEKPP 69
          +I +R WRRG RE DL+LG F++     LS  +L  LE+++ ED D  L+ W       P
Sbjct: 19 RITFRAWRRGFREADLVLGPFMEREGPGLSDADLDSLEALLAEDNDHELYAWIIETNPTP 78

Query: 70 EYLRTPIFKKIYDY 83
              TP+  ++  +
Sbjct: 79 AEHETPLMTRLRTF 92


>gi|169632379|ref|YP_001706115.1| hypothetical protein ABSDF0452 [Acinetobacter baumannii SDF]
 gi|169794623|ref|YP_001712416.1| hypothetical protein ABAYE0437 [Acinetobacter baumannii AYE]
 gi|184159569|ref|YP_001847908.1| hypothetical protein ACICU_03249 [Acinetobacter baumannii ACICU]
 gi|213158806|ref|YP_002320804.1| hypothetical protein AB57_3501 [Acinetobacter baumannii AB0057]
 gi|215482212|ref|YP_002324394.1| hypothetical protein ABBFA_000461 [Acinetobacter baumannii
          AB307-0294]
 gi|239503205|ref|ZP_04662515.1| hypothetical protein AbauAB_12923 [Acinetobacter baumannii AB900]
 gi|260557056|ref|ZP_05829273.1| UPF0350 protein [Acinetobacter baumannii ATCC 19606]
 gi|301348161|ref|ZP_07228902.1| hypothetical protein AbauAB0_17986 [Acinetobacter baumannii
          AB056]
 gi|301513379|ref|ZP_07238616.1| hypothetical protein AbauAB05_17401 [Acinetobacter baumannii
          AB058]
 gi|301595213|ref|ZP_07240221.1| hypothetical protein AbauAB059_05366 [Acinetobacter baumannii
          AB059]
 gi|332853168|ref|ZP_08434605.1| TPR repeat region [Acinetobacter baumannii 6013150]
 gi|332868586|ref|ZP_08438242.1| TPR repeat region [Acinetobacter baumannii 6013113]
 gi|332876054|ref|ZP_08443838.1| TPR repeat region [Acinetobacter baumannii 6014059]
 gi|169147550|emb|CAM85411.1| conserved hypothetical protein [Acinetobacter baumannii AYE]
 gi|169151171|emb|CAO99843.1| conserved hypothetical protein [Acinetobacter baumannii]
 gi|183211163|gb|ACC58561.1| hypothetical protein ACICU_03249 [Acinetobacter baumannii ACICU]
 gi|193078458|gb|ABO13449.2| hypothetical protein A1S_3052 [Acinetobacter baumannii ATCC
          17978]
 gi|213057966|gb|ACJ42868.1| conserved hypothetical protein [Acinetobacter baumannii AB0057]
 gi|213989108|gb|ACJ59407.1| conserved hypothetical protein [Acinetobacter baumannii
          AB307-0294]
 gi|260409662|gb|EEX02963.1| UPF0350 protein [Acinetobacter baumannii ATCC 19606]
 gi|322509479|gb|ADX04933.1| Putative uncharacterized protein [Acinetobacter baumannii 1656-2]
 gi|323519500|gb|ADX93881.1| hypothetical protein ABTW07_3464 [Acinetobacter baumannii
          TCDC-AB0715]
 gi|332728837|gb|EGJ60196.1| TPR repeat region [Acinetobacter baumannii 6013150]
 gi|332733263|gb|EGJ64457.1| TPR repeat region [Acinetobacter baumannii 6013113]
 gi|332735672|gb|EGJ66715.1| TPR repeat region [Acinetobacter baumannii 6014059]
          Length = 85

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 41/69 (59%), Gaps = 1/69 (1%)

Query: 1  MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
          M + M L+ RK++YR  RRG +E+D+    +V ++ L+    E  +   ++E++D +L  
Sbjct: 1  MSEEMTLEERKVIYRA-RRGLKEIDVYFDPYVKNYYLKADPAEKALFAELVEQEDPDLLD 59

Query: 61 WFTGMEKPP 69
          WF  + +PP
Sbjct: 60 WFMEVSEPP 68


>gi|67458758|ref|YP_246382.1| hypothetical protein RF_0366 [Rickettsia felis URRWXCal2]
 gi|67004291|gb|AAY61217.1| unknown [Rickettsia felis URRWXCal2]
          Length = 87

 Score = 55.1 bits (131), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 42/79 (53%)

Query: 2  KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
          K N N   +K+ YR   RG +EMD ILGSF + ++  +   +L     I++++D++L+ W
Sbjct: 3  KLNKNSLQKKLFYRSKNRGCKEMDYILGSFAEKYLSLMDEKKLGSYSLILDQNDNDLYNW 62

Query: 62 FTGMEKPPEYLRTPIFKKI 80
                 P YL   I  K+
Sbjct: 63 INNKSSAPSYLDAEIIDKL 81


>gi|332186184|ref|ZP_08387930.1| hypothetical protein SUS17_1084 [Sphingomonas sp. S17]
 gi|332013999|gb|EGI56058.1| hypothetical protein SUS17_1084 [Sphingomonas sp. S17]
          Length = 88

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 40/71 (56%)

Query: 10 RKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPP 69
          +++ +R W RGT+E DL++G F D     LS  EL   E+++EE D ++  W  G +  P
Sbjct: 8  KRLRFRAWHRGTKEADLMIGGFFDAHHETLSLEELDWFEALLEEQDVDIMAWAIGTQPCP 67

Query: 70 EYLRTPIFKKI 80
               P+ +++
Sbjct: 68 PQWDGPVMQRM 78


>gi|254512347|ref|ZP_05124414.1| TPR repeat family protein [Rhodobacteraceae bacterium KLH11]
 gi|221536058|gb|EEE39046.1| TPR repeat family protein [Rhodobacteraceae bacterium KLH11]
          Length = 95

 Score = 54.7 bits (130), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 36/58 (62%)

Query: 15 RCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPEYL 72
          R  RRG +EMDLIL ++ D  +  +  V L   ++++ E+D +L++W TG  +PP  L
Sbjct: 4  RSMRRGIKEMDLILTAYADRNLSSMDDVGLETYDALLHENDQDLYQWVTGQAQPPARL 61


>gi|261328771|emb|CBH11749.1| hypothetical protein, conserved [Trypanosoma brucei gambiense
           DAL972]
          Length = 146

 Score = 54.3 bits (129), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 49/82 (59%), Gaps = 1/82 (1%)

Query: 10  RKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFT-GMEKP 68
           R+++Y+   RG  EMD+ILG+F    I  LS+ +L   ++++   D++L+KW    +E P
Sbjct: 59  RRLLYQSTYRGMVEMDIILGAFARQNIETLSAPQLEEYDAVLRHFDNDLYKWLVMDVEAP 118

Query: 69  PEYLRTPIFKKIYDYYSNNLDR 90
            E  + P+F+ ++ +  +  ++
Sbjct: 119 AEVAQIPVFQSLHSFVRDEREK 140


>gi|72390155|ref|XP_845372.1| hypothetical protein [Trypanosoma brucei TREU927]
 gi|62360469|gb|AAX80883.1| hypothetical protein, conserved [Trypanosoma brucei]
 gi|70801907|gb|AAZ11813.1| hypothetical protein, conserved [Trypanosoma brucei brucei strain
           927/4 GUTat10.1]
          Length = 146

 Score = 54.3 bits (129), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 49/82 (59%), Gaps = 1/82 (1%)

Query: 10  RKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFT-GMEKP 68
           R+++Y+   RG  EMD+ILG+F    I  LS+ +L   ++++   D++L+KW    +E P
Sbjct: 59  RRLLYQSTYRGMVEMDIILGAFARQNIETLSAPQLEEYDAVLRHFDNDLYKWLVMDVEAP 118

Query: 69  PEYLRTPIFKKIYDYYSNNLDR 90
            E  + P+F+ ++ +  +  ++
Sbjct: 119 AEVAQIPVFQSLHSFVRDEREK 140


>gi|307295469|ref|ZP_07575305.1| protein of unknown function DUF339 [Sphingobium chlorophenolicum
          L-1]
 gi|306878508|gb|EFN09728.1| protein of unknown function DUF339 [Sphingobium chlorophenolicum
          L-1]
          Length = 89

 Score = 54.3 bits (129), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 38/77 (49%)

Query: 4  NMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFT 63
          N + + R++ +R W RG +E DL +G F D +       EL   E  IEE D+++  W  
Sbjct: 2  NEDPRIRRLQFRAWHRGIKEADLAVGGFFDRYHAGWGEEELDWFERFIEEQDADIMAWAL 61

Query: 64 GMEKPPEYLRTPIFKKI 80
          G    P+    P++ K 
Sbjct: 62 GTLPLPDEWGGPMWDKF 78


>gi|310815668|ref|YP_003963632.1| TPR repeat family protein [Ketogulonicigenium vulgare Y25]
 gi|308754403|gb|ADO42332.1| TPR repeat family protein [Ketogulonicigenium vulgare Y25]
          Length = 89

 Score = 54.3 bits (129), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 40/64 (62%)

Query: 6  NLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGM 65
          +L+ R++  R  RRG +EMDL+LG F    + +L+  +L + E++++E+D ++  W TG 
Sbjct: 4  DLRLRRLHMRAIRRGIKEMDLLLGHFAAARLADLAPADLDLFEALLDENDHDIHAWATGA 63

Query: 66 EKPP 69
             P
Sbjct: 64 LPVP 67


>gi|304321709|ref|YP_003855352.1| hypothetical protein PB2503_10794 [Parvularcula bermudensis
          HTCC2503]
 gi|303300611|gb|ADM10210.1| hypothetical protein PB2503_10794 [Parvularcula bermudensis
          HTCC2503]
          Length = 96

 Score = 54.3 bits (129), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 44/83 (53%)

Query: 1  MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
          M++ M  + R+++YR   RG +E DL++G+F    +  ++  EL   + ++E  D  L+ 
Sbjct: 1  MEEIMPPERRRLLYRAQHRGFKEADLVIGTFAKQQLAAMTEAELEEFQRLLEVPDQELYA 60

Query: 61 WFTGMEKPPEYLRTPIFKKIYDY 83
          W  G E  P     P+ +++  +
Sbjct: 61 WIIGRETVPTNYEGPVMRQLQAF 83


>gi|326403947|ref|YP_004284029.1| hypothetical protein ACMV_18000 [Acidiphilium multivorum AIU301]
 gi|325050809|dbj|BAJ81147.1| hypothetical protein ACMV_18000 [Acidiphilium multivorum AIU301]
          Length = 102

 Score = 53.9 bits (128), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 40/73 (54%)

Query: 10 RKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPP 69
          R+++YR   RGT E DL++G F   +I  +    L  LE+++E  D+ L  W TG +  P
Sbjct: 14 RRLLYRATHRGTYENDLMIGGFARKYIDGMDDEALDALEAVMEHPDAELADWLTGRKPVP 73

Query: 70 EYLRTPIFKKIYD 82
              + + ++I D
Sbjct: 74 AEAESDMLRRIRD 86


>gi|299768695|ref|YP_003730721.1| hypothetical protein AOLE_02235 [Acinetobacter sp. DR1]
 gi|298698783|gb|ADI89348.1| hypothetical protein AOLE_02235 [Acinetobacter sp. DR1]
          Length = 85

 Score = 53.9 bits (128), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 45/81 (55%), Gaps = 4/81 (4%)

Query: 1  MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
          M   M L+ RK++YR  RRG +E+D+    +V ++ L     E  +   ++E++D +L  
Sbjct: 1  MSDEMTLEERKVIYRA-RRGLKEIDVYFDPYVKNYYLTADPAEKALFAELVEQEDPDLLD 59

Query: 61 WFTGMEKPPEYLRTPIFKKIY 81
          WF  + +PP   RT + + IY
Sbjct: 60 WFMEVSEPP---RTELREFIY 77


>gi|298712750|emb|CBJ33347.1| conserved unknown protein [Ectocarpus siliculosus]
          Length = 209

 Score = 53.5 bits (127), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 46/78 (58%)

Query: 10  RKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPP 69
           +++VYR  +RG  E+DL+LG++ +  +  LS+ ++   E I+  +  ++F + TG   PP
Sbjct: 113 KRLVYRSKQRGWLEVDLLLGTWAERNVAGLSAADMDSYEDILNLETVDIFNFITGNADPP 172

Query: 70  EYLRTPIFKKIYDYYSNN 87
            ++  P+  ++  Y  +N
Sbjct: 173 AFVDAPMLARLQAYVKSN 190


>gi|254293941|ref|YP_003059964.1| hypothetical protein Hbal_1579 [Hirschia baltica ATCC 49814]
 gi|254042472|gb|ACT59267.1| protein of unknown function DUF339 [Hirschia baltica ATCC 49814]
          Length = 91

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 42/72 (58%)

Query: 5  MNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTG 64
          M+ + RK+++R   RG +EMD+++G F    + ++    L   E +++ DD +++ W  G
Sbjct: 1  MDARRRKLLFRANHRGFKEMDMMMGEFAGKHLDQMDEKALDEFERLLDTDDQDVYGWIIG 60

Query: 65 MEKPPEYLRTPI 76
           E+ PE L+  +
Sbjct: 61 REQEPEMLQGKV 72


>gi|163793171|ref|ZP_02187147.1| hypothetical protein BAL199_25319 [alpha proteobacterium BAL199]
 gi|159181817|gb|EDP66329.1| hypothetical protein BAL199_25319 [alpha proteobacterium BAL199]
          Length = 88

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 38/71 (53%)

Query: 10 RKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPP 69
          +++ YR    GT+E D++LG F    + +L   +L   E ++E DD  L+KW T  E PP
Sbjct: 10 KRLYYRSTYTGTKETDVLLGGFAARHLTDLDDQQLADYEKLLEIDDPRLYKWATSQETPP 69

Query: 70 EYLRTPIFKKI 80
              T + + I
Sbjct: 70 PEYDTSVLRLI 80


>gi|40063588|gb|AAR38377.1| conserved hypothetical protein [uncultured marine bacterium 582]
          Length = 87

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 41/63 (65%)

Query: 8  QCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEK 67
          + +++  R  RRG +EMDLIL +F +  + +++  +L + ++++ E+D +L++W TG   
Sbjct: 8  RVKRLKMRSMRRGIKEMDLILSAFANSHLEKMTEADLILYDAMLSENDHDLYQWVTGQIA 67

Query: 68 PPE 70
           PE
Sbjct: 68 APE 70


>gi|315499870|ref|YP_004088673.1| hypothetical protein Astex_2885 [Asticcacaulis excentricus CB 48]
 gi|315417882|gb|ADU14522.1| protein of unknown function DUF339 [Asticcacaulis excentricus CB
          48]
          Length = 105

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 45/77 (58%)

Query: 8  QCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEK 67
          + RK+ +R  RRG +E D+ILG F + ++  +++ +L + E+++E  D +L+ W    + 
Sbjct: 20 RLRKLWFRASRRGFKEADIILGHFAEEYLPTMTAEQLDIFEALLEAPDQDLYGWIIERDP 79

Query: 68 PPEYLRTPIFKKIYDYY 84
           P   ++ I  ++  YY
Sbjct: 80 VPPEHKSEIMSQLNQYY 96


>gi|218506538|ref|ZP_03504416.1| hypothetical protein RetlB5_02499 [Rhizobium etli Brasil 5]
          Length = 84

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 35/63 (55%), Gaps = 3/63 (4%)

Query: 10 RKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPP 69
          R+I++RCW RG REMDL+ G F +  I  LS  EL   E+I+ E    +  W  G  +P 
Sbjct: 16 RRILFRCWHRGIREMDLVFGQFAEAEIATLSDAELDEFETIMAE---RIMTWSAGSWEPG 72

Query: 70 EYL 72
            L
Sbjct: 73 RCL 75


>gi|293610853|ref|ZP_06693153.1| hypothetical protein HMPREF0013_03011 [Acinetobacter sp. SH024]
 gi|292827197|gb|EFF85562.1| hypothetical protein HMPREF0013_03011 [Acinetobacter sp. SH024]
          Length = 85

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 46/81 (56%), Gaps = 4/81 (4%)

Query: 1  MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
          M   M L+ RK++YR  RRG +E+D+    +V ++ L+    E  +   +++++D +L  
Sbjct: 1  MSDEMTLEERKVIYRA-RRGLKEIDVYFDPYVKNYYLKADPAEKALFAELVDQEDPDLLD 59

Query: 61 WFTGMEKPPEYLRTPIFKKIY 81
          WF  + +PP   RT + + IY
Sbjct: 60 WFMEVSEPP---RTELREFIY 77


>gi|254451743|ref|ZP_05065180.1| conserved hypothetical protein [Octadecabacter antarcticus 238]
 gi|198266149|gb|EDY90419.1| conserved hypothetical protein [Octadecabacter antarcticus 238]
          Length = 78

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 38/58 (65%), Gaps = 1/58 (1%)

Query: 15 RCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGM-EKPPEY 71
          R  RRG +EMDLIL  F    + +L + +L + + ++ E+D +L++W +G  ++PPEY
Sbjct: 2  RSIRRGIKEMDLILTGFSKAHLAQLGAAQLAVYDRMLNENDHDLYQWVSGQSDEPPEY 59


>gi|126643067|ref|YP_001086051.1| hypothetical protein A1S_3052 [Acinetobacter baumannii ATCC
          17978]
          Length = 81

 Score = 52.8 bits (125), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 39/65 (60%), Gaps = 1/65 (1%)

Query: 5  MNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTG 64
          M L+ RK++YR  RRG +E+D+    +V ++ L+    E  +   ++E++D +L  WF  
Sbjct: 1  MTLEERKVIYRA-RRGLKEIDVYFDPYVKNYYLKADPAEKALFAELVEQEDPDLLDWFME 59

Query: 65 MEKPP 69
          + +PP
Sbjct: 60 VSEPP 64


>gi|255630474|gb|ACU15595.1| unknown [Glycine max]
          Length = 182

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 47/80 (58%), Gaps = 1/80 (1%)

Query: 11  KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
           +++YR  +RG  E+DL+LG +V+  I  L    +  L  +++ ++ +L+KW +G E+PPE
Sbjct: 69  RLLYRSKQRGFLELDLVLGKWVEENIHSLDENRIKALIHVLDLENPDLWKWISGQEQPPE 128

Query: 71  YLRTP-IFKKIYDYYSNNLD 89
            +    +F  + +    NLD
Sbjct: 129 SVSANLVFAAVRERVKKNLD 148


>gi|149186683|ref|ZP_01864994.1| hypothetical protein ED21_29331 [Erythrobacter sp. SD-21]
 gi|148829591|gb|EDL48031.1| hypothetical protein ED21_29331 [Erythrobacter sp. SD-21]
          Length = 92

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 37/67 (55%)

Query: 14 YRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPEYLR 73
          +R W RGTRE D ++G F D +  +  + EL   E+++EEDD ++  W    +  P   +
Sbjct: 16 FRSWHRGTREADYMIGGFFDRYHADWGAEELAWFEALLEEDDVDIMAWALKTQPTPPRFQ 75

Query: 74 TPIFKKI 80
            + +K+
Sbjct: 76 GELIEKM 82


>gi|99081573|ref|YP_613727.1| hypothetical protein TM1040_1732 [Ruegeria sp. TM1040]
 gi|99037853|gb|ABF64465.1| protein of unknown function DUF339 [Ruegeria sp. TM1040]
          Length = 92

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 38/63 (60%)

Query: 8  QCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEK 67
          + +++  R  RRG +EMD++L  +    +  +S  +L + ++++ E+D +L++W TG   
Sbjct: 15 RIKRLTMRSMRRGIKEMDILLSGYAAANLAAMSDAQLALYDALLRENDQDLYQWVTGQTP 74

Query: 68 PPE 70
           PE
Sbjct: 75 APE 77


>gi|259418444|ref|ZP_05742362.1| TPR repeat family protein [Silicibacter sp. TrichCH4B]
 gi|259345839|gb|EEW57683.1| TPR repeat family protein [Silicibacter sp. TrichCH4B]
          Length = 92

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 42/70 (60%)

Query: 1  MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
          ++++  ++ +++  R  RRG +EMD++L  F    + E++  +L   + ++ E+D +L++
Sbjct: 8  LEESREIRIKRLTMRSMRRGIKEMDILLSGFAAANLAEMTDAQLGEYDHLLRENDQDLYQ 67

Query: 61 WFTGMEKPPE 70
          W TG    PE
Sbjct: 68 WVTGQAPAPE 77


>gi|71666559|ref|XP_820237.1| hypothetical protein [Trypanosoma cruzi strain CL Brener]
 gi|70885574|gb|EAN98386.1| hypothetical protein, conserved [Trypanosoma cruzi]
          Length = 145

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 37/60 (61%)

Query: 10  RKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPP 69
           R+++Y+   RG  EMD+ILG+F  H +  +   +L   ++I+   DS+LFKW    EKPP
Sbjct: 58  RRLIYQSAYRGMAEMDIILGAFSRHSLEGMPREQLDEYDTILRHFDSDLFKWLVMNEKPP 117


>gi|255319784|ref|ZP_05360989.1| TPR repeat-containing domain protein [Acinetobacter
          radioresistens SK82]
 gi|262380318|ref|ZP_06073472.1| UPF0350 protein [Acinetobacter radioresistens SH164]
 gi|255303103|gb|EET82315.1| TPR repeat-containing domain protein [Acinetobacter
          radioresistens SK82]
 gi|262297764|gb|EEY85679.1| UPF0350 protein [Acinetobacter radioresistens SH164]
          Length = 85

 Score = 52.0 bits (123), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 39/69 (56%), Gaps = 1/69 (1%)

Query: 1  MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
          M + M L+ RK++YR  RRG +E+D+    +V  + L+  + E      ++ ++D +L  
Sbjct: 1  MSEEMTLEERKVIYRA-RRGLKEIDVYFDPYVKQYYLQADAEEKATFAELVAQEDPDLLD 59

Query: 61 WFTGMEKPP 69
          WF  + +PP
Sbjct: 60 WFMEVSEPP 68


>gi|144898257|emb|CAM75121.1| protein containing DUF339 [Magnetospirillum gryphiswaldense
          MSR-1]
          Length = 88

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 20/79 (25%), Positives = 45/79 (56%)

Query: 8  QCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEK 67
          + +++ +R    G+ E D++ G F + ++  LS+ ++   E++I E D++LF W TG  +
Sbjct: 5  RLKRLKFRAHHMGSNENDILFGGFAEKYLYSLSAEQVDRFETLIAETDTDLFNWVTGKVE 64

Query: 68 PPEYLRTPIFKKIYDYYSN 86
           P +L   + + + ++  N
Sbjct: 65 VPVHLDHDVMQMVRNFVQN 83


>gi|167515466|ref|XP_001742074.1| hypothetical protein [Monosiga brevicollis MX1]
 gi|163778698|gb|EDQ92312.1| predicted protein [Monosiga brevicollis MX1]
          Length = 172

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 46/79 (58%), Gaps = 3/79 (3%)

Query: 11  KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDS--NLFKWFTGMEKP 68
           ++VY+  +RG +E DLI  +F   ++ +LS  ++  L+ I+ E D+  ++F W +G    
Sbjct: 75  RLVYQARKRGIKENDLIFSTFCHKYLDQLSRPQMEQLDIILNEHDNEWDMFNWLSGTRPA 134

Query: 69  PEYLRT-PIFKKIYDYYSN 86
           PEYL+   +F  + D+  N
Sbjct: 135 PEYLKELELFGALVDHTQN 153


>gi|262377283|ref|ZP_06070507.1| conserved hypothetical protein [Acinetobacter lwoffii SH145]
 gi|262307736|gb|EEY88875.1| conserved hypothetical protein [Acinetobacter lwoffii SH145]
          Length = 85

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 40/69 (57%), Gaps = 1/69 (1%)

Query: 1  MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
          M  +++L+ RK++YR  RRG +E+D+    +V +  L     E  M   ++E++D +L  
Sbjct: 1  MTDDISLEERKVIYRA-RRGLKELDVYFDPYVKNHYLNAEPFEKQMFAELVEQEDPDLLD 59

Query: 61 WFTGMEKPP 69
          WF  + +PP
Sbjct: 60 WFMEVSEPP 68


>gi|255633446|gb|ACU17081.1| unknown [Glycine max]
          Length = 175

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 48/80 (60%), Gaps = 1/80 (1%)

Query: 11  KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
           +++YR  +RG  E+DL+LG +V+  I  L    +  L  +++ ++ +L+KW +G E+PPE
Sbjct: 62  RLLYRSKQRGFLELDLVLGKWVEDNIHSLDEYRVRALILLLDLENPDLWKWISGQEQPPE 121

Query: 71  YLR-TPIFKKIYDYYSNNLD 89
            +   P+F  + +    NL+
Sbjct: 122 SIHINPVFAAVREGVMKNLE 141


>gi|50086186|ref|YP_047696.1| hypothetical protein ACIAD3189 [Acinetobacter sp. ADP1]
 gi|81175081|sp|Q6F7U1|Y3189_ACIAD RecName: Full=UPF0350 protein ACIAD3189
 gi|49532162|emb|CAG69874.1| conserved hypothetical protein [Acinetobacter sp. ADP1]
          Length = 85

 Score = 51.6 bits (122), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 46/83 (55%), Gaps = 1/83 (1%)

Query: 1  MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
          M + + L+ RK++YR  RRG +E+D+    +V ++ L   + E  +   ++ ++D +L  
Sbjct: 1  MSEELTLEERKVIYRA-RRGLKEIDVYFDPYVKNYYLTAPASEKALFAELVAQEDPDLLD 59

Query: 61 WFTGMEKPPEYLRTPIFKKIYDY 83
          WF  + +PP+     + +K+  Y
Sbjct: 60 WFMEVSEPPQVELKQLIQKLKHY 82


>gi|262373490|ref|ZP_06066768.1| conserved hypothetical protein [Acinetobacter junii SH205]
 gi|262311243|gb|EEY92329.1| conserved hypothetical protein [Acinetobacter junii SH205]
          Length = 85

 Score = 51.6 bits (122), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 43/79 (54%), Gaps = 2/79 (2%)

Query: 1  MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
          M   M L+ RK++YR  RRG +E+D+    +V  + L     E  +   +++++D +L  
Sbjct: 1  MSDEMTLEERKVIYRA-RRGLKEIDVYFDPYVKQYYLTADPTEKALFAELVDQEDPDLLD 59

Query: 61 WFTGMEKPP-EYLRTPIFK 78
          WF  + +PP E L+  I K
Sbjct: 60 WFMEVGEPPREELKAFILK 78


>gi|163734589|ref|ZP_02142028.1| hypothetical protein RLO149_14218 [Roseobacter litoralis Och 149]
 gi|161392082|gb|EDQ16412.1| hypothetical protein RLO149_14218 [Roseobacter litoralis Och 149]
          Length = 88

 Score = 51.6 bits (122), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 38/63 (60%)

Query: 8  QCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEK 67
          + +++  R  RRG +EMDLIL  F +  +  +    LT  ++++ E+D +L++W TG   
Sbjct: 8  RIKRLKMRSMRRGIKEMDLILQHFAERKLEGMDDAGLTHYDAMLNENDHDLYQWVTGQIA 67

Query: 68 PPE 70
          PPE
Sbjct: 68 PPE 70


>gi|325123575|gb|ADY83098.1| hypothetical protein BDGL_002512 [Acinetobacter calcoaceticus
          PHEA-2]
          Length = 81

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 39/65 (60%), Gaps = 1/65 (1%)

Query: 5  MNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTG 64
          M L+ RK++YR  RRG +E+D+    +V ++ L+    E  +   +++++D +L  WF  
Sbjct: 1  MTLEERKVIYRA-RRGLKEIDVYFDPYVKNYYLKADPAEKALFAELVDQEDPDLLDWFME 59

Query: 65 MEKPP 69
          + +PP
Sbjct: 60 VSEPP 64


>gi|15241359|ref|NP_199917.1| unknown protein [Arabidopsis thaliana]
 gi|9758251|dbj|BAB08750.1| unnamed protein product [Arabidopsis thaliana]
 gi|98960953|gb|ABF58960.1| At5g51040 [Arabidopsis thaliana]
 gi|110738284|dbj|BAF01071.1| hypothetical protein [Arabidopsis thaliana]
 gi|332008641|gb|AED96024.1| uncharacterized protein [Arabidopsis thaliana]
          Length = 188

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 50/81 (61%), Gaps = 1/81 (1%)

Query: 11  KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
           +++YR  +RG  E+DL+LG++V+  +  +    +  L  ++  ++ +L+KW T  E+PPE
Sbjct: 75  RLLYRSKQRGFLELDLVLGNWVEENVNSMDENGVKSLIHVLNLENPDLWKWLTEQEQPPE 134

Query: 71  YLRT-PIFKKIYDYYSNNLDR 90
            + + P+F  +++    NL++
Sbjct: 135 AVSSNPVFSALHEKVMKNLNK 155


>gi|21592766|gb|AAM64715.1| unknown [Arabidopsis thaliana]
          Length = 188

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 50/81 (61%), Gaps = 1/81 (1%)

Query: 11  KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
           +++YR  +RG  E+DL+LG++V+  +  +    +  L  ++  ++ +L+KW T  E+PPE
Sbjct: 75  RLLYRSKQRGFLELDLVLGNWVEENVNSMDENGVKSLIHVLNLENPDLWKWLTEQEQPPE 134

Query: 71  YLRT-PIFKKIYDYYSNNLDR 90
            + + P+F  +++    NL++
Sbjct: 135 AVSSNPVFSALHEKVMKNLNK 155


>gi|157803548|ref|YP_001492097.1| hypothetical protein A1E_01835 [Rickettsia canadensis str.
          McKiel]
 gi|157784811|gb|ABV73312.1| hypothetical protein A1E_01835 [Rickettsia canadensis str.
          McKiel]
          Length = 87

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 42/79 (53%)

Query: 2  KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
          K N N   +K++Y    RG +EMD ILGSF + ++  +   +L     I++++D++L+ W
Sbjct: 3  KLNKNSLQKKLLYLSKNRGCKEMDYILGSFTEKYLSLMDEKKLESYALILDQNDNDLYNW 62

Query: 62 FTGMEKPPEYLRTPIFKKI 80
                 P YL   I  K+
Sbjct: 63 INNKSSAPSYLDIEIIDKL 81


>gi|302849792|ref|XP_002956425.1| hypothetical protein VOLCADRAFT_66963 [Volvox carteri f.
          nagariensis]
 gi|300258331|gb|EFJ42569.1| hypothetical protein VOLCADRAFT_66963 [Volvox carteri f.
          nagariensis]
          Length = 110

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 48/79 (60%), Gaps = 1/79 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          K++YR  +RG  E+DL++G + +  I ++   EL  +  ++EE++ +LFKW TG  +PP+
Sbjct: 4  KLLYRSKQRGFLELDLLIGLWAEVNIPKMDFAELKQMALVLEEENPDLFKWLTGQLQPPD 63

Query: 71 YLR-TPIFKKIYDYYSNNL 88
           +    +F+ +  + +  L
Sbjct: 64 RMSGNAVFEALRRHVAQQL 82


>gi|322823537|gb|EFZ29268.1| hypothetical protein TCSYLVIO_4481 [Trypanosoma cruzi]
          Length = 145

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 39/64 (60%)

Query: 6   NLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGM 65
           + + R+++Y+   RG  EMD+ILG+F  H +  +   +L   ++I+   DS+LFKW    
Sbjct: 54  DAKRRRLIYQSAYRGMVEMDIILGAFSRHSLEGMPREQLDEYDTILRHFDSDLFKWLVMD 113

Query: 66  EKPP 69
           EKPP
Sbjct: 114 EKPP 117


>gi|254475964|ref|ZP_05089350.1| TPR repeat family protein [Ruegeria sp. R11]
 gi|214030207|gb|EEB71042.1| TPR repeat family protein [Ruegeria sp. R11]
          Length = 94

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 17/63 (26%), Positives = 39/63 (61%)

Query: 8  QCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEK 67
          + +++  R  RRG +EMD++L ++    +  +S  +L + ++++ E+D +L++W TG   
Sbjct: 18 RIKRLTMRSMRRGIKEMDILLSAYAAQKLAAMSDADLDLYDALLHENDQDLYQWVTGQVA 77

Query: 68 PPE 70
           P+
Sbjct: 78 APQ 80


>gi|83954061|ref|ZP_00962781.1| TPR repeat family protein [Sulfitobacter sp. NAS-14.1]
 gi|83841098|gb|EAP80268.1| TPR repeat family protein [Sulfitobacter sp. NAS-14.1]
          Length = 88

 Score = 51.2 bits (121), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 43/80 (53%), Gaps = 1/80 (1%)

Query: 8  QCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEK 67
          + +++  R  RRG +EMDLIL S+    +  +    L++ + ++ E+D +L++W TG   
Sbjct: 8  KVKRLHMRSMRRGIKEMDLILPSYASTRLATMDDAALSLYDDMLSENDHDLYQWVTGQTP 67

Query: 68 PPEYLRTPIFKKIYDYYSNN 87
           PE   T +   I  + + N
Sbjct: 68 APEPF-TALIADIQTHLAAN 86


>gi|71649137|ref|XP_813320.1| hypothetical protein [Trypanosoma cruzi strain CL Brener]
 gi|70878192|gb|EAN91469.1| hypothetical protein, conserved [Trypanosoma cruzi]
          Length = 145

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 39/64 (60%)

Query: 6   NLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGM 65
           + + R+++Y+   RG  EMD+ILG+F  H +  +   +L   ++I+   DS+LFKW    
Sbjct: 54  DAKRRRLIYQSAYRGMVEMDIILGAFSRHSLEGMPREQLDEYDTILRHFDSDLFKWLVMD 113

Query: 66  EKPP 69
           EKPP
Sbjct: 114 EKPP 117


>gi|94495556|ref|ZP_01302136.1| hypothetical protein SKA58_05890 [Sphingomonas sp. SKA58]
 gi|94424944|gb|EAT09965.1| hypothetical protein SKA58_05890 [Sphingomonas sp. SKA58]
          Length = 92

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 35/69 (50%)

Query: 8  QCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEK 67
            R++ +R W RGTRE D  +G F D +    +  E+   E  +EE D+++  W  G   
Sbjct: 11 HLRRMKFRAWHRGTRESDYTVGGFFDRYHATWNEEEIAWFERFMEEQDADIMGWAMGTIP 70

Query: 68 PPEYLRTPI 76
           P+  + P+
Sbjct: 71 VPDEWKGPM 79


>gi|89071274|ref|ZP_01158445.1| TPR repeat family protein [Oceanicola granulosus HTCC2516]
 gi|89043204|gb|EAR49437.1| TPR repeat family protein [Oceanicola granulosus HTCC2516]
          Length = 87

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 37/64 (57%)

Query: 1  MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
          M +    + +++  R  RRG +EMDL+L +F D  +  LS  EL   E ++EE D +L+ 
Sbjct: 1  MSERHETRLKRLRMRSMRRGMKEMDLLLMAFADARLAGLSGSELDAYERLLEESDQDLYA 60

Query: 61 WFTG 64
          W +G
Sbjct: 61 WISG 64


>gi|126730937|ref|ZP_01746746.1| hypothetical protein SSE37_14028 [Sagittula stellata E-37]
 gi|126708653|gb|EBA07710.1| hypothetical protein SSE37_14028 [Sagittula stellata E-37]
          Length = 91

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 22/86 (25%), Positives = 49/86 (56%), Gaps = 1/86 (1%)

Query: 1  MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
          +++  +++ +++  R  RRGT+EMD++L  F +  +  L    L   E++++E+D +L++
Sbjct: 6  IRETHDIRLKRLTMRSMRRGTKEMDILLMRFAEARLAALDPAALDAYEALLDENDQDLYQ 65

Query: 61 WFTGMEKPPEYLRTPIFKKIYDYYSN 86
          W +G ++P      P+  +I     N
Sbjct: 66 WISG-QRPAPAAHAPLIAEIASVAGN 90


>gi|258542201|ref|YP_003187634.1| hypothetical protein APA01_11050 [Acetobacter pasteurianus IFO
           3283-01]
 gi|256633279|dbj|BAH99254.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-01]
 gi|256636338|dbj|BAI02307.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-03]
 gi|256639391|dbj|BAI05353.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-07]
 gi|256642447|dbj|BAI08402.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-22]
 gi|256645502|dbj|BAI11450.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-26]
 gi|256648555|dbj|BAI14496.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-32]
 gi|256651608|dbj|BAI17542.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256654599|dbj|BAI20526.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-12]
          Length = 109

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 46/81 (56%)

Query: 2   KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
           + N+  + R++ +R   RGT E D+++G FV+     +++ ELT +E+I+E  D  L  W
Sbjct: 21  EDNLAARRRRLKFRANHRGTFETDILIGGFVEANADTMTAEELTDMENILEMPDPELTDW 80

Query: 62  FTGMEKPPEYLRTPIFKKIYD 82
             G    PE   TP+ +++ +
Sbjct: 81  LFGRLPLPEEKATPMLRRMVE 101


>gi|83942890|ref|ZP_00955350.1| TPR repeat-containing protein [Sulfitobacter sp. EE-36]
 gi|83845898|gb|EAP83775.1| TPR repeat-containing protein [Sulfitobacter sp. EE-36]
          Length = 88

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 43/80 (53%), Gaps = 1/80 (1%)

Query: 8  QCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEK 67
          + +++  R  RRG +EMDLIL S+    +  +    L++ + ++ E+D +L++W TG   
Sbjct: 8  KVKRLHMRSMRRGIKEMDLILPSYAATRLATMDDAALSLYDDMLSENDHDLYQWVTGQTP 67

Query: 68 PPEYLRTPIFKKIYDYYSNN 87
           PE   T +   I  + + N
Sbjct: 68 APEPF-TALIADIQTHLAAN 86


>gi|83311565|ref|YP_421829.1| hypothetical protein amb2466 [Magnetospirillum magneticum AMB-1]
 gi|82946406|dbj|BAE51270.1| Uncharacterized conserved protein [Magnetospirillum magneticum
          AMB-1]
          Length = 105

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 40/73 (54%)

Query: 8  QCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEK 67
          + +++++R    G+ E D++ G F   ++  L+S +    ES+I E+DS+LF W TG  +
Sbjct: 22 RLKRLMFRAHHMGSNENDILFGGFAAKYLETLTSEQAERFESLIAENDSDLFNWVTGKAE 81

Query: 68 PPEYLRTPIFKKI 80
           P  L   +   I
Sbjct: 82 VPAVLDHDVMAMI 94


>gi|46202165|ref|ZP_00053647.2| COG2938: Uncharacterized conserved protein [Magnetospirillum
          magnetotacticum MS-1]
          Length = 88

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 41/73 (56%)

Query: 8  QCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEK 67
          + +++++R    G+ E D++ G F   +++ LS  +    E++I E+DS+LF W T   +
Sbjct: 5  RLKRLMFRAHHMGSNENDILFGGFAAKYLMSLSPDQAERFEALIAENDSDLFNWVTSKAE 64

Query: 68 PPEYLRTPIFKKI 80
           P++L   +   I
Sbjct: 65 VPDHLDHDVMAMI 77


>gi|297792415|ref|XP_002864092.1| hypothetical protein ARALYDRAFT_495170 [Arabidopsis lyrata subsp.
           lyrata]
 gi|297309927|gb|EFH40351.1| hypothetical protein ARALYDRAFT_495170 [Arabidopsis lyrata subsp.
           lyrata]
          Length = 185

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 50/81 (61%), Gaps = 1/81 (1%)

Query: 11  KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
           +++YR  +RG  E+DL+LG++V+  +  +    +  L  ++  ++ +L+KW T  E+PPE
Sbjct: 72  RLLYRSKQRGFLELDLVLGNWVEENVDSMDENGVKSLIHVLNLENPDLWKWLTEQEQPPE 131

Query: 71  YLRT-PIFKKIYDYYSNNLDR 90
            + + P+F  +++    NL++
Sbjct: 132 EVSSNPVFSALHEKVMKNLNK 152


>gi|209880044|ref|XP_002141462.1| TPR repeat-containing protein [Cryptosporidium muris RN66]
 gi|209557068|gb|EEA07113.1| TPR repeat-containing protein [Cryptosporidium muris RN66]
          Length = 124

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 45/82 (54%)

Query: 6   NLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGM 65
           N Q +K+ +RC   G +E+D+I  +F D+++ ELS ++L   + ++  +  +L+ W TG 
Sbjct: 38  NTQRQKLRHRCCNTGLKELDIIFKNFSDNYLDELSCIQLKEFDLLLRNETLDLYDWLTGK 97

Query: 66  EKPPEYLRTPIFKKIYDYYSNN 87
              P  ++      +  Y +NN
Sbjct: 98  RSTPSEIKNLTTWNLLTYKTNN 119


>gi|329113370|ref|ZP_08242151.1| Hypothetical protein APO_0135 [Acetobacter pomorum DM001]
 gi|326697195|gb|EGE48855.1| Hypothetical protein APO_0135 [Acetobacter pomorum DM001]
          Length = 108

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 46/81 (56%)

Query: 2   KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
           + N+  + R++ +R   RGT E D+++G FV+     +++ ELT +E+I+E  D  L  W
Sbjct: 20  EDNLAARRRRLKFRANHRGTFETDILIGGFVEANADTMTAEELTDMENILEMPDPELTDW 79

Query: 62  FTGMEKPPEYLRTPIFKKIYD 82
             G    PE   TP+ +++ +
Sbjct: 80  LFGRLPLPEEKATPMLRRMVE 100


>gi|281206223|gb|EFA80412.1| DUF339 family protein [Polysphondylium pallidum PN500]
          Length = 137

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 46/84 (54%)

Query: 4   NMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFT 63
           N ++  +K++Y+   RG  E DL+LGSF   ++ +    +L   ++II++ D +++ W  
Sbjct: 47  NTDILRKKLIYQSKERGMLENDLLLGSFASKYLNDFDHNKLVEYDNIIQQPDPDIYNWAL 106

Query: 64  GMEKPPEYLRTPIFKKIYDYYSNN 87
             +  PE L T + K +  +  NN
Sbjct: 107 NKQDIPEELNTEVMKLLQHHCQNN 130


>gi|110681029|ref|YP_684036.1| hypothetical protein RD1_3890 [Roseobacter denitrificans OCh 114]
 gi|109457145|gb|ABG33350.1| conserved hypothetical protein [Roseobacter denitrificans OCh
          114]
          Length = 88

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 37/63 (58%)

Query: 8  QCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEK 67
          + +++  R  RRG +EMDLIL  F +  +  +    L   ++++ E+D +L++W TG   
Sbjct: 8  RIKRLKMRSMRRGIKEMDLILQHFAERQLDGMDDAGLGQYDAMLNENDHDLYQWVTGQVA 67

Query: 68 PPE 70
          PPE
Sbjct: 68 PPE 70


>gi|79330527|ref|NP_001032052.1| unknown protein [Arabidopsis thaliana]
 gi|222423776|dbj|BAH19854.1| AT5G51040 [Arabidopsis thaliana]
 gi|332008642|gb|AED96025.1| uncharacterized protein [Arabidopsis thaliana]
          Length = 184

 Score = 50.8 bits (120), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 49/82 (59%), Gaps = 1/82 (1%)

Query: 10  RKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPP 69
           R+ + R  +RG  E+DL+LG++V+  +  +    +  L  ++  ++ +L+KW T  E+PP
Sbjct: 70  RRTINRSKQRGFLELDLVLGNWVEENVNSMDENGVKSLIHVLNLENPDLWKWLTEQEQPP 129

Query: 70  EYLRT-PIFKKIYDYYSNNLDR 90
           E + + P+F  +++    NL++
Sbjct: 130 EAVSSNPVFSALHEKVMKNLNK 151


>gi|269958467|ref|YP_003328254.1| hypothetical protein ACIS_00270 [Anaplasma centrale str. Israel]
 gi|269848296|gb|ACZ48940.1| hypothetical protein ACIS_00270 [Anaplasma centrale str. Israel]
          Length = 110

 Score = 50.4 bits (119), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 40/78 (51%)

Query: 10  RKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPP 69
           R+++YR   RG +E D++LG+F   ++  L   EL   E I+E DD  L+ +  G  + P
Sbjct: 33  RRLLYRSTHRGCKETDILLGAFAREYLALLDEEELAQYEKIVELDDELLYSYIVGRREVP 92

Query: 70  EYLRTPIFKKIYDYYSNN 87
             +   +  +I +  S  
Sbjct: 93  SSIDKALVSRIANCVSGK 110


>gi|163737398|ref|ZP_02144815.1| TPR repeat family protein [Phaeobacter gallaeciensis BS107]
 gi|163740932|ref|ZP_02148325.1| TPR repeat family protein [Phaeobacter gallaeciensis 2.10]
 gi|161385923|gb|EDQ10299.1| TPR repeat family protein [Phaeobacter gallaeciensis 2.10]
 gi|161388924|gb|EDQ13276.1| TPR repeat family protein [Phaeobacter gallaeciensis BS107]
          Length = 86

 Score = 50.4 bits (119), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 37/60 (61%)

Query: 10 RKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPP 69
          +++  R  RRG +EMD++L ++ D  +  +   EL + + +++E+D +L++W TG    P
Sbjct: 10 KRLQMRSMRRGIKEMDILLSAYADRNLAVMGPAELDLYDRLLQENDQDLYQWVTGQVAAP 69


>gi|302783166|ref|XP_002973356.1| hypothetical protein SELMODRAFT_98920 [Selaginella
          moellendorffii]
 gi|302789552|ref|XP_002976544.1| hypothetical protein SELMODRAFT_105340 [Selaginella
          moellendorffii]
 gi|300155582|gb|EFJ22213.1| hypothetical protein SELMODRAFT_105340 [Selaginella
          moellendorffii]
 gi|300159109|gb|EFJ25730.1| hypothetical protein SELMODRAFT_98920 [Selaginella
          moellendorffii]
          Length = 122

 Score = 50.4 bits (119), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 45/80 (56%), Gaps = 1/80 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          +++YR  +RG  E+DL+LG +    I +L    L  L  +++ ++ +L+KW TG  + PE
Sbjct: 8  RLLYRSKQRGFLELDLVLGKWTQENIHQLDDKHLESLIQVLDLENPDLWKWLTGQAEVPE 67

Query: 71 YLRT-PIFKKIYDYYSNNLD 89
           +   P+F  I    S NL+
Sbjct: 68 SITANPVFACIQKQISGNLE 87


>gi|84687909|ref|ZP_01015776.1| TPR repeat family protein [Maritimibacter alkaliphilus HTCC2654]
 gi|84664103|gb|EAQ10600.1| TPR repeat family protein [Rhodobacterales bacterium HTCC2654]
          Length = 86

 Score = 50.4 bits (119), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 49/85 (57%), Gaps = 1/85 (1%)

Query: 1  MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
          M +    + +++  R WRRGT+EMD+ILG + D  +  + + +L + ++++ E+D +L++
Sbjct: 1  MNETAENRLKRMNMRSWRRGTKEMDMILGPYSDDRLATMDAADLDLYDALLLENDQDLYQ 60

Query: 61 WFTGMEKPPEYLRTPIFKKIYDYYS 85
          W +G    PE     +   I D+ +
Sbjct: 61 WVSGQVPAPERF-AGLIATIADHAA 84


>gi|157825986|ref|YP_001493706.1| hypothetical protein A1C_04680 [Rickettsia akari str. Hartford]
 gi|157799944|gb|ABV75198.1| hypothetical protein A1C_04680 [Rickettsia akari str. Hartford]
          Length = 87

 Score = 50.4 bits (119), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 41/79 (51%)

Query: 2  KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
          K N N   +K+ YR   R  +EMD ILGSF + ++  +   +L     I++++D++++ W
Sbjct: 3  KLNKNSLQKKLFYRSKNRSCKEMDYILGSFAEKYLSLMDEKKLECYTLILDQNDNDIYNW 62

Query: 62 FTGMEKPPEYLRTPIFKKI 80
                 P YL   I  K+
Sbjct: 63 INNESSAPSYLDAEIMDKL 81


>gi|149203900|ref|ZP_01880868.1| hypothetical protein RTM1035_10280 [Roseovarius sp. TM1035]
 gi|149142342|gb|EDM30387.1| hypothetical protein RTM1035_10280 [Roseovarius sp. TM1035]
          Length = 98

 Score = 50.4 bits (119), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 41/78 (52%), Gaps = 1/78 (1%)

Query: 10 RKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPP 69
          +++  R  RRG +EMD+IL  + +  +  + +  L   ++++ E+D +L++W TG   PP
Sbjct: 21 KRLRMRAMRRGIKEMDIILSRYAEARLGAMDAAALDGFDALLCENDQDLYQWVTGQAAPP 80

Query: 70 EYLRTPIFKKIYDYYSNN 87
               P+  +I    S  
Sbjct: 81 AQF-APLVAEIAAEASGG 97


>gi|58584317|ref|YP_197890.1| hypothetical protein Wbm0056 [Wolbachia endosymbiont strain TRS
          of Brugia malayi]
 gi|58418633|gb|AAW70648.1| Uncharacterized conserved protein [Wolbachia endosymbiont strain
          TRS of Brugia malayi]
          Length = 93

 Score = 50.4 bits (119), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 41/78 (52%)

Query: 10 RKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPP 69
          RK++YR W RG +E D++LG F  +++ + S  EL   E I++ DD  L+ + T     P
Sbjct: 11 RKLIYRSWHRGCKETDILLGYFALNYLDKFSLNELIEYEKIVDLDDYELYCYITCKTNLP 70

Query: 70 EYLRTPIFKKIYDYYSNN 87
            L + I   I  +   N
Sbjct: 71 SNLSSDIVNLITHFIKAN 88


>gi|254995303|ref|ZP_05277493.1| hypothetical protein AmarM_05065 [Anaplasma marginale str.
          Mississippi]
          Length = 88

 Score = 50.4 bits (119), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 38/71 (53%)

Query: 10 RKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPP 69
          R+++YR   RG +E D++LG+F   ++  L   EL   E I+E DD  L+ +  G    P
Sbjct: 11 RRLLYRSTHRGCKEADILLGAFAQRYLALLDEEELVQYEKIVELDDELLYSYIVGRRPVP 70

Query: 70 EYLRTPIFKKI 80
          + +   +  +I
Sbjct: 71 DSIDKALVSRI 81


>gi|255003481|ref|ZP_05278445.1| hypothetical protein AmarPR_04530 [Anaplasma marginale str.
          Puerto Rico]
 gi|255004606|ref|ZP_05279407.1| hypothetical protein AmarV_04895 [Anaplasma marginale str.
          Virginia]
          Length = 88

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 38/71 (53%)

Query: 10 RKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPP 69
          R+++YR   RG +E D++LG+F   ++  L   EL   E I+E DD  L+ +  G    P
Sbjct: 11 RRLLYRSTHRGCKETDILLGAFAQRYLALLDEEELVQYEKIVELDDELLYSYIVGRRPVP 70

Query: 70 EYLRTPIFKKI 80
          + +   +  +I
Sbjct: 71 DSIDKALVSRI 81


>gi|312113595|ref|YP_004011191.1| hypothetical protein Rvan_0816 [Rhodomicrobium vannielii ATCC
          17100]
 gi|311218724|gb|ADP70092.1| protein of unknown function DUF339 [Rhodomicrobium vannielii ATCC
          17100]
          Length = 83

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 43/81 (53%), Gaps = 2/81 (2%)

Query: 4  NMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFT 63
           + L+ ++ VYR   RGT+E+DLILG + +  +  +   +L   E+++   D ++  W  
Sbjct: 3  GLELRRKRAVYRALHRGTKELDLILGRYAEARVPLMEEAQLASFETVLAAQDPDVDLWIR 62

Query: 64 GMEKPPEYLRTPIFKKIYDYY 84
            + P E   + I  +I D+Y
Sbjct: 63 KGDAPGEL--SAIVAEIRDFY 81


>gi|83951510|ref|ZP_00960242.1| TPR repeat family protein [Roseovarius nubinhibens ISM]
 gi|83836516|gb|EAP75813.1| TPR repeat family protein [Roseovarius nubinhibens ISM]
          Length = 88

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 40/70 (57%)

Query: 1  MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
          M +  +++ +++  R  RRG +EMD++L  F +  +  +    L + + ++EE+D +L+ 
Sbjct: 1  MSEPRDIRLKRLTMRSMRRGIKEMDILLTRFAEAELASMPQEGLDLYDRLLEENDQDLYA 60

Query: 61 WFTGMEKPPE 70
          W TG    PE
Sbjct: 61 WVTGQTPAPE 70


>gi|116791666|gb|ABK26064.1| unknown [Picea sitchensis]
          Length = 190

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 43/73 (58%), Gaps = 1/73 (1%)

Query: 11  KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
           +++YR  +RG  E+DL+LG +V+  I  L    +  L  ++  ++ +L+KW +  E  PE
Sbjct: 78  RLLYRSKQRGLLELDLVLGKWVEENIQSLDETHIKALVEVLNLENPDLWKWLSAQEPAPE 137

Query: 71  YL-RTPIFKKIYD 82
            + + P+F  +++
Sbjct: 138 AVFKNPVFSALHE 150


>gi|56417131|ref|YP_154205.1| hypothetical protein AM1093 [Anaplasma marginale str. St. Maries]
 gi|222475496|ref|YP_002563913.1| hypothetical protein AMF_826 [Anaplasma marginale str. Florida]
 gi|56388363|gb|AAV86950.1| hypothetical protein AM1093 [Anaplasma marginale str. St. Maries]
 gi|222419634|gb|ACM49657.1| Conserved hypothetical protein [Anaplasma marginale str. Florida]
          Length = 110

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 39/78 (50%)

Query: 10  RKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPP 69
           R+++YR   RG +E D++LG+F   ++  L   EL   E I+E DD  L+ +  G    P
Sbjct: 33  RRLLYRSTHRGCKETDILLGAFAQRYLALLDEEELVQYEKIVELDDELLYSYIVGRRPVP 92

Query: 70  EYLRTPIFKKIYDYYSNN 87
           + +   +  +I    S  
Sbjct: 93  DSIDKALVSRISACASGK 110


>gi|126740656|ref|ZP_01756342.1| TPR repeat family protein [Roseobacter sp. SK209-2-6]
 gi|126718171|gb|EBA14887.1| TPR repeat family protein [Roseobacter sp. SK209-2-6]
          Length = 84

 Score = 49.7 bits (117), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 38/62 (61%)

Query: 8  QCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEK 67
          Q +++  R  RRG +EMD++L ++ D  +  + S +L + + ++ E+D +L++W TG   
Sbjct: 8  QIKRLKMRSMRRGIKEMDILLSAYADANLEAMESDKLELYDQLLHENDQDLYQWVTGQIP 67

Query: 68 PP 69
           P
Sbjct: 68 AP 69


>gi|163745990|ref|ZP_02153349.1| hypothetical protein OIHEL45_10398 [Oceanibulbus indolifex
          HEL-45]
 gi|161380735|gb|EDQ05145.1| hypothetical protein OIHEL45_10398 [Oceanibulbus indolifex
          HEL-45]
          Length = 88

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 39/63 (61%)

Query: 8  QCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEK 67
          + +++  R  RRG +EMDLIL ++ +  + ++    LT+ + ++ E+D +L+ W +G  +
Sbjct: 8  RLKRLQMRSMRRGIKEMDLILSAYAEARLPQMDDAGLTLYDQMLNENDHDLYLWVSGQTE 67

Query: 68 PPE 70
           PE
Sbjct: 68 APE 70


>gi|42520893|ref|NP_966808.1| hypothetical protein WD1087 [Wolbachia endosymbiont of Drosophila
          melanogaster]
 gi|58698450|ref|ZP_00373359.1| AER200Cp [Wolbachia endosymbiont of Drosophila ananassae]
 gi|99036033|ref|ZP_01315071.1| hypothetical protein Wendoof_01000088 [Wolbachia endosymbiont of
          Drosophila willistoni TSC#14030-0811.24]
 gi|225630817|ref|YP_002727608.1| hypothetical protein WRi_011210 [Wolbachia sp. wRi]
 gi|225631213|ref|ZP_03787909.1| hypothetical protein WUni_003680 [Wolbachia endosymbiont of
          Muscidifurax uniraptor]
 gi|42410634|gb|AAS14742.1| conserved hypothetical protein [Wolbachia endosymbiont of
          Drosophila melanogaster]
 gi|58535042|gb|EAL59132.1| AER200Cp [Wolbachia endosymbiont of Drosophila ananassae]
 gi|225591093|gb|EEH12279.1| hypothetical protein WUni_003680 [Wolbachia endosymbiont of
          Muscidifurax uniraptor]
 gi|225592798|gb|ACN95817.1| hypothetical protein WRi_011210 [Wolbachia sp. wRi]
          Length = 92

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 40/78 (51%)

Query: 10 RKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPP 69
          RK++YR W RG +E D++LG F   ++ + S  EL   E I++ DD  L+ + T     P
Sbjct: 9  RKLIYRSWHRGCKETDILLGHFALKYLDKFSLSELIEYEKIVDLDDYELYCYITRKTNLP 68

Query: 70 EYLRTPIFKKIYDYYSNN 87
            L + I   I  +   N
Sbjct: 69 PGLNSQIVNLIACFIEAN 86


>gi|85708436|ref|ZP_01039502.1| hypothetical protein NAP1_04335 [Erythrobacter sp. NAP1]
 gi|85689970|gb|EAQ29973.1| hypothetical protein NAP1_04335 [Erythrobacter sp. NAP1]
          Length = 92

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 38/77 (49%)

Query: 4  NMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFT 63
           +  +  +  +R W RGTRE D ++G + D +  E    E+   E ++ EDD ++  W  
Sbjct: 6  TLETRLARAKFRAWHRGTREADYMIGGYFDRYHAEWGEKEMDWFEDLLAEDDVDVMAWGL 65

Query: 64 GMEKPPEYLRTPIFKKI 80
            +  PE  +  + +K+
Sbjct: 66 KTQPVPERFQGEMIEKM 82


>gi|299744835|ref|XP_002910843.1| mitochondrial protein [Coprinopsis cinerea okayama7#130]
 gi|298406310|gb|EFI27349.1| mitochondrial protein [Coprinopsis cinerea okayama7#130]
          Length = 156

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 46/77 (59%), Gaps = 1/77 (1%)

Query: 11  KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
           ++VY+  +RGT E DL+L +F    + ++S  EL   + +++E D +++ W TG   PPE
Sbjct: 68  RLVYQSRKRGTLETDLLLSTFAQENLAKMSVPELKEFDKLLDEPDWDIYYWCTGKRTPPE 127

Query: 71  -YLRTPIFKKIYDYYSN 86
            + ++ + +K+  +  N
Sbjct: 128 RWAKSELLEKLRVHAQN 144


>gi|294651602|ref|ZP_06728907.1| conserved hypothetical protein [Acinetobacter haemolyticus ATCC
          19194]
 gi|292822511|gb|EFF81409.1| conserved hypothetical protein [Acinetobacter haemolyticus ATCC
          19194]
          Length = 85

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 40/69 (57%), Gaps = 1/69 (1%)

Query: 1  MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
          M + + L+ RK++YR  RRG +E+D+    +V +  L   + E  +   +++++D +L  
Sbjct: 1  MSEELTLEERKVIYRA-RRGLKEIDVYFDPYVKNCYLTADAAEKALFAELVDQEDPDLLD 59

Query: 61 WFTGMEKPP 69
          WF  + +PP
Sbjct: 60 WFMEVGEPP 68


>gi|326387813|ref|ZP_08209419.1| hypothetical protein Y88_0727 [Novosphingobium nitrogenifigens
          DSM 19370]
 gi|326207859|gb|EGD58670.1| hypothetical protein Y88_0727 [Novosphingobium nitrogenifigens
          DSM 19370]
          Length = 88

 Score = 48.9 bits (115), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 35/73 (47%)

Query: 8  QCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEK 67
          + R++ +R W RGTRE D ++G F D    E     +   E +++EDD ++  W  G   
Sbjct: 6  RLRRLKFRAWHRGTREADYMIGCFFDRHHTEWDEASIAWYERLMDEDDVDIMGWALGTIP 65

Query: 68 PPEYLRTPIFKKI 80
           P     P+   +
Sbjct: 66 IPADYAGPMMDAM 78


>gi|226953903|ref|ZP_03824367.1| conserved hypothetical protein [Acinetobacter sp. ATCC 27244]
 gi|226835386|gb|EEH67769.1| conserved hypothetical protein [Acinetobacter sp. ATCC 27244]
          Length = 85

 Score = 48.9 bits (115), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 40/69 (57%), Gaps = 1/69 (1%)

Query: 1  MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
          M + + L+ RK++YR  RRG +E+D+    +V +  L   + E  +   +++++D +L  
Sbjct: 1  MSEELTLEERKVIYRA-RRGLKEIDVYFDPYVKNCYLTADATEKALFAELVDQEDPDLLD 59

Query: 61 WFTGMEKPP 69
          WF  + +PP
Sbjct: 60 WFMEVGEPP 68


>gi|254440656|ref|ZP_05054149.1| hypothetical protein OA307_71 [Octadecabacter antarcticus 307]
 gi|198250734|gb|EDY75049.1| hypothetical protein OA307_71 [Octadecabacter antarcticus 307]
          Length = 91

 Score = 48.9 bits (115), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 43/72 (59%), Gaps = 1/72 (1%)

Query: 1  MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
          M + +++  +++  R  RRG +EMDLIL  F    +  L + +L + + ++ E+D +L++
Sbjct: 1  MSEPLDVMRKRLHMRSIRRGIKEMDLILMGFSKAHLAGLDATQLAVYDRLLNENDHDLYQ 60

Query: 61 WFTGM-EKPPEY 71
          W +G  + P EY
Sbjct: 61 WVSGQSDGPTEY 72


>gi|260433145|ref|ZP_05787116.1| TPR repeat family protein [Silicibacter lacuscaerulensis
          ITI-1157]
 gi|260416973|gb|EEX10232.1| TPR repeat family protein [Silicibacter lacuscaerulensis
          ITI-1157]
          Length = 85

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 39/69 (56%)

Query: 1  MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
          M +    + +++  R  RRG +EMD+IL ++ +  +  +    L   ++++ E+D +L++
Sbjct: 1  MTETRETRIKRMKMRSMRRGIKEMDIILQAYAERNLDAMDDAGLDRYDALLHENDQDLYQ 60

Query: 61 WFTGMEKPP 69
          W TG   PP
Sbjct: 61 WVTGQVAPP 69


>gi|254499307|ref|ZP_05111979.1| conserved hypothetical protein [Legionella drancourtii LLAP12]
 gi|254351462|gb|EET10325.1| conserved hypothetical protein [Legionella drancourtii LLAP12]
          Length = 81

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          ++ + C RRG  E+DLIL  F+   + +LS+ EL   +S++   D  LF WF G E+P  
Sbjct: 9  RLTWHC-RRGMLELDLILQRFLKQGLEQLSARELKTFDSLLSCTDPELFAWFMGHEEP-- 65

Query: 71 YLRTPIFKKIYDYYSNN 87
                FK+I     NN
Sbjct: 66 --ENKEFKEIVAIIRNN 80


>gi|209964569|ref|YP_002297484.1| TPR domain protein [Rhodospirillum centenum SW]
 gi|209958035|gb|ACI98671.1| TPR domain protein [Rhodospirillum centenum SW]
          Length = 105

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 16/62 (25%), Positives = 38/62 (61%)

Query: 8  QCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEK 67
          + +++ +R   RGT+E+D++ G+F +  +  +++ EL   E +++  D  ++ W +G  +
Sbjct: 24 RVKRLKFRSGHRGTKELDILFGAFAERHLDGMAAAELDAFERLLDLPDLEVYDWISGAAE 83

Query: 68 PP 69
          PP
Sbjct: 84 PP 85


>gi|86137417|ref|ZP_01055994.1| TPR repeat family protein [Roseobacter sp. MED193]
 gi|85825752|gb|EAQ45950.1| TPR repeat family protein [Roseobacter sp. MED193]
          Length = 89

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 37/60 (61%)

Query: 10 RKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPP 69
          +++  R  RRG +EMD++L ++ D  +  + + +L + + ++ E+D +L++W TG    P
Sbjct: 13 KRLKMRSMRRGIKEMDILLTAYADANLPAMDAAKLDLYDQLLHENDQDLYQWVTGQVATP 72


>gi|91205665|ref|YP_538020.1| TPR repeat-containing protein [Rickettsia bellii RML369-C]
 gi|91069209|gb|ABE04931.1| Tetratricopeptide repeat-containing protein [Rickettsia bellii
          RML369-C]
          Length = 87

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 43/79 (54%)

Query: 2  KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
          K N N   +K+ YR   RG +EMD ILG+F   ++  ++  +L     I++++D++L+ W
Sbjct: 3  KLNKNSLQKKLFYRSKNRGCKEMDYILGNFASLYLPFMAEEKLLSYALILDQNDNDLYNW 62

Query: 62 FTGMEKPPEYLRTPIFKKI 80
           T     P  L   I +++
Sbjct: 63 ITNKSSVPSNLDAEIMEQL 81


>gi|84515361|ref|ZP_01002723.1| TPR repeat family protein [Loktanella vestfoldensis SKA53]
 gi|84510644|gb|EAQ07099.1| TPR repeat family protein [Loktanella vestfoldensis SKA53]
          Length = 94

 Score = 48.1 bits (113), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 36/61 (59%)

Query: 10 RKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPP 69
          +++  R  RRG +EMDLIL +F    + ++   EL + ++++ E+D +L+ W  G    P
Sbjct: 11 KRLHMRSMRRGIKEMDLILPAFAAEHLADMDEAELALYDALLSENDHDLYGWVGGQFAVP 70

Query: 70 E 70
          +
Sbjct: 71 D 71


>gi|126735191|ref|ZP_01750937.1| TPR repeat family protein [Roseobacter sp. CCS2]
 gi|126715746|gb|EBA12611.1| TPR repeat family protein [Roseobacter sp. CCS2]
          Length = 90

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 40/73 (54%), Gaps = 1/73 (1%)

Query: 1  MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
          M +  +   +++  R  RRG +EMDLIL +F D  +   S  +L + + ++ E+D +++ 
Sbjct: 1  MTERRDTMIKRLRMRSMRRGIKEMDLILQAFADAHLDAFSDEDLVLYDQLLSENDHDIYG 60

Query: 61 WFTGM-EKPPEYL 72
          W  G    P +YL
Sbjct: 61 WVGGQFPTPAQYL 73


>gi|254488001|ref|ZP_05101206.1| TPR repeat family protein [Roseobacter sp. GAI101]
 gi|214044870|gb|EEB85508.1| TPR repeat family protein [Roseobacter sp. GAI101]
          Length = 88

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 38/63 (60%)

Query: 8  QCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEK 67
          + +++  R  RRG +EMDLIL S+    +  +    L++ + ++ E+D +L++W TG + 
Sbjct: 8  KVKRLHMRSMRRGIKEMDLILPSYAATCLAVMDDAALSLYDLMLSENDHDLYQWVTGQKS 67

Query: 68 PPE 70
           P+
Sbjct: 68 APD 70


>gi|303273306|ref|XP_003056014.1| predicted protein [Micromonas pusilla CCMP1545]
 gi|226462098|gb|EEH59390.1| predicted protein [Micromonas pusilla CCMP1545]
          Length = 174

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 36/62 (58%)

Query: 11  KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
           +++YR  +RG  E+D+++G +    ++  S   +     +++E++  LFKW TG E PP 
Sbjct: 67  RLLYRAKQRGFLELDILVGKWAQRHLINRSEEFMASFSEVLDEENPELFKWLTGQEYPPS 126

Query: 71  YL 72
            L
Sbjct: 127 RL 128


>gi|190573780|ref|YP_001971625.1| putative TPR repeat-containing protein [Stenotrophomonas
          maltophilia K279a]
 gi|254521879|ref|ZP_05133934.1| conserved hypothetical protein [Stenotrophomonas sp. SKA14]
 gi|190011702|emb|CAQ45321.1| putative TPR repeat protein [Stenotrophomonas maltophilia K279a]
 gi|219719470|gb|EED37995.1| conserved hypothetical protein [Stenotrophomonas sp. SKA14]
          Length = 82

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 10 RKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPP 69
          +K+ +RC RRG RE+D + G ++DH      + E  +   +++ +D  L++WF G E  P
Sbjct: 8  KKLRWRC-RRGMRELDQLFGRYLDHEWSTAPTEEREVFLFLLDCEDDKLWRWFMGYEACP 66

Query: 70 EYLRTPIFKKI 80
               P+ +KI
Sbjct: 67 HAHAIPLMQKI 77


>gi|85373851|ref|YP_457913.1| hypothetical protein ELI_05120 [Erythrobacter litoralis HTCC2594]
 gi|84786934|gb|ABC63116.1| hypothetical protein ELI_05120 [Erythrobacter litoralis HTCC2594]
          Length = 89

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 35/70 (50%)

Query: 3  KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
           +   +  +  +R W RGTRE D ++G F D +       +L   E +++EDD ++  W 
Sbjct: 2  SDFTTRLARAKFRGWHRGTREADYMIGGFFDRYSDGWGEEDLAWFEMLLDEDDVDIMAWA 61

Query: 63 TGMEKPPEYL 72
           G    PE++
Sbjct: 62 LGTLPIPEHV 71


>gi|308048441|ref|YP_003912007.1| hypothetical protein Fbal_0722 [Ferrimonas balearica DSM 9799]
 gi|307630631|gb|ADN74933.1| protein of unknown function DUF339 [Ferrimonas balearica DSM
          9799]
          Length = 89

 Score = 47.8 bits (112), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 36/61 (59%), Gaps = 1/61 (1%)

Query: 10 RKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPP 69
          +++ + C RRG  E+D++L  FV+   L LS  +    E +++EDD +LF WF G    P
Sbjct: 14 KRLKWAC-RRGMLELDVLLEPFVERHFLGLSPAQQQAFERLLKEDDPDLFAWFMGHAPCP 72

Query: 70 E 70
          +
Sbjct: 73 D 73


>gi|296116130|ref|ZP_06834748.1| hypothetical protein GXY_10049 [Gluconacetobacter hansenii ATCC
          23769]
 gi|295977236|gb|EFG83996.1| hypothetical protein GXY_10049 [Gluconacetobacter hansenii ATCC
          23769]
          Length = 103

 Score = 47.4 bits (111), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 35/62 (56%)

Query: 19 RGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPEYLRTPIFK 78
          RGT E D+++G FV   +  +S  EL  LE +++  D++L  W +G    P  + TP+ +
Sbjct: 25 RGTHETDVLIGGFVAPRLEGMSEAELDALEEVMDLPDADLADWLSGRRPIPAEVDTPMMR 84

Query: 79 KI 80
           I
Sbjct: 85 AI 86


>gi|329850835|ref|ZP_08265680.1| pyridoxine 5'-phosphate synthase [Asticcacaulis biprosthecum C19]
 gi|328841150|gb|EGF90721.1| pyridoxine 5'-phosphate synthase [Asticcacaulis biprosthecum C19]
          Length = 341

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 23/75 (30%), Positives = 38/75 (50%)

Query: 13  VYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPEYL 72
           +YR   RG REMD+I+ SF    +  L   +L M E I+E  D +L++      +P + L
Sbjct: 262 LYRANYRGFREMDIIMSSFAQAVVPALVDPDLFMFEHILEMPDHDLYERIRSTNEPEQGL 321

Query: 73  RTPIFKKIYDYYSNN 87
              +   + D+Y  +
Sbjct: 322 HIELLTNLRDHYKQS 336


>gi|190571426|ref|YP_001975784.1| hypothetical protein WPa_1039 [Wolbachia endosymbiont of Culex
          quinquefasciatus Pel]
 gi|190357698|emb|CAQ55147.1| Hypothetical protein WP1039 [Wolbachia endosymbiont of Culex
          quinquefasciatus Pel]
          Length = 90

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 43/80 (53%)

Query: 4  NMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFT 63
          +++L  RK++YR W RG +E D++LG F   ++ + S  EL   E I++ DD  L+ + T
Sbjct: 5  DISLLRRKLMYRSWHRGCKETDILLGHFALKYLDKFSLSELIEYEKIVDLDDCELYCYIT 64

Query: 64 GMEKPPEYLRTPIFKKIYDY 83
               P  L + +   I  +
Sbjct: 65 RKRLLPPDLSSEVVDLIASF 84


>gi|255070871|ref|XP_002507517.1| hypothetical protein MICPUN_113604 [Micromonas sp. RCC299]
 gi|226522792|gb|ACO68775.1| hypothetical protein MICPUN_113604 [Micromonas sp. RCC299]
          Length = 157

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 46/82 (56%), Gaps = 1/82 (1%)

Query: 11  KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
           K++YR  +RG  E+D+++G++ +  +   S         I++E++  LF+W T  E+PP 
Sbjct: 55  KLIYRAKQRGFLELDILIGTWAECNLSSRSQGFWAEFSEILDEENPELFRWLTCQEQPPP 114

Query: 71  YL-RTPIFKKIYDYYSNNLDRK 91
            + R   F  ++ Y S+ + RK
Sbjct: 115 RMTRNRAFISLHAYTSSLMRRK 136


>gi|285018592|ref|YP_003376303.1| hypothetical protein XALc_1822 [Xanthomonas albilineans GPE PC73]
 gi|283473810|emb|CBA16312.1| conserved hypothetical protein [Xanthomonas albilineans]
          Length = 82

 Score = 47.0 bits (110), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 10 RKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPP 69
          +K+ +RC RRG RE+D + G ++D    +  +VE  +  S+++ +D  L++WF G E  P
Sbjct: 8  KKLRWRC-RRGMRELDQLFGRYLDQRWAQAPTVERGVFLSLLDCEDDKLWRWFMGYEVCP 66

Query: 70 EYLRTPIFKKI 80
          +     +   I
Sbjct: 67 DARAADLIATI 77


>gi|157826878|ref|YP_001495942.1| TPR repeat-containing protein [Rickettsia bellii OSU 85-389]
 gi|157802182|gb|ABV78905.1| Tetratricopeptide repeat-containing protein [Rickettsia bellii
          OSU 85-389]
          Length = 87

 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 42/79 (53%)

Query: 2  KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
          K N N   +K+ YR   RG +EMD ILG+F   ++  ++  +L     I+ ++D++L+ W
Sbjct: 3  KLNKNSLQKKLFYRSKNRGCKEMDYILGNFASLYLPFMAEEKLLSYALILYQNDNDLYNW 62

Query: 62 FTGMEKPPEYLRTPIFKKI 80
           T     P  L   I +++
Sbjct: 63 ITNKSSVPSNLDAEIMEQL 81


>gi|78047802|ref|YP_363977.1| hypothetical protein XCV2246 [Xanthomonas campestris pv.
          vesicatoria str. 85-10]
 gi|325928372|ref|ZP_08189567.1| hypothetical protein XPE_3623 [Xanthomonas perforans 91-118]
 gi|78036232|emb|CAJ23923.1| conserved hypothetical protein [Xanthomonas campestris pv.
          vesicatoria str. 85-10]
 gi|325541248|gb|EGD12795.1| hypothetical protein XPE_3623 [Xanthomonas perforans 91-118]
          Length = 82

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 37/71 (52%), Gaps = 1/71 (1%)

Query: 10 RKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPP 69
          +K+ +RC RRG RE+D + G ++D    +    E  +   +++ +D  L++WF G E  P
Sbjct: 8  KKLRWRC-RRGMRELDQLFGRYLDQRWAQAPDAERAVFLQLLDCEDDKLWRWFMGYEACP 66

Query: 70 EYLRTPIFKKI 80
          +     +   I
Sbjct: 67 DAANAALIADI 77


>gi|78486366|ref|YP_392291.1| TPR repeat-containing protein [Thiomicrospira crunogena XCL-2]
 gi|78364652|gb|ABB42617.1| TPR repeat family protein [Thiomicrospira crunogena XCL-2]
          Length = 87

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 39/73 (53%), Gaps = 1/73 (1%)

Query: 4  NMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFT 63
          +++ Q + I   C RRG  E +L+L +++DH   +     L  L +++ E+D +LF W  
Sbjct: 5  DLSTQIKAIRLNC-RRGNSETELLLQAYIDHLAEKSDPEALHELSTLVAENDQDLFHWLM 63

Query: 64 GMEKPPEYLRTPI 76
               P+Y +T I
Sbjct: 64 TPTDAPQYYQTLI 76


>gi|84623841|ref|YP_451213.1| hypothetical protein XOO_2184 [Xanthomonas oryzae pv. oryzae MAFF
          311018]
 gi|188576496|ref|YP_001913425.1| TPR repeat region superfamily [Xanthomonas oryzae pv. oryzae
          PXO99A]
 gi|84367781|dbj|BAE68939.1| conserved hypothetical protein [Xanthomonas oryzae pv. oryzae
          MAFF 311018]
 gi|188520948|gb|ACD58893.1| TPR repeat region superfamily [Xanthomonas oryzae pv. oryzae
          PXO99A]
          Length = 82

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 37/71 (52%), Gaps = 1/71 (1%)

Query: 10 RKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPP 69
          +K+ +RC RRG RE+D + G ++D    +    E  +   +++ +D  L++WF G E  P
Sbjct: 8  KKLRWRC-RRGMRELDQLFGRYLDQRWAQAPDAERAVFLQLLDCEDDKLWRWFMGYEACP 66

Query: 70 EYLRTPIFKKI 80
          +     +   I
Sbjct: 67 DVANAALIADI 77


>gi|325917576|ref|ZP_08179776.1| hypothetical protein XVE_3784 [Xanthomonas vesicatoria ATCC
          35937]
 gi|325536210|gb|EGD08006.1| hypothetical protein XVE_3784 [Xanthomonas vesicatoria ATCC
          35937]
          Length = 98

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 37/71 (52%), Gaps = 1/71 (1%)

Query: 10 RKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPP 69
          +K+ +RC RRG RE+D + G F+D      S  E  +   +++ +D  L++WF G E  P
Sbjct: 24 KKLRWRC-RRGMRELDQLFGRFLDQRWAHASEGERAVFLQLLDCEDDKLWRWFMGYEACP 82

Query: 70 EYLRTPIFKKI 80
          +     +   I
Sbjct: 83 DVANAALIADI 93


>gi|324519048|gb|ADY47274.1| Succinate dehydrogenase assembly factor 2 [Ascaris suum]
          Length = 145

 Score = 46.2 bits (108), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 48/76 (63%), Gaps = 3/76 (3%)

Query: 11  KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEED--DSNLFKWFTGMEKP 68
           +++Y+  +RG  E D+I+G F    + ++S  EL   +SII  D  + +LF + +G ++P
Sbjct: 61  RLLYQSKKRGILENDIIIGGFAQEALADMSREELLEYDSIINGDHMEWDLFYFMSGKKEP 120

Query: 69  PEYLR-TPIFKKIYDY 83
           P+ L+ + IF++I +Y
Sbjct: 121 PKELQESAIFRRIQEY 136


>gi|85707127|ref|ZP_01038215.1| TPR repeat family protein [Roseovarius sp. 217]
 gi|85668413|gb|EAQ23286.1| TPR repeat family protein [Roseovarius sp. 217]
          Length = 98

 Score = 46.2 bits (108), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 39/78 (50%), Gaps = 1/78 (1%)

Query: 10 RKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPP 69
          +++  R  RRG +EMD+IL  + +  +  +    L   ++++ E+D +L++W TG   PP
Sbjct: 21 KRLHMRAMRRGIKEMDIILSRYAEARLEAMEDSALDGFDALLCENDQDLYQWVTGQTPPP 80

Query: 70 EYLRTPIFKKIYDYYSNN 87
               P+   I    S  
Sbjct: 81 ARF-APLVADIATQASAT 97


>gi|56696155|ref|YP_166511.1| TPR repeat-containing protein [Ruegeria pomeroyi DSS-3]
 gi|56677892|gb|AAV94558.1| TPR repeat family protein [Ruegeria pomeroyi DSS-3]
          Length = 85

 Score = 46.2 bits (108), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 34/57 (59%)

Query: 20 GTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPEYLRTPI 76
          G +EMDLIL ++ D  I  + +  L + ++++ E+D +L++W TG    P+  R  I
Sbjct: 20 GIKEMDLILSAYADRSIEAMDAGALDLYDALLHENDQDLYQWVTGQVSAPDRYRDLI 76


>gi|83593062|ref|YP_426814.1| hypothetical protein Rru_A1727 [Rhodospirillum rubrum ATCC 11170]
 gi|83575976|gb|ABC22527.1| Protein of unknown function DUF339 [Rhodospirillum rubrum ATCC
          11170]
          Length = 88

 Score = 46.2 bits (108), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 37/67 (55%)

Query: 10 RKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPP 69
          ++ +YR   RG +E D+ +G+F    +  ++  +    E+++EE D+++  W  G  +PP
Sbjct: 11 KRTLYRAQHRGMKEADIFIGAFAVDRLETMTDDQHDRFEALLEEHDADIMDWIMGRAEPP 70

Query: 70 EYLRTPI 76
             RT +
Sbjct: 71 VAYRTDV 77


>gi|58581929|ref|YP_200945.1| hypothetical protein XOO2306 [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|75435398|sp|Q5H0G1|Y2306_XANOR RecName: Full=UPF0350 protein XOO2306
 gi|58426523|gb|AAW75560.1| conserved hypothetical protein [Xanthomonas oryzae pv. oryzae
           KACC10331]
          Length = 107

 Score = 46.2 bits (108), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 41/81 (50%), Gaps = 3/81 (3%)

Query: 2   KKNMNLQCR--KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLF 59
           +  M+ Q R  K+ +RC RRG RE+D + G ++D    +    E  +   +++ +D  L+
Sbjct: 23  RDEMDEQTRLKKLRWRC-RRGMRELDQLFGRYLDQRWAQAPDAERAVFLQLLDCEDDKLW 81

Query: 60  KWFTGMEKPPEYLRTPIFKKI 80
           +WF G E  P+     +   I
Sbjct: 82  RWFMGYEACPDVANAALIADI 102


>gi|325193361|emb|CCA27700.1| conserved hypothetical protein [Albugo laibachii Nc14]
          Length = 186

 Score = 46.2 bits (108), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 49/87 (56%), Gaps = 1/87 (1%)

Query: 10  RKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPP 69
           ++++YR  +RG  E+DL+LGS+    +  L   EL   E+I+ ++  +++ + T     P
Sbjct: 90  KRLLYRSRQRGWLEVDLLLGSWTQKSVEGLQEAELDHFEAILNQETIDIYNYITKQRPIP 149

Query: 70  EYLRTPIFKKIYDYYSNN-LDRKNMLG 95
             L T +  ++ +Y +N+ L + +M G
Sbjct: 150 SELDTNVMHRLQEYCANSPLGKASMDG 176


>gi|148554436|ref|YP_001262018.1| hypothetical protein Swit_1517 [Sphingomonas wittichii RW1]
 gi|148499626|gb|ABQ67880.1| protein of unknown function DUF339 [Sphingomonas wittichii RW1]
          Length = 88

 Score = 46.2 bits (108), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/77 (23%), Positives = 38/77 (49%)

Query: 4  NMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFT 63
          N + + +++ +R W RGTRE D ++G F D          L   E ++ ++D+++  W  
Sbjct: 2  NHDDRLKRLRFRAWHRGTREADYMIGGFFDRLHQGWDGEALDWFEGLLAQEDADILGWVM 61

Query: 64 GMEKPPEYLRTPIFKKI 80
          G    P   +  + +++
Sbjct: 62 GTIPVPAEWQGALMERM 78


>gi|323507544|emb|CBQ67415.1| related to EMI5-protein required for transcriptional induction of
           TF IME1 [Sporisorium reilianum]
          Length = 235

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 37/65 (56%)

Query: 6   NLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGM 65
           N +  ++VY+C +RGT E DL+L +F    +  L   EL   + +++E D ++F W T  
Sbjct: 138 NTKIARLVYQCRKRGTLETDLLLSTFAKKELKNLPDAELDEFDRLLDEPDWDIFYWCTQR 197

Query: 66  EKPPE 70
           +  PE
Sbjct: 198 KPIPE 202


>gi|323447553|gb|EGB03469.1| hypothetical protein AURANDRAFT_16750 [Aureococcus
          anophagefferens]
 gi|323447555|gb|EGB03471.1| hypothetical protein AURANDRAFT_16747 [Aureococcus
          anophagefferens]
          Length = 82

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 43/74 (58%)

Query: 10 RKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPP 69
          ++++YR  +RG  E+DL+LG++    +  L+S E    E I+  +  ++F + TG +  P
Sbjct: 2  KRLIYRSKQRGWLEVDLLLGTWAVENVDGLTSAECDEYEDILNCETIDIFNFITGKDPVP 61

Query: 70 EYLRTPIFKKIYDY 83
            L T + K++ DY
Sbjct: 62 PRLDTAMMKRLQDY 75


>gi|21242818|ref|NP_642400.1| hypothetical protein XAC2079 [Xanthomonas axonopodis pv. citri str.
           306]
 gi|81175073|sp|Q8PKT3|Y2079_XANAC RecName: Full=UPF0350 protein XAC2079
 gi|21108304|gb|AAM36936.1| conserved hypothetical protein [Xanthomonas axonopodis pv. citri
           str. 306]
          Length = 109

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 37/71 (52%), Gaps = 1/71 (1%)

Query: 10  RKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPP 69
           +K+ +RC RRG RE+D + G ++D    +    E  +   +++ +D  L++WF G E  P
Sbjct: 35  KKLRWRC-RRGMRELDQLFGRYLDQRWAQAPDAERAVFLQLLDCEDDKLWRWFMGYEACP 93

Query: 70  EYLRTPIFKKI 80
           +     +   I
Sbjct: 94  DAANAALIADI 104


>gi|21231572|ref|NP_637489.1| hypothetical protein XCC2128 [Xanthomonas campestris pv.
          campestris str. ATCC 33913]
 gi|66768307|ref|YP_243069.1| hypothetical protein XC_1986 [Xanthomonas campestris pv.
          campestris str. 8004]
 gi|188991446|ref|YP_001903456.1| hypothetical protein xccb100_2051 [Xanthomonas campestris pv.
          campestris str. B100]
 gi|81175071|sp|Q4UV74|Y1986_XANC8 RecName: Full=UPF0350 protein XC_1986
 gi|81175074|sp|Q8P8V6|Y2128_XANCP RecName: Full=UPF0350 protein XCC2128
 gi|21113258|gb|AAM41413.1| conserved hypothetical protein [Xanthomonas campestris pv.
          campestris str. ATCC 33913]
 gi|66573639|gb|AAY49049.1| conserved hypothetical protein [Xanthomonas campestris pv.
          campestris str. 8004]
 gi|167733206|emb|CAP51404.1| Conserved hypothetical protein [Xanthomonas campestris pv.
          campestris]
          Length = 86

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 38/71 (53%), Gaps = 1/71 (1%)

Query: 10 RKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPP 69
          +K+ +RC RRG RE+D + G ++D    +  + E  +   +++ +D  L++WF G E  P
Sbjct: 12 KKLRWRC-RRGMRELDQLFGRYLDRRWAQAPAAERAVFLQLLDCEDDKLWRWFMGYEACP 70

Query: 70 EYLRTPIFKKI 80
          +     +   I
Sbjct: 71 DADNAALIADI 81


>gi|332008643|gb|AED96026.1| uncharacterized protein [Arabidopsis thaliana]
          Length = 197

 Score = 45.4 bits (106), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 56/90 (62%), Gaps = 10/90 (11%)

Query: 11  KIVYRCWRRGTREMDLILGSFVDHFI--LELSSVE-----LTMLESIIEE--DDSNLFKW 61
           +++YR  +RG  E+DL+LG++V+  +  ++ + V+     L ++ES   +  ++ +L+KW
Sbjct: 75  RLLYRSKQRGFLELDLVLGNWVEENVNSMDENGVKSLIHVLNLVESEATKLLENPDLWKW 134

Query: 62  FTGMEKPPEYLRT-PIFKKIYDYYSNNLDR 90
            T  E+PPE + + P+F  +++    NL++
Sbjct: 135 LTEQEQPPEAVSSNPVFSALHEKVMKNLNK 164


>gi|238593559|ref|XP_002393230.1| hypothetical protein MPER_07073 [Moniliophthora perniciosa FA553]
 gi|215460401|gb|EEB94160.1| hypothetical protein MPER_07073 [Moniliophthora perniciosa FA553]
          Length = 147

 Score = 45.4 bits (106), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 36/60 (60%)

Query: 11  KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
           ++VY+  +RGT E DL++ +F    + ++S  EL   +  ++E D +++ W TG   PPE
Sbjct: 60  RLVYQSRKRGTLESDLLMSTFARDHLGKMSEEELREYDRFLDEPDWDIYYWATGKRTPPE 119


>gi|289669023|ref|ZP_06490098.1| hypothetical protein XcampmN_11137 [Xanthomonas campestris pv.
          musacearum NCPPB4381]
          Length = 82

 Score = 45.4 bits (106), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 36/71 (50%), Gaps = 1/71 (1%)

Query: 10 RKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPP 69
          +K+ +RC RRG RE+D + G ++D         E  +   +++ +D  L++WF G E  P
Sbjct: 8  KKLRWRC-RRGMRELDQLFGRYLDQRWARAPEAERAVFLQLLDCEDDKLWRWFMGYEACP 66

Query: 70 EYLRTPIFKKI 80
          +     +   I
Sbjct: 67 DAANAALIADI 77


>gi|289665887|ref|ZP_06487468.1| hypothetical protein XcampvN_23122 [Xanthomonas campestris pv.
          vasculorum NCPPB702]
          Length = 101

 Score = 45.4 bits (106), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 36/71 (50%), Gaps = 1/71 (1%)

Query: 10 RKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPP 69
          +K+ +RC RRG RE+D + G ++D         E  +   +++ +D  L++WF G E  P
Sbjct: 27 KKLRWRC-RRGMRELDQLFGRYLDQRWARAPEAERAVFLQLLDCEDDKLWRWFMGYEACP 85

Query: 70 EYLRTPIFKKI 80
          +     +   I
Sbjct: 86 DAANAALIADI 96


>gi|90021899|ref|YP_527726.1| response regulator receiver domain-containing protein
          [Saccharophagus degradans 2-40]
 gi|89951499|gb|ABD81514.1| protein of unknown function DUF339 [Saccharophagus degradans
          2-40]
          Length = 81

 Score = 45.4 bits (106), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 36/70 (51%), Gaps = 4/70 (5%)

Query: 18 RRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPEYLRTPIF 77
          RRG  E+DL+L  F+D+    L + +  +   ++EE D +LF+WF    +P      P  
Sbjct: 11 RRGMLELDLVLNPFLDNVYSTLGADDQALFHKLLEEQDQDLFQWFMRKSEP----EAPDL 66

Query: 78 KKIYDYYSNN 87
          K+I     NN
Sbjct: 67 KRIVSIILNN 76


>gi|307104767|gb|EFN53019.1| hypothetical protein CHLNCDRAFT_137510 [Chlorella variabilis]
          Length = 141

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 40/63 (63%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          +++YR  +RG  E+DL++G + +  + ++S  ++   E ++ +++ ++FKW T   + PE
Sbjct: 14 RLLYRSRQRGFLELDLLVGMWAEKELPQMSVEQMREFEVVLGQENPDMFKWLTAQAEAPE 73

Query: 71 YLR 73
           LR
Sbjct: 74 ELR 76


>gi|302675735|ref|XP_003027551.1| hypothetical protein SCHCODRAFT_40518 [Schizophyllum commune
          H4-8]
 gi|300101238|gb|EFI92648.1| hypothetical protein SCHCODRAFT_40518 [Schizophyllum commune
          H4-8]
          Length = 103

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 44/77 (57%), Gaps = 1/77 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          ++VY+  +RGT E DL+L +F    +  ++  E+   + +++E D +++ W TG   PPE
Sbjct: 16 RLVYQSRKRGTLESDLLLSTFARDNLSTMTEDEMREYDKLLDEPDWDIYYWATGKRTPPE 75

Query: 71 -YLRTPIFKKIYDYYSN 86
           +  + + KK+  +  N
Sbjct: 76 RWQESQLLKKLAVHAKN 92


>gi|54294378|ref|YP_126793.1| hypothetical protein lpl1447 [Legionella pneumophila str. Lens]
 gi|296107163|ref|YP_003618863.1| hypothetical protein lpa_02293 [Legionella pneumophila 2300/99
          Alcoy]
 gi|81175064|sp|Q5WWK6|Y1447_LEGPL RecName: Full=UPF0350 protein lpl1447
 gi|53754210|emb|CAH15687.1| hypothetical protein lpl1447 [Legionella pneumophila str. Lens]
 gi|295649064|gb|ADG24911.1| hypothetical protein lpa_02293 [Legionella pneumophila 2300/99
          Alcoy]
          Length = 79

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 39/62 (62%), Gaps = 1/62 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          +++++C RRG  E+DL+L  F+ + I  L+  +L   ++++  +D NL+ W  G E+P +
Sbjct: 8  RLLWKC-RRGMLELDLVLQKFIANEIDRLTENQLKAFDNLLTHNDPNLYAWLMGHEEPEK 66

Query: 71 YL 72
           L
Sbjct: 67 EL 68


>gi|330799426|ref|XP_003287746.1| hypothetical protein DICPUDRAFT_32960 [Dictyostelium purpureum]
 gi|325082255|gb|EGC35743.1| hypothetical protein DICPUDRAFT_32960 [Dictyostelium purpureum]
          Length = 134

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 42/78 (53%)

Query: 10  RKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPP 69
           +K++Y+   RG  E DL+LGSF  + I +L+  +L   + ++++ D ++F W       P
Sbjct: 50  KKLLYQSKERGMLENDLLLGSFATNNIQKLTEQQLKDYDLLLQQPDPDIFNWILNKTVIP 109

Query: 70  EYLRTPIFKKIYDYYSNN 87
           +   T + K I  +  N+
Sbjct: 110 DEFETEVLKMIQHHCQND 127


>gi|296283912|ref|ZP_06861910.1| hypothetical protein CbatJ_09826 [Citromicrobium bathyomarinum
          JL354]
          Length = 91

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 31/58 (53%), Gaps = 1/58 (1%)

Query: 14 YRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEK-PPE 70
          +R W RGTRE D ++G + D +  E    +L   E++++ DD  +  W    +  PPE
Sbjct: 15 FRAWHRGTREADYMIGGYFDRYHAEWGEEDLVWFETLLDYDDVEIMAWALKTQPIPPE 72


>gi|328874720|gb|EGG23085.1| DUF339 family protein [Dictyostelium fasciculatum]
          Length = 145

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 40/78 (51%)

Query: 10  RKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPP 69
           +K++Y+   RG  E DL+LG+F    +   +  +L   + II++ D +++ W    +  P
Sbjct: 60  KKLLYQSKERGMLENDLLLGTFATKHLHSFTDAQLKKYDIIIQQPDPDIYNWVLSKDIVP 119

Query: 70  EYLRTPIFKKIYDYYSNN 87
           E L   + K +  +  NN
Sbjct: 120 EELDNDVMKLLQHHCQNN 137


>gi|325920383|ref|ZP_08182314.1| hypothetical protein XGA_1262 [Xanthomonas gardneri ATCC 19865]
 gi|325549130|gb|EGD20053.1| hypothetical protein XGA_1262 [Xanthomonas gardneri ATCC 19865]
          Length = 115

 Score = 45.1 bits (105), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 38/71 (53%), Gaps = 1/71 (1%)

Query: 10  RKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPP 69
           +K+ +RC RRG RE+D + G ++D    + S  E  +   +++ +D  L++WF G E  P
Sbjct: 41  KKLRWRC-RRGMRELDQLFGRYLDQRWAQASEPERAVFLQLLDCEDDKLWRWFMGYEACP 99

Query: 70  EYLRTPIFKKI 80
           +     +   I
Sbjct: 100 DADNAALIADI 110


>gi|149914340|ref|ZP_01902871.1| TPR repeat family protein [Roseobacter sp. AzwK-3b]
 gi|149811859|gb|EDM71692.1| TPR repeat family protein [Roseobacter sp. AzwK-3b]
          Length = 88

 Score = 44.7 bits (104), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 40/68 (58%)

Query: 2  KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
          +++ + + R++  R  RRG +EMD+IL  + +  +  L   +L + + ++ E+D +L++W
Sbjct: 3  EEDRDTRLRRLHMRSIRRGIKEMDIILTRYSEARLAALGPDQLDLYDRLLWENDQDLYQW 62

Query: 62 FTGMEKPP 69
           TG    P
Sbjct: 63 VTGQVAAP 70


>gi|148359115|ref|YP_001250322.1| hypothetical protein LPC_1003 [Legionella pneumophila str. Corby]
 gi|148280888|gb|ABQ54976.1| hypothetical protein LPC_1003 [Legionella pneumophila str. Corby]
          Length = 79

 Score = 44.7 bits (104), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 39/62 (62%), Gaps = 1/62 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          +++++C RRG  E+DL+L  F+ + I  L+  +L   ++++  +D NL+ W  G E+P +
Sbjct: 8  RLLWKC-RRGMLELDLLLQKFIANEIDRLTENQLKAFDNLLTHNDPNLYAWLMGHEEPEK 66

Query: 71 YL 72
           L
Sbjct: 67 EL 68


>gi|221487116|gb|EEE25362.1| conserved hypothetical protein [Toxoplasma gondii GT1]
          Length = 215

 Score = 44.7 bits (104), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 47/91 (51%), Gaps = 5/91 (5%)

Query: 10  RKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGME--- 66
           ++++YR  +RG  E+DL+LG++ D  +  +S+ E+  LE I+  ++  LF    G +   
Sbjct: 113 KRLMYRAKQRGWVELDLLLGAYCDENVPSMSTEEVEELEKILAAENVVLFDCLVGKDWKR 172

Query: 67  --KPPEYLRTPIFKKIYDYYSNNLDRKNMLG 95
              PPE+     ++K+  +    L   +  G
Sbjct: 173 APAPPEFGHLSQWRKLSAFVEARLPPPHSAG 203


>gi|328769818|gb|EGF79861.1| hypothetical protein BATDEDRAFT_6694 [Batrachochytrium
          dendrobatidis JAM81]
          Length = 101

 Score = 44.7 bits (104), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 19/77 (24%), Positives = 46/77 (59%), Gaps = 1/77 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          ++V++  +RG  E DL+L +++   +  +   +L   +S+++E+D +++ W TG ++ PE
Sbjct: 14 RLVWQSRKRGILETDLLLSTYIQQALPTMEDAQLQEYDSLLDENDWDIYYWCTGAKEAPE 73

Query: 71 YLRT-PIFKKIYDYYSN 86
           ++   IF  + ++  N
Sbjct: 74 RIKDMSIFDGLVEHCKN 90


>gi|294139700|ref|YP_003555678.1| hypothetical protein SVI_0929 [Shewanella violacea DSS12]
 gi|293326169|dbj|BAJ00900.1| conserved hypothetical protein [Shewanella violacea DSS12]
          Length = 83

 Score = 44.7 bits (104), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 37/64 (57%), Gaps = 1/64 (1%)

Query: 7  LQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGME 66
          ++  ++ + C RRG  E+D+I   FVD +  +LS     +L  ++E +D  LF WF G E
Sbjct: 5  MKISRVRWAC-RRGMLELDVIFQPFVDRYYEQLSVKNKAILVRLLEGEDPELFAWFMGHE 63

Query: 67 KPPE 70
          + P+
Sbjct: 64 QCPD 67


>gi|237831473|ref|XP_002365034.1| hypothetical protein TGME49_058100 [Toxoplasma gondii ME49]
 gi|211962698|gb|EEA97893.1| hypothetical protein TGME49_058100 [Toxoplasma gondii ME49]
          Length = 144

 Score = 44.7 bits (104), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 47/91 (51%), Gaps = 5/91 (5%)

Query: 10  RKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGME--- 66
           ++++YR  +RG  E+DL+LG++ D  +  +S+ E+  LE I+  ++  LF    G +   
Sbjct: 42  KRLMYRAKQRGWVELDLLLGAYCDENVPSMSTEEVEELEKILAAENVVLFDCLVGKDWKR 101

Query: 67  --KPPEYLRTPIFKKIYDYYSNNLDRKNMLG 95
              PPE+     ++K+  +    L   +  G
Sbjct: 102 APAPPEFGHLSQWRKLSAFVEARLPPPHSAG 132


>gi|194365317|ref|YP_002027927.1| hypothetical protein Smal_1539 [Stenotrophomonas maltophilia
          R551-3]
 gi|194348121|gb|ACF51244.1| protein of unknown function DUF339 [Stenotrophomonas maltophilia
          R551-3]
          Length = 82

 Score = 44.7 bits (104), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 10 RKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPP 69
          +K+ +RC RRG RE+D + G ++D       + E  +   +++ +D  L++WF G E  P
Sbjct: 8  KKLRWRC-RRGMRELDQLFGRYLDREWSTAPTEEREVFLFLLDCEDDKLWRWFMGYEACP 66

Query: 70 EYLRTPIFKKI 80
               P+ +KI
Sbjct: 67 HAHAIPLMQKI 77


>gi|167999718|ref|XP_001752564.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162696464|gb|EDQ82803.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 134

 Score = 44.7 bits (104), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 42/81 (51%), Gaps = 2/81 (2%)

Query: 9   CRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKP 68
           CR I+YR  +RG  E+DL+LG + +  I  L    L  L  ++E ++ +L+ W TG  + 
Sbjct: 21  CR-ILYRSRQRGYLELDLLLGKWAEDNINNLDENRLQELVDLLEGENPDLWNWLTGQAEV 79

Query: 69  PEYL-RTPIFKKIYDYYSNNL 88
           P  L    +F  I    + NL
Sbjct: 80  PAALAENSVFAAIKGQIAENL 100


>gi|255262313|ref|ZP_05341655.1| TPR repeat family protein [Thalassiobium sp. R2A62]
 gi|255104648|gb|EET47322.1| TPR repeat family protein [Thalassiobium sp. R2A62]
          Length = 84

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 40/73 (54%), Gaps = 2/73 (2%)

Query: 1  MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
          M ++   + +++  R  RRG +EMDLIL  +       +S  ++   E +++E D +L+ 
Sbjct: 1  MTEDRETRIKRLKMRSMRRGIKEMDLILSQYSARLD-AMSDAQIDHYEILLDESDHDLYA 59

Query: 61 WFTG-MEKPPEYL 72
          W +G  E P EYL
Sbjct: 60 WVSGAAETPLEYL 72


>gi|148285179|ref|YP_001249269.1| hypothetical protein OTBS_2179 [Orientia tsutsugamushi str.
          Boryong]
 gi|146740618|emb|CAM81274.1| hypothetical protein OTBS_2179 [Orientia tsutsugamushi str.
          Boryong]
          Length = 87

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 37/63 (58%)

Query: 10 RKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPP 69
          ++++YR   RG +E DL+L  F+   +  LS  EL     I++ DD ++++W T  +  P
Sbjct: 11 KRLIYRATYRGCKESDLLLSQFLSKHLEFLSDKELLDFALILDCDDKDIYEWTTNKKPSP 70

Query: 70 EYL 72
          ++L
Sbjct: 71 KHL 73


>gi|84501610|ref|ZP_00999782.1| hypothetical protein OB2597_15450 [Oceanicola batsensis HTCC2597]
 gi|84390231|gb|EAQ02790.1| hypothetical protein OB2597_15450 [Oceanicola batsensis HTCC2597]
          Length = 94

 Score = 43.9 bits (102), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 36/66 (54%), Gaps = 1/66 (1%)

Query: 22 REMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPEYLRTPIFKKIY 81
          +EMD++L  F +  +  LS  EL + + I+  +D +L++W TG  +PP  L   +  +I 
Sbjct: 23 KEMDILLMRFAEAHLAALSDPELDIYDEILGRNDQDLYRWITGQAEPPAPLAQ-VIARIA 81

Query: 82 DYYSNN 87
              N+
Sbjct: 82 AAAEND 87


>gi|66799941|ref|XP_628896.1| DUF339 family protein [Dictyostelium discoideum AX4]
 gi|74850425|sp|Q54B20|SDHF2_DICDI RecName: Full=Succinate dehydrogenase assembly factor 2,
           mitochondrial; Short=SDH assembly factor 2; AltName:
           Full=Succinate dehydrogenase subunit 5, mitochondrial;
           Flags: Precursor
 gi|60462245|gb|EAL60472.1| DUF339 family protein [Dictyostelium discoideum AX4]
          Length = 141

 Score = 43.9 bits (102), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 41/78 (52%)

Query: 10  RKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPP 69
           +K++Y+   RG  E DL+LGSF    I +L+  +L     ++++ D ++F W     + P
Sbjct: 57  KKLLYQSKERGMLENDLLLGSFATLNIHKLTESQLRDYNLLLQQPDPDIFNWILKKAEVP 116

Query: 70  EYLRTPIFKKIYDYYSNN 87
           E   T + K +  +  N+
Sbjct: 117 EEFETEVLKLVQHHCKND 134


>gi|119476431|ref|ZP_01616782.1| hypothetical protein GP2143_08269 [marine gamma proteobacterium
          HTCC2143]
 gi|119450295|gb|EAW31530.1| hypothetical protein GP2143_08269 [marine gamma proteobacterium
          HTCC2143]
          Length = 84

 Score = 43.9 bits (102), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 30/53 (56%)

Query: 18 RRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          RRG  E+DLILG FV+H    L  +       +++ +DS+LF WF G   P +
Sbjct: 15 RRGMLELDLILGPFVEHCYRGLDDINRQRYIDLLDGEDSDLFSWFLGRGVPED 67


>gi|126725661|ref|ZP_01741503.1| TPR repeat family protein [Rhodobacterales bacterium HTCC2150]
 gi|126704865|gb|EBA03956.1| TPR repeat family protein [Rhodobacterales bacterium HTCC2150]
          Length = 95

 Score = 43.9 bits (102), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 35/53 (66%), Gaps = 1/53 (1%)

Query: 20 GTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTG-MEKPPEY 71
          G +EMD+ILG F D    ++S  ++ + + ++ E+D +L++WF+  + +P +Y
Sbjct: 29 GIKEMDMILGPFSDKGFKDMSEADIDLYDQLLWENDQDLYQWFSNQIARPAKY 81


>gi|257454687|ref|ZP_05619943.1| hypothetical protein ENHAE0001_1297 [Enhydrobacter aerosaccus
          SK60]
 gi|257447997|gb|EEV22984.1| hypothetical protein ENHAE0001_1297 [Enhydrobacter aerosaccus
          SK60]
          Length = 88

 Score = 43.9 bits (102), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 32/57 (56%), Gaps = 1/57 (1%)

Query: 6  NLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
           L+ RK++YR  RRG +E+D     +V    L+  S E  +   +++E+D +L  WF
Sbjct: 9  TLEQRKVIYRA-RRGLKELDYYFDPYVRAHYLQADSQEQQIFAELVKEEDPDLLDWF 64


>gi|164656893|ref|XP_001729573.1| hypothetical protein MGL_3117 [Malassezia globosa CBS 7966]
 gi|159103466|gb|EDP42359.1| hypothetical protein MGL_3117 [Malassezia globosa CBS 7966]
          Length = 184

 Score = 43.5 bits (101), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 35/60 (58%)

Query: 11  KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
           ++ Y+C +RGT E DL+L +F    +  L   EL  L+ +++E D ++F W T  +  PE
Sbjct: 83  RLQYQCRKRGTLETDLLLSTFAHEELRRLPDDELHELDRLLDEPDWDIFYWCTDRKPVPE 142


>gi|296448067|ref|ZP_06889970.1| protein of unknown function DUF339 [Methylosinus trichosporium
          OB3b]
 gi|296254424|gb|EFH01548.1| protein of unknown function DUF339 [Methylosinus trichosporium
          OB3b]
          Length = 97

 Score = 43.5 bits (101), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 27/68 (39%), Positives = 40/68 (58%), Gaps = 1/68 (1%)

Query: 20 GTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPEYLRTPIFKK 79
          G REMDLI+G FVD  I  L    L  LE++++ DD  ++ W      PP Y  TP+F++
Sbjct: 23 GMREMDLIMGGFVDSEIRGLDDAALEALEALLDADDDAVYGWLCAAGAPPAY-DTPLFRR 81

Query: 80 IYDYYSNN 87
          I  +++N 
Sbjct: 82 IAAFHANG 89


>gi|116180004|ref|XP_001219851.1| hypothetical protein CHGG_00630 [Chaetomium globosum CBS 148.51]
 gi|88184927|gb|EAQ92395.1| hypothetical protein CHGG_00630 [Chaetomium globosum CBS 148.51]
          Length = 229

 Score = 43.5 bits (101), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 36/60 (60%)

Query: 11  KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
           ++VY+  +RGT E DL+L +F    +  ++  +L   +  ++E+D +++ W T  E+ PE
Sbjct: 67  RLVYQSRKRGTLESDLLLSTFASARLARMTPAQLAEYDRFLDENDWDIYYWATQQEQKPE 126


>gi|189184481|ref|YP_001938266.1| hypothetical protein OTT_1574 [Orientia tsutsugamushi str. Ikeda]
 gi|189181252|dbj|BAG41032.1| hypothetical protein OTT_1574 [Orientia tsutsugamushi str. Ikeda]
          Length = 102

 Score = 43.5 bits (101), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 36/63 (57%)

Query: 10 RKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPP 69
          ++++YR   RG +E DL+L  F+   +  LS  EL     I++ DD ++++W T     P
Sbjct: 26 KRLIYRATYRGCKESDLLLSKFLSKHLEFLSDKELLDFALILDCDDKDIYEWTTNKNPSP 85

Query: 70 EYL 72
          ++L
Sbjct: 86 KHL 88


>gi|56459927|ref|YP_155208.1| hypothetical protein IL0819 [Idiomarina loihiensis L2TR]
 gi|81175091|sp|Q5R0Z7|Y819_IDILO RecName: Full=UPF0350 protein IL0819
 gi|56178937|gb|AAV81659.1| Uncharacterized conserved protein [Idiomarina loihiensis L2TR]
          Length = 90

 Score = 43.5 bits (101), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 33/58 (56%), Gaps = 1/58 (1%)

Query: 10 RKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEK 67
          R++ + C RRG  E+D++   FVD    ELS  +  +   +I  DD +LF WF G +K
Sbjct: 15 RRLRWAC-RRGMLELDVLFEPFVDQAYDELSEEQKAVFRRLITCDDPDLFAWFMGHQK 71


>gi|126173430|ref|YP_001049579.1| hypothetical protein Sbal_1192 [Shewanella baltica OS155]
 gi|152999769|ref|YP_001365450.1| hypothetical protein Shew185_1236 [Shewanella baltica OS185]
 gi|125996635|gb|ABN60710.1| protein of unknown function DUF339 [Shewanella baltica OS155]
 gi|151364387|gb|ABS07387.1| protein of unknown function DUF339 [Shewanella baltica OS185]
          Length = 79

 Score = 43.5 bits (101), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 36/60 (60%), Gaps = 1/60 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          ++ + C RRG  E+D++   FV++F  E+S  + T+   ++E +D  LF WF G E  P+
Sbjct: 5  RVRWAC-RRGMLELDVLFQPFVENFYQEMSDEDKTVFIRLLECEDPELFAWFMGHEVCPD 63


>gi|160874388|ref|YP_001553704.1| hypothetical protein Sbal195_1269 [Shewanella baltica OS195]
 gi|217974278|ref|YP_002359029.1| hypothetical protein Sbal223_3121 [Shewanella baltica OS223]
 gi|304409354|ref|ZP_07390974.1| protein of unknown function DUF339 [Shewanella baltica OS183]
 gi|307303712|ref|ZP_07583465.1| protein of unknown function DUF339 [Shewanella baltica BA175]
 gi|160859910|gb|ABX48444.1| protein of unknown function DUF339 [Shewanella baltica OS195]
 gi|217499413|gb|ACK47606.1| protein of unknown function DUF339 [Shewanella baltica OS223]
 gi|304351872|gb|EFM16270.1| protein of unknown function DUF339 [Shewanella baltica OS183]
 gi|306912610|gb|EFN43033.1| protein of unknown function DUF339 [Shewanella baltica BA175]
 gi|315266623|gb|ADT93476.1| protein of unknown function DUF339 [Shewanella baltica OS678]
          Length = 82

 Score = 43.1 bits (100), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 36/60 (60%), Gaps = 1/60 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          ++ + C RRG  E+D++   FV++F  E+S  + T+   ++E +D  LF WF G E  P+
Sbjct: 8  RVRWAC-RRGMLELDVLFQPFVENFYQEMSDEDKTVFIRLLECEDPELFAWFMGHEVCPD 66


>gi|58258883|ref|XP_566854.1| mitochondrion protein [Cryptococcus neoformans var. neoformans
           JEC21]
 gi|58258885|ref|XP_566855.1| mitochondrion protein [Cryptococcus neoformans var. neoformans
           JEC21]
 gi|134106877|ref|XP_777980.1| hypothetical protein CNBA4490 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|74687618|sp|Q5KP03|SDHF2_CRYNE RecName: Full=Succinate dehydrogenase assembly factor 2,
           mitochondrial; Short=SDH assembly factor 2; AltName:
           Full=Early meiotic induction protein 5; AltName:
           Full=Succinate dehydrogenase subunit 5, mitochondrial;
           Flags: Precursor
 gi|50260680|gb|EAL23333.1| hypothetical protein CNBA4490 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|57222991|gb|AAW41035.1| mitochondrion protein, putative [Cryptococcus neoformans var.
           neoformans JEC21]
 gi|57222992|gb|AAW41036.1| mitochondrion protein, putative [Cryptococcus neoformans var.
           neoformans JEC21]
          Length = 175

 Score = 43.1 bits (100), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 41/77 (53%), Gaps = 1/77 (1%)

Query: 11  KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
           +++Y+  +RGT E DLIL +F    +  +   E+   + +++E D ++F W      PP 
Sbjct: 81  RLIYQTRKRGTLETDLILSTFARDELPNMDFEEMKQFDKLLDEPDWDIFYWSVKKRDPPA 140

Query: 71  YLR-TPIFKKIYDYYSN 86
             + TP+ +K+  +  N
Sbjct: 141 RWKGTPLLEKLQKHAKN 157


>gi|158300413|ref|XP_320341.4| AGAP012191-PA [Anopheles gambiae str. PEST]
 gi|157013147|gb|EAA00134.4| AGAP012191-PA [Anopheles gambiae str. PEST]
          Length = 145

 Score = 43.1 bits (100), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 48/90 (53%), Gaps = 4/90 (4%)

Query: 2   KKNMNLQCRK--IVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESII--EEDDSN 57
           KKN  LQ +K  ++Y+  +RG  E  L+L +F   ++ E+S  +  + + +I    +D +
Sbjct: 40  KKNEPLQLQKSRLLYQSRKRGMLENGLLLSTFAAKYLAEMSPAQTKLYDQLINLPSNDWD 99

Query: 58  LFKWFTGMEKPPEYLRTPIFKKIYDYYSNN 87
           +F W TG++  P+     +   + ++  NN
Sbjct: 100 IFYWATGVKPTPKEYDNEVMNMLKNHVKNN 129


>gi|85712968|ref|ZP_01044007.1| hypothetical protein OS145_07434 [Idiomarina baltica OS145]
 gi|85693206|gb|EAQ31165.1| hypothetical protein OS145_07434 [Idiomarina baltica OS145]
          Length = 90

 Score = 43.1 bits (100), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 34/61 (55%), Gaps = 1/61 (1%)

Query: 10 RKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPP 69
          R++ + C RRG  E+D++   FVD     LS  +  +   ++  DD +LF WF G +K P
Sbjct: 15 RRLKWAC-RRGMLELDVLFEPFVDEAYDHLSEEDKAIFRRLVTCDDPDLFAWFMGHKKCP 73

Query: 70 E 70
          +
Sbjct: 74 D 74


>gi|322501057|emb|CBZ36134.1| unnamed protein product [Leishmania donovani BPK282A1]
          Length = 301

 Score = 43.1 bits (100), Expect = 0.013,   Method: Composition-based stats.
 Identities = 25/88 (28%), Positives = 45/88 (51%), Gaps = 3/88 (3%)

Query: 10  RKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFT-GMEKP 68
           R+++Y+   RG  EMDLI G F    +  L +  L   + ++++ DS LF+W   G++ P
Sbjct: 215 RRLIYQSRYRGMVEMDLIFGHFARCKLETLDASMLDEYDVLLKQLDSELFRWLVMGVDAP 274

Query: 69  PEYLRTPIFKKIYDYYSNNLDRKNMLGS 96
               +   F ++  +     +R  +LGS
Sbjct: 275 EGVAKLRCFDELRRFIKE--ERTELLGS 300


>gi|321249321|ref|XP_003191419.1| mitochondrion protein [Cryptococcus gattii WM276]
 gi|317457886|gb|ADV19632.1| mitochondrion protein, putative [Cryptococcus gattii WM276]
          Length = 175

 Score = 42.7 bits (99), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 43/77 (55%), Gaps = 1/77 (1%)

Query: 11  KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
           +++Y+  +RGT E DLIL +F    + ++   E+   + +++E D ++F W     +PP 
Sbjct: 81  RLIYQTRKRGTLETDLILSTFARDELPKMDFKEMKQFDKLLDEPDWDIFYWSVEKREPPA 140

Query: 71  -YLRTPIFKKIYDYYSN 86
            +  +PI +K+  +  N
Sbjct: 141 RWNGSPILEKLKKHAKN 157


>gi|308799237|ref|XP_003074399.1| unnamed protein product [Ostreococcus tauri]
 gi|116000570|emb|CAL50250.1| unnamed protein product [Ostreococcus tauri]
          Length = 148

 Score = 42.7 bits (99), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 46/85 (54%), Gaps = 3/85 (3%)

Query: 11  KIVYRCWRRGTREMDLILGSFVDHFI-LELSSVE-LTMLESIIEEDDSNLFKWFTGMEKP 68
           + +YR  +RG  E+D+++G++    +  E +S+E L   + ++  ++  LFKW TG E+ 
Sbjct: 40  RALYRARQRGFLELDIVVGAWATRTLDPETASMEFLDAFDEVLRAENPELFKWLTGQERA 99

Query: 69  PEYL-RTPIFKKIYDYYSNNLDRKN 92
           P  +     +  + ++    LD K+
Sbjct: 100 PRAMAENAAYASLAEHCKKFLDEKS 124


>gi|54297491|ref|YP_123860.1| hypothetical protein lpp1536 [Legionella pneumophila str. Paris]
 gi|81175065|sp|Q5X4Y4|Y1536_LEGPA RecName: Full=UPF0350 protein lpp1536
 gi|53751276|emb|CAH12687.1| hypothetical protein lpp1536 [Legionella pneumophila str. Paris]
          Length = 79

 Score = 42.7 bits (99), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 41/67 (61%), Gaps = 1/67 (1%)

Query: 6  NLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGM 65
          N +  +++++C RRG  E+DL+L  F+ + I  L+  +L   ++++  +D +L+ W  G 
Sbjct: 3  NREKSRLLWKC-RRGMLELDLLLQKFIANEIDRLTENQLKAFDNLLTHNDPSLYAWLMGH 61

Query: 66 EKPPEYL 72
          E+P + L
Sbjct: 62 EEPEKEL 68


>gi|254481369|ref|ZP_05094614.1| TPR repeat region superfamily protein [marine gamma
          proteobacterium HTCC2148]
 gi|214038532|gb|EEB79194.1| TPR repeat region superfamily protein [marine gamma
          proteobacterium HTCC2148]
          Length = 88

 Score = 42.7 bits (99), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 35/72 (48%)

Query: 18 RRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPEYLRTPIF 77
          RRG  E+DL+L  FV      L   +    + ++  +D +LF WF   E+P +     I 
Sbjct: 15 RRGMLELDLVLEPFVQSRFATLDEADRIRFKDLMLSEDQDLFAWFMRREQPQDRELALIV 74

Query: 78 KKIYDYYSNNLD 89
          KKI D+   + D
Sbjct: 75 KKILDFTHTSPD 86


>gi|300121586|emb|CBK22104.2| unnamed protein product [Blastocystis hominis]
          Length = 174

 Score = 42.7 bits (99), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 40/74 (54%)

Query: 10  RKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPP 69
           +++++R  +RG  E+DL+LG +    I  LS  EL   E+++  +  ++F W T     P
Sbjct: 78  KRLLHRSRQRGMLEVDLLLGKWAQLNINRLSRQELDQYEALLNSETVDIFSWITDKSPLP 137

Query: 70  EYLRTPIFKKIYDY 83
             +  PI ++I  +
Sbjct: 138 PEMDLPIVREIQQW 151


>gi|209695952|ref|YP_002263882.1| hypothetical protein VSAL_I2534 [Aliivibrio salmonicida LFI1238]
 gi|208009905|emb|CAQ80218.1| conserved hypothetical protein [Aliivibrio salmonicida LFI1238]
          Length = 86

 Score = 42.4 bits (98), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 37/78 (47%), Gaps = 1/78 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          ++ + C RRG  E+D+++  F D    EL+  E     S++E DD +LF W  G  +   
Sbjct: 9  RVKWAC-RRGMLELDVVIMPFFDECFEELTEAEQQGFVSLLESDDPDLFTWIMGHGRSDN 67

Query: 71 YLRTPIFKKIYDYYSNNL 88
               +  KI  +  + L
Sbjct: 68 LAHASMIDKIVAHNHSKL 85


>gi|219113397|ref|XP_002186282.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gi|209583132|gb|ACI65752.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
          Length = 206

 Score = 42.4 bits (98), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 43/75 (57%)

Query: 1   MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
            K N++++ ++++YR  +RG  E+DL+LG++    +   +  EL   E+ +  +  +++ 
Sbjct: 96  AKLNLDIRRKRLIYRSKQRGWLEVDLLLGTYASEHVHTFAHDELNQFEAFVNLETIDIYN 155

Query: 61  WFTGMEKPPEYLRTP 75
             T     PE+++TP
Sbjct: 156 IITLRLDIPEHMKTP 170


>gi|294083796|ref|YP_003550553.1| hypothetical protein SAR116_0226 [Candidatus Puniceispirillum
          marinum IMCC1322]
 gi|292663368|gb|ADE38469.1| protein of unknown function DUF339 [Candidatus Puniceispirillum
          marinum IMCC1322]
          Length = 87

 Score = 42.4 bits (98), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 39/73 (53%)

Query: 8  QCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEK 67
          + R+++Y+    G +E DL+LG F    + +L+  EL   E++++  D  ++ W    E 
Sbjct: 9  RARRLIYQASYTGMKETDLLLGHFAKVHLPDLNDNELDDFEALLKVGDPIIYAWVMEKEP 68

Query: 68 PPEYLRTPIFKKI 80
           P +  T +F+ I
Sbjct: 69 VPMHYNTRVFQLI 81


>gi|70993332|ref|XP_751513.1| TPR repeat protein [Aspergillus fumigatus Af293]
 gi|66849147|gb|EAL89475.1| TPR repeat protein [Aspergillus fumigatus Af293]
 gi|159125553|gb|EDP50670.1| TPR repeat protein [Aspergillus fumigatus A1163]
          Length = 295

 Score = 42.4 bits (98), Expect = 0.023,   Method: Composition-based stats.
 Identities = 17/65 (26%), Positives = 39/65 (60%), Gaps = 2/65 (3%)

Query: 11  KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
           +++Y+  +RG  E DL+L +F D ++ +++  +L   +  ++E+D +++ W T  + PP 
Sbjct: 151 RLLYQSRKRGILESDLLLSTFADVYLKDMTPEQLQEYDRFLDENDWDIYYWAT--QDPPS 208

Query: 71  YLRTP 75
              +P
Sbjct: 209 ATDSP 213


>gi|254578394|ref|XP_002495183.1| ZYRO0B05324p [Zygosaccharomyces rouxii]
 gi|238938073|emb|CAR26250.1| ZYRO0B05324p [Zygosaccharomyces rouxii]
          Length = 158

 Score = 42.4 bits (98), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 49/85 (57%), Gaps = 5/85 (5%)

Query: 11  KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEK--- 67
           +++Y+  +RG  E DL+LG F   ++ E++  +L   +S+++E D +++ W T   +   
Sbjct: 64  RLIYQSRKRGILETDLLLGGFAAKYLKEMTPEQLAEYDSLLDELDWDIYYWATKNYETSP 123

Query: 68  -PPEYLRTPIFKKIYDYYSNNLDRK 91
            P ++  + + KK+   Y+ N D+K
Sbjct: 124 IPEKWKNSELMKKL-QVYAENKDKK 147


>gi|197335149|ref|YP_002156895.1| protein VV1_1557 [Vibrio fischeri MJ11]
 gi|197316639|gb|ACH66086.1| protein VV1_1557 [Vibrio fischeri MJ11]
          Length = 86

 Score = 42.0 bits (97), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 36/73 (49%), Gaps = 1/73 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          ++ + C RRG  E+D+++  F D    EL+  E     S++E DD +LF W  G  +   
Sbjct: 9  RVKWAC-RRGMLELDVVIMPFFDECFEELTEAEQQAFVSLLECDDPDLFTWIMGHGRSDN 67

Query: 71 YLRTPIFKKIYDY 83
               +  KI ++
Sbjct: 68 LAHASMVDKIVEH 80


>gi|154299367|ref|XP_001550103.1| hypothetical protein BC1G_11169 [Botryotinia fuckeliana B05.10]
 gi|150857434|gb|EDN32626.1| hypothetical protein BC1G_11169 [Botryotinia fuckeliana B05.10]
          Length = 331

 Score = 42.0 bits (97), Expect = 0.026,   Method: Composition-based stats.
 Identities = 14/58 (24%), Positives = 35/58 (60%)

Query: 11  KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKP 68
           +++Y+  +RGT E DL++ +F D  +  +++ ++   +  ++E+D +++ W T    P
Sbjct: 147 RLLYQSRKRGTLESDLLMSTFADAHLPNMTAAQMVQYDQFLDENDWDIYYWVTQEPSP 204


>gi|192361870|ref|YP_001982678.1| TPR repeat family protein [Cellvibrio japonicus Ueda107]
 gi|190688035|gb|ACE85713.1| TPR repeat family protein [Cellvibrio japonicus Ueda107]
          Length = 81

 Score = 42.0 bits (97), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 36/75 (48%), Gaps = 4/75 (5%)

Query: 18 RRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPEYLRTPIF 77
          RRG  E+DLIL  F++     L   +     +++EE D +LF WF   E PP    T   
Sbjct: 11 RRGMLELDLILLPFLERVYPGLEQADKERYWALLEEQDQDLFAWFLRRENPP----TAEL 66

Query: 78 KKIYDYYSNNLDRKN 92
          ++I D    N   +N
Sbjct: 67 QRIVDIIRANTGLQN 81


>gi|59712703|ref|YP_205479.1| hypothetical protein VF_2096 [Vibrio fischeri ES114]
 gi|75353459|sp|Q5E305|Y2096_VIBF1 RecName: Full=UPF0350 protein VF_2096
 gi|59480804|gb|AAW86591.1| hypothetical protein VF_2096 [Vibrio fischeri ES114]
          Length = 86

 Score = 42.0 bits (97), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 36/73 (49%), Gaps = 1/73 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          ++ + C RRG  E+D+++  F D    EL+  E     S++E DD +LF W  G  +   
Sbjct: 9  RVKWAC-RRGMLELDVVIMPFFDECFEELTEAEQQAFVSLLECDDPDLFTWVMGHGRSDN 67

Query: 71 YLRTPIFKKIYDY 83
               +  KI ++
Sbjct: 68 LAHASMVDKIVEH 80


>gi|256076238|ref|XP_002574420.1| hypothetical protein [Schistosoma mansoni]
 gi|238659625|emb|CAZ30653.1| expressed protein [Schistosoma mansoni]
          Length = 161

 Score = 42.0 bits (97), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 19/79 (24%), Positives = 45/79 (56%), Gaps = 2/79 (2%)

Query: 11  KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDS--NLFKWFTGMEKP 68
           +++Y+  +RG  E  ++L +F   ++  ++  +L   +S+I   D+  +++ W T  ++ 
Sbjct: 71  RLLYQSRKRGNLENGILLSTFAAKYLNSMTHEQLIAYDSLINLPDNEWDIYYWITKAKEA 130

Query: 69  PEYLRTPIFKKIYDYYSNN 87
           PEY +T I + + ++  NN
Sbjct: 131 PEYFQTDILQLLQEHCQNN 149


>gi|156044082|ref|XP_001588597.1| hypothetical protein SS1G_10144 [Sclerotinia sclerotiorum 1980]
 gi|154694533|gb|EDN94271.1| hypothetical protein SS1G_10144 [Sclerotinia sclerotiorum 1980
           UF-70]
          Length = 331

 Score = 42.0 bits (97), Expect = 0.030,   Method: Composition-based stats.
 Identities = 14/58 (24%), Positives = 35/58 (60%)

Query: 11  KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKP 68
           +++Y+  +RGT E DL++ +F D  +  +++ ++   +  ++E+D +++ W T    P
Sbjct: 147 RLLYQSRKRGTLESDLLMSTFADAHLPTMTAAQMVQYDQFLDENDWDIYYWVTQEPSP 204


>gi|331005233|ref|ZP_08328626.1| hypothetical protein IMCC1989_1373 [gamma proteobacterium
          IMCC1989]
 gi|330420976|gb|EGG95249.1| hypothetical protein IMCC1989_1373 [gamma proteobacterium
          IMCC1989]
          Length = 82

 Score = 41.6 bits (96), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 31/58 (53%), Gaps = 2/58 (3%)

Query: 18 RRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKP--PEYLR 73
          RRG  E+DL+L  F++     LS  +  +   ++EE D +LF WF   E P  P  LR
Sbjct: 11 RRGMLELDLVLMPFIEKVYSSLSEADQQLYHLLLEEQDQDLFTWFMRREDPTDPNLLR 68


>gi|322493503|emb|CBZ28791.1| conserved hypothetical protein [Leishmania mexicana
           MHOM/GT/2001/U1103]
          Length = 235

 Score = 41.6 bits (96), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 51/96 (53%), Gaps = 3/96 (3%)

Query: 2   KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
           K+++  + R+++Y+   RG  EMDLI G F    +  L +  L   ++++++ DS LF+W
Sbjct: 141 KESVECKRRRLIYQSRYRGMVEMDLIFGHFARCKLETLDASMLDEYDTLLKQLDSELFRW 200

Query: 62  FT-GMEKPPEYLRTPIFKKIYDYYSNNLDRKNMLGS 96
              G++ P    +   F ++  +     +R  +LGS
Sbjct: 201 LVMGVDAPEGMTKLRCFDELRRFIKE--ERTELLGS 234


>gi|195995797|ref|XP_002107767.1| hypothetical protein TRIADDRAFT_20085 [Trichoplax adhaerens]
 gi|190588543|gb|EDV28565.1| hypothetical protein TRIADDRAFT_20085 [Trichoplax adhaerens]
          Length = 145

 Score = 41.6 bits (96), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 20/78 (25%), Positives = 40/78 (51%), Gaps = 2/78 (2%)

Query: 11  KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDS--NLFKWFTGMEKP 68
           +++Y+  +RG +E DL+L +F  HF+ ++ + +L   + ++ E  +   L+ W  G +  
Sbjct: 56  RLLYQSRKRGIKENDLLLSNFAHHFLHKMDNQQLDQYDRLLNESSNEWELYYWIIGTKSV 115

Query: 69  PEYLRTPIFKKIYDYYSN 86
           P      I   +  Y SN
Sbjct: 116 PTEFDNEIMAMLQKYASN 133


>gi|30250297|ref|NP_842367.1| hypothetical protein NE2372 [Nitrosomonas europaea ATCC 19718]
 gi|75540026|sp|Q82SG6|Y2372_NITEU RecName: Full=UPF0350 protein NE2372
 gi|30181092|emb|CAD86284.1| conserved hypothetical protein [Nitrosomonas europaea ATCC 19718]
          Length = 77

 Score = 41.6 bits (96), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 39/74 (52%), Gaps = 2/74 (2%)

Query: 5  MNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTG 64
          MN Q R + +RC RRG  E+D++L  F+D+   +L   +L + E ++   D +L+    G
Sbjct: 1  MNHQAR-MRWRC-RRGMLELDIVLQRFIDNHYEQLDEHQLELFEMLLSLSDHDLWNIIIG 58

Query: 65 MEKPPEYLRTPIFK 78
            K P     P+ K
Sbjct: 59 NTKEPNNQFQPVLK 72


>gi|121708553|ref|XP_001272170.1| TPR repeat protein [Aspergillus clavatus NRRL 1]
 gi|119400318|gb|EAW10744.1| TPR repeat protein [Aspergillus clavatus NRRL 1]
          Length = 300

 Score = 41.2 bits (95), Expect = 0.042,   Method: Composition-based stats.
 Identities = 15/53 (28%), Positives = 34/53 (64%)

Query: 11  KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFT 63
           +++Y+  +RG  E DL+L +F D ++ +++  EL   +  ++E+D +++ W T
Sbjct: 153 RLLYQSRKRGILESDLLLSTFADVYLADMTPEELQQYDRFLDENDWDIYYWAT 205


>gi|242791990|ref|XP_002481862.1| TPR repeat protein [Talaromyces stipitatus ATCC 10500]
 gi|218718450|gb|EED17870.1| TPR repeat protein [Talaromyces stipitatus ATCC 10500]
          Length = 303

 Score = 41.2 bits (95), Expect = 0.043,   Method: Composition-based stats.
 Identities = 17/60 (28%), Positives = 35/60 (58%)

Query: 11  KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
           +++Y+  +RG  E DL+L +F D ++  +S  +L   +  ++E+D +++ W T   K  E
Sbjct: 148 RLLYQSRKRGILETDLLLSTFADVYLGNMSKEQLQQYDKFLDENDWDIYYWATQEPKQAE 207


>gi|91763275|ref|ZP_01265239.1| hypothetical protein PU1002_01415 [Candidatus Pelagibacter ubique
          HTCC1002]
 gi|91717688|gb|EAS84339.1| hypothetical protein PU1002_01415 [Candidatus Pelagibacter ubique
          HTCC1002]
          Length = 88

 Score = 41.2 bits (95), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 36/54 (66%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTG 64
          KI YR   RGT+EMD +LGSF   +I + +  ELT+L  +++ DD NL+K+  G
Sbjct: 11 KITYRANYRGTKEMDKLLGSFTKKYIDQFNEQELTLLCDLLDFDDENLYKFNQG 64


>gi|119499940|ref|XP_001266727.1| TPR repeat protein [Neosartorya fischeri NRRL 181]
 gi|119414892|gb|EAW24830.1| TPR repeat protein [Neosartorya fischeri NRRL 181]
          Length = 295

 Score = 41.2 bits (95), Expect = 0.049,   Method: Composition-based stats.
 Identities = 17/65 (26%), Positives = 38/65 (58%), Gaps = 2/65 (3%)

Query: 11  KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
           +++Y+  +RG  E DL+L +F D ++ +++  +L   +  ++E+D +++ W T  + PP 
Sbjct: 151 RLLYQSRKRGILESDLLLSTFADVYLKDMTPEQLQEYDRFLDENDWDIYYWAT--QDPPS 208

Query: 71  YLRTP 75
               P
Sbjct: 209 STDGP 213


>gi|120599811|ref|YP_964385.1| hypothetical protein Sputw3181_3014 [Shewanella sp. W3-18-1]
 gi|146292253|ref|YP_001182677.1| hypothetical protein Sputcn32_1150 [Shewanella putrefaciens
          CN-32]
 gi|120559904|gb|ABM25831.1| protein of unknown function DUF339 [Shewanella sp. W3-18-1]
 gi|145563943|gb|ABP74878.1| protein of unknown function DUF339 [Shewanella putrefaciens
          CN-32]
          Length = 79

 Score = 41.2 bits (95), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 34/60 (56%), Gaps = 1/60 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          ++ + C RRG  E+D++   FV++   +LS ++      ++E +D  LF WF G E  P+
Sbjct: 5  RVRWAC-RRGMLELDVLFQPFVENIYQDLSDIDKASFIRLLECEDPELFAWFMGHEACPD 63


>gi|67527801|ref|XP_661768.1| hypothetical protein AN4164.2 [Aspergillus nidulans FGSC A4]
 gi|40740235|gb|EAA59425.1| hypothetical protein AN4164.2 [Aspergillus nidulans FGSC A4]
 gi|259481239|tpe|CBF74574.1| TPA: TPR repeat protein (AFU_orthologue; AFUA_4G13180) [Aspergillus
           nidulans FGSC A4]
          Length = 296

 Score = 40.8 bits (94), Expect = 0.057,   Method: Composition-based stats.
 Identities = 16/59 (27%), Positives = 37/59 (62%), Gaps = 2/59 (3%)

Query: 11  KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPP 69
           +++Y+  +RG  E DL+L +F D ++ +++  +L   +  ++E+D +++ W T  + PP
Sbjct: 149 RLLYQSRKRGILESDLLLSTFADVYLADMNKEQLQEYDRFLDENDWDIYYWAT--QDPP 205


>gi|88812340|ref|ZP_01127590.1| hypothetical protein NB231_01099 [Nitrococcus mobilis Nb-231]
 gi|88790347|gb|EAR21464.1| hypothetical protein NB231_01099 [Nitrococcus mobilis Nb-231]
          Length = 79

 Score = 40.8 bits (94), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 37/70 (52%), Gaps = 2/70 (2%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          ++ +RC RRGTRE++ +L  F+DH  L L   +L   E +++ +D  L  W    + P +
Sbjct: 6  RLRWRC-RRGTRELEYLLQRFLDHH-LSLDEPDLRAFERLLDCEDDRLIDWLIRGDDPAD 63

Query: 71 YLRTPIFKKI 80
               I + I
Sbjct: 64 GQLCAIIRHI 73


>gi|145229999|ref|XP_001389308.1| succinate dehydrogenase assembly factor 2 [Aspergillus niger CBS
           513.88]
 gi|134055422|emb|CAK37131.1| unnamed protein product [Aspergillus niger]
          Length = 302

 Score = 40.8 bits (94), Expect = 0.058,   Method: Composition-based stats.
 Identities = 16/59 (27%), Positives = 37/59 (62%), Gaps = 2/59 (3%)

Query: 11  KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPP 69
           +++Y+  +RG  E DL+L +F D ++ +++  +L   +  ++E+D +++ W T  + PP
Sbjct: 151 RLLYQSRKRGILESDLLLSTFADVYLADMNKEQLQEYDRFLDENDWDIYYWAT--QDPP 207


>gi|319425552|gb|ADV53626.1| protein of unknown function DUF339 [Shewanella putrefaciens 200]
          Length = 82

 Score = 40.8 bits (94), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 34/60 (56%), Gaps = 1/60 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          ++ + C RRG  E+D++   FV++   +LS ++      ++E +D  LF WF G E  P+
Sbjct: 8  RVRWAC-RRGMLELDVLFQPFVENIYQDLSDIDKASFIRLLECEDPELFAWFMGHEACPD 66


>gi|281602230|gb|ADA75214.1| hypothetical protein SFxv_3162 [Shigella flexneri 2002017]
 gi|332753733|gb|EGJ84112.1| hypothetical protein SFK671_3463 [Shigella flexneri K-671]
 gi|333015102|gb|EGK34445.1| hypothetical protein SFK304_3694 [Shigella flexneri K-304]
          Length = 88

 Score = 40.8 bits (94), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 35/66 (53%)

Query: 5  MNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTG 64
          M++  +  ++   RRG RE+D+ + SF +H    LS  E  +   ++E DD +LF W   
Sbjct: 1  MDINNKARIHWACRRGMRELDISIMSFFEHEYDSLSDDEKRIFIRLLECDDPDLFNWLMN 60

Query: 65 MEKPPE 70
            KP +
Sbjct: 61 HGKPAD 66


>gi|46137249|ref|XP_390316.1| hypothetical protein FG10140.1 [Gibberella zeae PH-1]
          Length = 217

 Score = 40.8 bits (94), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 34/57 (59%)

Query: 11  KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEK 67
           ++VY+  +RGT E DL+L +F    +  LS   L   + I++E+D +++ W T  E+
Sbjct: 69  RLVYQSRKRGTLESDLLLSTFASAHLASLSPELLDQYDRILDENDWDIYYWATQKEE 125


>gi|283788445|ref|YP_003368310.1| hypothetical protein ROD_49361 [Citrobacter rodentium ICC168]
 gi|282951899|emb|CBG91617.1| conserved hypothetical protein [Citrobacter rodentium ICC168]
          Length = 88

 Score = 40.8 bits (94), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 34/66 (51%)

Query: 5  MNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTG 64
          M++  +  ++   RRG RE+D+ +  F +H    LS  E  +   ++E DD +LF W   
Sbjct: 1  MDINNKARIHWACRRGMRELDISIMPFFEHEYDTLSDAEKRIFVRLLECDDPDLFNWLMN 60

Query: 65 MEKPPE 70
            KP +
Sbjct: 61 HGKPAD 66


>gi|24372917|ref|NP_716959.1| hypothetical protein SO_1339 [Shewanella oneidensis MR-1]
 gi|81175061|sp|Q8EH90|Y1339_SHEON RecName: Full=UPF0350 protein SO_1339
 gi|24347049|gb|AAN54404.1|AE015578_4 conserved hypothetical protein [Shewanella oneidensis MR-1]
          Length = 82

 Score = 40.4 bits (93), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 34/60 (56%), Gaps = 1/60 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          ++ + C RRG  E+D++   FVD+   +LS  +  +   ++E +D  LF WF G E  P+
Sbjct: 8  RVRWAC-RRGMLELDVLFQPFVDNVYQDLSDEDKVLFIRLLECEDPELFAWFMGHEVCPD 66


>gi|109899464|ref|YP_662719.1| hypothetical protein Patl_3159 [Pseudoalteromonas atlantica T6c]
 gi|109701745|gb|ABG41665.1| protein of unknown function DUF339 [Pseudoalteromonas atlantica
          T6c]
          Length = 83

 Score = 40.4 bits (93), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 35/66 (53%), Gaps = 4/66 (6%)

Query: 18 RRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPEYLRTPIF 77
          RRG  E+D+I   FV+    +LS  +  + ES++  DD +L+ W  G +        P +
Sbjct: 15 RRGMLELDVIFMPFVEEGFNDLSEADKVIFESLLTCDDPDLYAWLMGHQA----CNNPDY 70

Query: 78 KKIYDY 83
          K++ D+
Sbjct: 71 KRLIDH 76


>gi|213404718|ref|XP_002173131.1| early meiotic induction protein [Schizosaccharomyces japonicus
           yFS275]
 gi|257096791|sp|B6JZ70|SDHF2_SCHJY RecName: Full=Succinate dehydrogenase assembly factor 2,
           mitochondrial; Short=SDH assembly factor 2; AltName:
           Full=Early meiotic induction protein 5; AltName:
           Full=Succinate dehydrogenase subunit 5, mitochondrial;
           Flags: Precursor
 gi|212001178|gb|EEB06838.1| early meiotic induction protein [Schizosaccharomyces japonicus
           yFS275]
          Length = 143

 Score = 40.4 bits (93), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 43/77 (55%), Gaps = 1/77 (1%)

Query: 11  KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
           ++VY+  +RG  E DLIL  F   ++ + +   L   ++++ E D ++  W TG  + PE
Sbjct: 56  RLVYQSRKRGILETDLILSGFAKEYLSKYNVELLKEYDNLLNEADWDILYWCTGERQAPE 115

Query: 71  -YLRTPIFKKIYDYYSN 86
            +L + + + + +Y S+
Sbjct: 116 HWLNSRVLRDLKEYLSS 132


>gi|300023170|ref|YP_003755781.1| hypothetical protein Hden_1653 [Hyphomicrobium denitrificans ATCC
          51888]
 gi|299524991|gb|ADJ23460.1| protein of unknown function DUF339 [Hyphomicrobium denitrificans
          ATCC 51888]
          Length = 90

 Score = 40.4 bits (93), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 37/72 (51%), Gaps = 1/72 (1%)

Query: 1  MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
          M  +++++ R+  YR   RGT+EMDL++G + D  I   S   +   E  +   D  L  
Sbjct: 1  MADDLDVRRRRASYRAHHRGTKEMDLLVGRYADVRIPAWSEEAVQHFERFLNLPDPLLQA 60

Query: 61 W-FTGMEKPPEY 71
          W F+G  +  E+
Sbjct: 61 WIFSGEPESGEF 72


>gi|16761828|ref|NP_457445.1| hypothetical protein STY3203 [Salmonella enterica subsp. enterica
          serovar Typhi str. CT18]
 gi|16766348|ref|NP_461963.1| hypothetical protein STM3047 [Salmonella enterica subsp. enterica
          serovar Typhimurium str. LT2]
 gi|29143315|ref|NP_806657.1| hypothetical protein t2965 [Salmonella enterica subsp. enterica
          serovar Typhi str. Ty2]
 gi|56414993|ref|YP_152068.1| hypothetical protein SPA2915 [Salmonella enterica subsp. enterica
          serovar Paratyphi A str. ATCC 9150]
 gi|62181557|ref|YP_217974.1| hypothetical protein SC2987 [Salmonella enterica subsp. enterica
          serovar Choleraesuis str. SC-B67]
 gi|161615995|ref|YP_001589959.1| hypothetical protein SPAB_03795 [Salmonella enterica subsp.
          enterica serovar Paratyphi B str. SPB7]
 gi|167550069|ref|ZP_02343826.1| TPR repeat protein [Salmonella enterica subsp. enterica serovar
          Saintpaul str. SARA29]
 gi|167994110|ref|ZP_02575202.1| TPR repeat protein [Salmonella enterica subsp. enterica serovar
          4,[5],12:i:- str. CVM23701]
 gi|168231152|ref|ZP_02656210.1| TPR repeat protein [Salmonella enterica subsp. enterica serovar
          Kentucky str. CDC 191]
 gi|168236106|ref|ZP_02661164.1| TPR repeat protein [Salmonella enterica subsp. enterica serovar
          Schwarzengrund str. SL480]
 gi|168242834|ref|ZP_02667766.1| protein YgfY [Salmonella enterica subsp. enterica serovar
          Heidelberg str. SL486]
 gi|168261791|ref|ZP_02683764.1| TPR repeat protein [Salmonella enterica subsp. enterica serovar
          Hadar str. RI_05P066]
 gi|168463785|ref|ZP_02697702.1| TPR repeat protein [Salmonella enterica subsp. enterica serovar
          Newport str. SL317]
 gi|168823062|ref|ZP_02835062.1| TPR repeat protein [Salmonella enterica subsp. enterica serovar
          Weltevreden str. HI_N05-537]
 gi|194443194|ref|YP_002042298.1| hypothetical protein SNSL254_A3282 [Salmonella enterica subsp.
          enterica serovar Newport str. SL254]
 gi|194451388|ref|YP_002047031.1| hypothetical protein SeHA_C3279 [Salmonella enterica subsp.
          enterica serovar Heidelberg str. SL476]
 gi|194470206|ref|ZP_03076190.1| TPR repeat protein [Salmonella enterica subsp. enterica serovar
          Kentucky str. CVM29188]
 gi|194472028|ref|ZP_03078012.1| TPR repeat protein [Salmonella enterica subsp. enterica serovar
          Kentucky str. CVM29188]
 gi|194736338|ref|YP_002115996.1| hypothetical protein SeSA_A3216 [Salmonella enterica subsp.
          enterica serovar Schwarzengrund str. CVM19633]
 gi|197250464|ref|YP_002147959.1| hypothetical protein SeAg_B3204 [Salmonella enterica subsp.
          enterica serovar Agona str. SL483]
 gi|197264493|ref|ZP_03164567.1| TPR repeat protein [Salmonella enterica subsp. enterica serovar
          Saintpaul str. SARA23]
 gi|197363922|ref|YP_002143559.1| hypothetical protein SSPA2717 [Salmonella enterica subsp.
          enterica serovar Paratyphi A str. AKU_12601]
 gi|198244586|ref|YP_002217024.1| hypothetical protein SeD_A3384 [Salmonella enterica subsp.
          enterica serovar Dublin str. CT_02021853]
 gi|200387067|ref|ZP_03213679.1| protein YgfY [Salmonella enterica subsp. enterica serovar Virchow
          str. SL491]
 gi|204928371|ref|ZP_03219571.1| TPR repeat protein [Salmonella enterica subsp. enterica serovar
          Javiana str. GA_MM04042433]
 gi|205353971|ref|YP_002227772.1| hypothetical protein SG2942 [Salmonella enterica subsp. enterica
          serovar Gallinarum str. 287/91]
 gi|207858310|ref|YP_002244961.1| hypothetical protein SEN2890 [Salmonella enterica subsp. enterica
          serovar Enteritidis str. P125109]
 gi|213025340|ref|ZP_03339787.1| hypothetical protein Salmonelentericaenterica_23998 [Salmonella
          enterica subsp. enterica serovar Typhi str. 404ty]
 gi|213162148|ref|ZP_03347858.1| hypothetical protein Salmoneentericaenterica_19993 [Salmonella
          enterica subsp. enterica serovar Typhi str. E00-7866]
 gi|213425826|ref|ZP_03358576.1| hypothetical protein SentesTyphi_09337 [Salmonella enterica
          subsp. enterica serovar Typhi str. E02-1180]
 gi|213582633|ref|ZP_03364459.1| hypothetical protein SentesTyph_16088 [Salmonella enterica subsp.
          enterica serovar Typhi str. E98-0664]
 gi|213609790|ref|ZP_03369616.1| hypothetical protein SentesTyp_04375 [Salmonella enterica subsp.
          enterica serovar Typhi str. E98-2068]
 gi|213646967|ref|ZP_03377020.1| hypothetical protein SentesTy_06454 [Salmonella enterica subsp.
          enterica serovar Typhi str. J185]
 gi|213857739|ref|ZP_03384710.1| hypothetical protein SentesT_21660 [Salmonella enterica subsp.
          enterica serovar Typhi str. M223]
 gi|224584836|ref|YP_002638634.1| hypothetical protein SPC_3106 [Salmonella enterica subsp.
          enterica serovar Paratyphi C strain RKS4594]
 gi|238909846|ref|ZP_04653683.1| hypothetical protein SentesTe_01750 [Salmonella enterica subsp.
          enterica serovar Tennessee str. CDC07-0191]
 gi|289806994|ref|ZP_06537623.1| hypothetical protein Salmonellaentericaenterica_22237 [Salmonella
          enterica subsp. enterica serovar Typhi str. AG3]
 gi|289823824|ref|ZP_06543436.1| hypothetical protein Salmonellentericaenterica_01172 [Salmonella
          enterica subsp. enterica serovar Typhi str. E98-3139]
 gi|75481005|sp|Q57K69|YGFY_SALCH RecName: Full=UPF0350 protein ygfY
 gi|81175094|sp|Q5PJF5|YGFY_SALPA RecName: Full=UPF0350 protein ygfY
 gi|81175095|sp|Q8XEN6|YGFY_SALTI RecName: Full=UPF0350 protein ygfY
 gi|81175096|sp|Q7CPV1|YGFY_SALTY RecName: Full=UPF0350 protein ygfY
 gi|25512534|pir||AE0872 conserved hypothetical protein STY3203 [imported] - Salmonella
          enterica subsp. enterica serovar Typhi (strain CT18)
 gi|16421598|gb|AAL21922.1| putative cytoplasmic protein [Salmonella enterica subsp. enterica
          serovar Typhimurium str. LT2]
 gi|16504130|emb|CAD02877.1| conserved hypothetical protein [Salmonella enterica subsp.
          enterica serovar Typhi]
 gi|29138949|gb|AAO70517.1| conserved hypothetical protein [Salmonella enterica subsp.
          enterica serovar Typhi str. Ty2]
 gi|56129250|gb|AAV78756.1| conserved hypothetical protein [Salmonella enterica subsp.
          enterica serovar Paratyphi A str. ATCC 9150]
 gi|62129190|gb|AAX66893.1| putative cytoplasmic protein [Salmonella enterica subsp. enterica
          serovar Choleraesuis str. SC-B67]
 gi|161365359|gb|ABX69127.1| hypothetical protein SPAB_03795 [Salmonella enterica subsp.
          enterica serovar Paratyphi B str. SPB7]
 gi|194401857|gb|ACF62079.1| TPR repeat protein [Salmonella enterica subsp. enterica serovar
          Newport str. SL254]
 gi|194409692|gb|ACF69911.1| protein YgfY [Salmonella enterica subsp. enterica serovar
          Heidelberg str. SL476]
 gi|194456570|gb|EDX45409.1| TPR repeat protein [Salmonella enterica subsp. enterica serovar
          Kentucky str. CVM29188]
 gi|194458392|gb|EDX47231.1| TPR repeat protein [Salmonella enterica subsp. enterica serovar
          Kentucky str. CVM29188]
 gi|194711840|gb|ACF91061.1| TPR repeat protein [Salmonella enterica subsp. enterica serovar
          Schwarzengrund str. CVM19633]
 gi|195633729|gb|EDX52143.1| TPR repeat protein [Salmonella enterica subsp. enterica serovar
          Newport str. SL317]
 gi|197095399|emb|CAR60958.1| conserved hypothetical protein [Salmonella enterica subsp.
          enterica serovar Paratyphi A str. AKU_12601]
 gi|197214167|gb|ACH51564.1| TPR repeat protein [Salmonella enterica subsp. enterica serovar
          Agona str. SL483]
 gi|197242748|gb|EDY25368.1| TPR repeat protein [Salmonella enterica subsp. enterica serovar
          Saintpaul str. SARA23]
 gi|197290673|gb|EDY30027.1| TPR repeat protein [Salmonella enterica subsp. enterica serovar
          Schwarzengrund str. SL480]
 gi|197939102|gb|ACH76435.1| TPR repeat protein [Salmonella enterica subsp. enterica serovar
          Dublin str. CT_02021853]
 gi|199604165|gb|EDZ02710.1| protein YgfY [Salmonella enterica subsp. enterica serovar Virchow
          str. SL491]
 gi|204322693|gb|EDZ07890.1| TPR repeat protein [Salmonella enterica subsp. enterica serovar
          Javiana str. GA_MM04042433]
 gi|205273752|emb|CAR38747.1| conserved hypothetical protein [Salmonella enterica subsp.
          enterica serovar Gallinarum str. 287/91]
 gi|205324788|gb|EDZ12627.1| TPR repeat protein [Salmonella enterica subsp. enterica serovar
          Saintpaul str. SARA29]
 gi|205327995|gb|EDZ14759.1| TPR repeat protein [Salmonella enterica subsp. enterica serovar
          4,[5],12:i:- str. CVM23701]
 gi|205334422|gb|EDZ21186.1| TPR repeat protein [Salmonella enterica subsp. enterica serovar
          Kentucky str. CDC 191]
 gi|205338218|gb|EDZ24982.1| protein YgfY [Salmonella enterica subsp. enterica serovar
          Heidelberg str. SL486]
 gi|205340635|gb|EDZ27399.1| TPR repeat protein [Salmonella enterica subsp. enterica serovar
          Weltevreden str. HI_N05-537]
 gi|205349097|gb|EDZ35728.1| TPR repeat protein [Salmonella enterica subsp. enterica serovar
          Hadar str. RI_05P066]
 gi|206710113|emb|CAR34468.1| conserved hypothetical protein [Salmonella enterica subsp.
          enterica serovar Enteritidis str. P125109]
 gi|224469363|gb|ACN47193.1| hypothetical protein SPC_3106 [Salmonella enterica subsp.
          enterica serovar Paratyphi C strain RKS4594]
 gi|261248179|emb|CBG26015.1| conserved hypothetical protein [Salmonella enterica subsp.
          enterica serovar Typhimurium str. D23580]
 gi|267995201|gb|ACY90086.1| hypothetical protein STM14_3679 [Salmonella enterica subsp.
          enterica serovar Typhimurium str. 14028S]
 gi|301159603|emb|CBW19122.1| conserved hypothetical protein [Salmonella enterica subsp.
          enterica serovar Typhimurium str. SL1344]
 gi|312914068|dbj|BAJ38042.1| hypothetical protein STMDT12_C30990 [Salmonella enterica subsp.
          enterica serovar Typhimurium str. T000240]
 gi|320087476|emb|CBY97241.1| UPF0350 protein YPTB3173 [Salmonella enterica subsp. enterica
          serovar Weltevreden str. 2007-60-3289-1]
 gi|322613445|gb|EFY10386.1| hypothetical protein SEEM315_06935 [Salmonella enterica subsp.
          enterica serovar Montevideo str. 315996572]
 gi|322621037|gb|EFY17895.1| hypothetical protein SEEM971_19659 [Salmonella enterica subsp.
          enterica serovar Montevideo str. 495297-1]
 gi|322624101|gb|EFY20935.1| hypothetical protein SEEM973_19780 [Salmonella enterica subsp.
          enterica serovar Montevideo str. 495297-3]
 gi|322628160|gb|EFY24949.1| hypothetical protein SEEM974_21515 [Salmonella enterica subsp.
          enterica serovar Montevideo str. 495297-4]
 gi|322633279|gb|EFY30021.1| hypothetical protein SEEM201_12605 [Salmonella enterica subsp.
          enterica serovar Montevideo str. 515920-1]
 gi|322636143|gb|EFY32851.1| hypothetical protein SEEM202_13463 [Salmonella enterica subsp.
          enterica serovar Montevideo str. 515920-2]
 gi|322639481|gb|EFY36169.1| hypothetical protein SEEM954_11592 [Salmonella enterica subsp.
          enterica serovar Montevideo str. 531954]
 gi|322647586|gb|EFY44075.1| hypothetical protein SEEM054_10677 [Salmonella enterica subsp.
          enterica serovar Montevideo str. NC_MB110209-0054]
 gi|322648770|gb|EFY45217.1| hypothetical protein SEEM675_04666 [Salmonella enterica subsp.
          enterica serovar Montevideo str. OH_2009072675]
 gi|322653825|gb|EFY50151.1| hypothetical protein SEEM965_22316 [Salmonella enterica subsp.
          enterica serovar Montevideo str. CASC_09SCPH15965]
 gi|322657931|gb|EFY54199.1| hypothetical protein SEEM19N_18431 [Salmonella enterica subsp.
          enterica serovar Montevideo str. 19N]
 gi|322664034|gb|EFY60233.1| hypothetical protein SEEM801_04731 [Salmonella enterica subsp.
          enterica serovar Montevideo str. 81038-01]
 gi|322668955|gb|EFY65106.1| hypothetical protein SEEM507_09846 [Salmonella enterica subsp.
          enterica serovar Montevideo str. MD_MDA09249507]
 gi|322673051|gb|EFY69158.1| hypothetical protein SEEM877_00935 [Salmonella enterica subsp.
          enterica serovar Montevideo str. 414877]
 gi|322677958|gb|EFY74021.1| hypothetical protein SEEM867_01877 [Salmonella enterica subsp.
          enterica serovar Montevideo str. 366867]
 gi|322681134|gb|EFY77167.1| hypothetical protein SEEM180_20369 [Salmonella enterica subsp.
          enterica serovar Montevideo str. 413180]
 gi|322687936|gb|EFY83903.1| hypothetical protein SEEM600_16016 [Salmonella enterica subsp.
          enterica serovar Montevideo str. 446600]
 gi|322716038|gb|EFZ07609.1| UPF0350 protein ygfY [Salmonella enterica subsp. enterica serovar
          Choleraesuis str. A50]
 gi|323131403|gb|ADX18833.1| UPF0350 protein ygfY [Salmonella enterica subsp. enterica serovar
          Typhimurium str. 4/74]
 gi|323194868|gb|EFZ80055.1| hypothetical protein SEEM581_15587 [Salmonella enterica subsp.
          enterica serovar Montevideo str. 609458-1]
 gi|323196619|gb|EFZ81767.1| hypothetical protein SEEM501_20663 [Salmonella enterica subsp.
          enterica serovar Montevideo str. 556150-1]
 gi|323202681|gb|EFZ87721.1| hypothetical protein SEEM460_18430 [Salmonella enterica subsp.
          enterica serovar Montevideo str. 609460]
 gi|323207832|gb|EFZ92778.1| hypothetical protein SEEM020_18210 [Salmonella enterica subsp.
          enterica serovar Montevideo str. 507440-20]
 gi|323212616|gb|EFZ97433.1| hypothetical protein SEEM6152_10338 [Salmonella enterica subsp.
          enterica serovar Montevideo str. 556152]
 gi|323214901|gb|EFZ99649.1| hypothetical protein SEEM0077_03064 [Salmonella enterica subsp.
          enterica serovar Montevideo str. MB101509-0077]
 gi|323222632|gb|EGA06997.1| hypothetical protein SEEM0047_09315 [Salmonella enterica subsp.
          enterica serovar Montevideo str. MB102109-0047]
 gi|323225089|gb|EGA09341.1| hypothetical protein SEEM0055_02505 [Salmonella enterica subsp.
          enterica serovar Montevideo str. MB110209-0055]
 gi|323230611|gb|EGA14729.1| hypothetical protein SEEM0052_20144 [Salmonella enterica subsp.
          enterica serovar Montevideo str. MB111609-0052]
 gi|323235038|gb|EGA19124.1| hypothetical protein SEEM3312_05848 [Salmonella enterica subsp.
          enterica serovar Montevideo str. 2009083312]
 gi|323239077|gb|EGA23127.1| hypothetical protein SEEM5258_05725 [Salmonella enterica subsp.
          enterica serovar Montevideo str. 2009085258]
 gi|323244565|gb|EGA28571.1| hypothetical protein SEEM1156_01482 [Salmonella enterica subsp.
          enterica serovar Montevideo str. 315731156]
 gi|323247180|gb|EGA31146.1| hypothetical protein SEEM9199_21540 [Salmonella enterica subsp.
          enterica serovar Montevideo str. IA_2009159199]
 gi|323253337|gb|EGA37166.1| hypothetical protein SEEM8282_09691 [Salmonella enterica subsp.
          enterica serovar Montevideo str. IA_2010008282]
 gi|323256356|gb|EGA40092.1| hypothetical protein SEEM8283_12186 [Salmonella enterica subsp.
          enterica serovar Montevideo str. IA_2010008283]
 gi|323262468|gb|EGA46024.1| hypothetical protein SEEM8284_01851 [Salmonella enterica subsp.
          enterica serovar Montevideo str. IA_2010008284]
 gi|323267436|gb|EGA50920.1| hypothetical protein SEEM8285_21677 [Salmonella enterica subsp.
          enterica serovar Montevideo str. IA_2010008285]
 gi|323269160|gb|EGA52615.1| hypothetical protein SEEM8287_10727 [Salmonella enterica subsp.
          enterica serovar Montevideo str. IA_2010008287]
 gi|326624792|gb|EGE31137.1| TPR repeat protein [Salmonella enterica subsp. enterica serovar
          Dublin str. 3246]
 gi|326629085|gb|EGE35428.1| YgfY protein [Salmonella enterica subsp. enterica serovar
          Gallinarum str. 9]
 gi|332989914|gb|AEF08897.1| hypothetical protein STMUK_3035 [Salmonella enterica subsp.
          enterica serovar Typhimurium str. UK-1]
          Length = 88

 Score = 40.4 bits (93), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 34/66 (51%)

Query: 5  MNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTG 64
          M++  +  ++   RRG RE+D+ +  F +H    LS  E  +   +++ DD +LF W   
Sbjct: 1  MDIHNKARIHWACRRGMRELDISIMPFFEHEYDSLSDEEKRIFVRLLQSDDPDLFNWLMN 60

Query: 65 MEKPPE 70
            KP +
Sbjct: 61 HGKPAD 66


>gi|90416427|ref|ZP_01224358.1| hypothetical protein GB2207_04477 [marine gamma proteobacterium
          HTCC2207]
 gi|90331626|gb|EAS46854.1| hypothetical protein GB2207_04477 [marine gamma proteobacterium
          HTCC2207]
          Length = 81

 Score = 40.0 bits (92), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 32/58 (55%), Gaps = 1/58 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKP 68
          ++ + C RRG  E+DLIL  FV++F   L   +    E ++E +D +LF W    + P
Sbjct: 5  RLRWAC-RRGMLELDLILEPFVENFYETLEEADQLRFEVLLESEDQSLFMWLMKRQAP 61


>gi|296826364|ref|XP_002850964.1| early meiotic induction protein 5 [Arthroderma otae CBS 113480]
 gi|238838518|gb|EEQ28180.1| early meiotic induction protein 5 [Arthroderma otae CBS 113480]
          Length = 264

 Score = 40.0 bits (92), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 38/60 (63%), Gaps = 1/60 (1%)

Query: 11  KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
           +++Y+  +RGT E DL+L +F   ++ +++S +L   +  ++E+D +++ W T  E P E
Sbjct: 121 RLLYQSRKRGTLESDLLLSTFASTYLGKMTSSQLDEYDRFLDENDWDIYYWAT-QEAPSE 179


>gi|45190803|ref|NP_985057.1| AER200Cp [Ashbya gossypii ATCC 10895]
 gi|74693456|sp|Q756Q4|SDHF2_ASHGO RecName: Full=Succinate dehydrogenase assembly factor 2,
           mitochondrial; Short=SDH assembly factor 2; AltName:
           Full=Early meiotic induction protein 5; AltName:
           Full=Succinate dehydrogenase subunit 5, mitochondrial;
           Flags: Precursor
 gi|44983845|gb|AAS52881.1| AER200Cp [Ashbya gossypii ATCC 10895]
          Length = 160

 Score = 40.0 bits (92), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 23/93 (24%), Positives = 48/93 (51%), Gaps = 5/93 (5%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
           + +  Q  ++VY+  +RG  E DL+L  F   ++  +++ EL   + ++ E D +++ W 
Sbjct: 59  ETLEQQRARLVYQSRKRGILETDLLLSGFAAKYLKHMTAEELNEYDELLNELDWDIYYWA 118

Query: 63  T----GMEKPPEYLRTPIFKKIYDYYSNNLDRK 91
           T        P ++  + I +K+   YS N D++
Sbjct: 119 TKNSDASPLPEKWQHSKILRKL-QAYSENKDKQ 150


>gi|322710170|gb|EFZ01745.1| early meiotic induction protein 5 [Metarhizium anisopliae ARSEF 23]
          Length = 214

 Score = 40.0 bits (92), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 41/74 (55%)

Query: 1   MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
           + +N + +  +++Y+  +RGT E DL+L +F    +  +S   L   +++++E+D +++ 
Sbjct: 64  VGENDDTKRARLLYQSRKRGTLESDLLLSTFAKAHLPSMSGGLLAQYDALLDENDWDIYY 123

Query: 61  WFTGMEKPPEYLRT 74
           W T  E    Y  T
Sbjct: 124 WATQREPSDSYTST 137


>gi|322698313|gb|EFY90084.1| TPR repeat protein [Metarhizium acridum CQMa 102]
          Length = 221

 Score = 40.0 bits (92), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 41/74 (55%)

Query: 1   MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
           + +N + +  +++Y+  +RGT E DL+L +F    +  +S   L   +++++E+D +++ 
Sbjct: 65  VGENDDTKRARLLYQSRKRGTLESDLLLSTFAKAHLPSMSGGLLAQYDALLDENDWDIYY 124

Query: 61  WFTGMEKPPEYLRT 74
           W T  E    Y  T
Sbjct: 125 WATQREPSDSYTST 138


>gi|113971192|ref|YP_734985.1| hypothetical protein Shewmr4_2857 [Shewanella sp. MR-4]
 gi|114048430|ref|YP_738980.1| hypothetical protein Shewmr7_2939 [Shewanella sp. MR-7]
 gi|113885876|gb|ABI39928.1| protein of unknown function DUF339 [Shewanella sp. MR-4]
 gi|113889872|gb|ABI43923.1| protein of unknown function DUF339 [Shewanella sp. MR-7]
          Length = 79

 Score = 40.0 bits (92), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 34/60 (56%), Gaps = 1/60 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          ++ + C RRG  E+D++   FV++   +LS  +  +   ++E +D  LF WF G E  P+
Sbjct: 5  RVRWAC-RRGMLELDVLFQPFVENVYQDLSDEDKALFIRLLECEDPELFAWFMGHEACPD 63


>gi|92114273|ref|YP_574201.1| hypothetical protein Csal_2151 [Chromohalobacter salexigens DSM
          3043]
 gi|91797363|gb|ABE59502.1| protein of unknown function DUF339 [Chromohalobacter salexigens
          DSM 3043]
          Length = 92

 Score = 40.0 bits (92), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 38/68 (55%), Gaps = 4/68 (5%)

Query: 18 RRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKP--PEYLRTP 75
          RRG  E+DL+L  F++H   +L   +    +++I+++D +LF W    + P  PE  R  
Sbjct: 15 RRGMWELDLLLIPFLEHRYPQLDDADKARYQALIDQEDQDLFIWLMRRDWPSDPELRR-- 72

Query: 76 IFKKIYDY 83
          I + I DY
Sbjct: 73 IVQMIVDY 80


>gi|117921474|ref|YP_870666.1| hypothetical protein Shewana3_3035 [Shewanella sp. ANA-3]
 gi|117613806|gb|ABK49260.1| protein of unknown function DUF339 [Shewanella sp. ANA-3]
          Length = 79

 Score = 40.0 bits (92), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 34/60 (56%), Gaps = 1/60 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          ++ + C RRG  E+D++   FV++   +LS  +  +   ++E +D  LF WF G E  P+
Sbjct: 5  RVRWAC-RRGMLELDVLFQPFVENVYQDLSDDDKALFIRLLECEDPELFAWFMGHEACPD 63


>gi|157872307|ref|XP_001684702.1| hypothetical protein [Leishmania major strain Friedlin]
 gi|68127772|emb|CAJ06126.1| conserved hypothetical protein [Leishmania major strain Friedlin]
          Length = 232

 Score = 39.7 bits (91), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 50/96 (52%), Gaps = 3/96 (3%)

Query: 2   KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
           K+++  + R+++Y+   RG  EMDLI G F    +  L +  L   + ++++ DS LF+W
Sbjct: 138 KESVECKRRRLIYQSRYRGMVEMDLIFGHFARCKLETLDASMLDEYDMLLKQLDSELFRW 197

Query: 62  FT-GMEKPPEYLRTPIFKKIYDYYSNNLDRKNMLGS 96
              G++ P    +   F ++  +     +R  +LGS
Sbjct: 198 LVMGVDAPEGVAKLRCFGELRRFIKE--ERTALLGS 231


>gi|327308212|ref|XP_003238797.1| TPR repeat protein [Trichophyton rubrum CBS 118892]
 gi|326459053|gb|EGD84506.1| TPR repeat protein [Trichophyton rubrum CBS 118892]
          Length = 261

 Score = 39.7 bits (91), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 38/59 (64%), Gaps = 2/59 (3%)

Query: 11  KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPP 69
           +++Y+  +RGT E DL+L +F   ++ +++  +L   +  ++E+D +++ W T  ++PP
Sbjct: 116 RLLYQSRKRGTLESDLLLSTFASTYLAKMTGSQLDEYDRFLDENDWDIYYWAT--QEPP 172


>gi|325117486|emb|CBZ53038.1| hypothetical protein NCLIV_028270 [Neospora caninum Liverpool]
          Length = 89

 Score = 39.7 bits (91), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 42/85 (49%), Gaps = 5/85 (5%)

Query: 13 VYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGME-----K 67
          +YR  +RG  E+DL+LG++ D  +  +S  E+  LE I+  ++  L+    G +      
Sbjct: 1  MYRAKQRGWVELDLLLGAYCDQAVPTMSPGEVEELEQILAAENVVLYDCLIGKDWKRAPA 60

Query: 68 PPEYLRTPIFKKIYDYYSNNLDRKN 92
          P ++     +KK+  +    L + N
Sbjct: 61 PAQFAELSQWKKLSAFVEARLPQPN 85


>gi|323143172|ref|ZP_08077869.1| TPR repeat region [Succinatimonas hippei YIT 12066]
 gi|322417059|gb|EFY07696.1| TPR repeat region [Succinatimonas hippei YIT 12066]
          Length = 89

 Score = 39.7 bits (91), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 35/76 (46%)

Query: 18 RRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPEYLRTPIF 77
          RRG RE+DL+L  FV+H +  +    +     +++  D  LF+W  G  +P    R  + 
Sbjct: 14 RRGMRELDLMLLPFVEHDLPNMDEAAVDAYIDLLKATDLELFRWLHGSAEPDSKSRKDMI 73

Query: 78 KKIYDYYSNNLDRKNM 93
            I   +     R+ +
Sbjct: 74 ATIIKCHEGRKGREGV 89


>gi|332532644|ref|ZP_08408520.1| protein YgfY [Pseudoalteromonas haloplanktis ANT/505]
 gi|332037860|gb|EGI74309.1| protein YgfY [Pseudoalteromonas haloplanktis ANT/505]
          Length = 83

 Score = 39.7 bits (91), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 34/57 (59%), Gaps = 1/57 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEK 67
          +I + C RRG  E+D++   FV+     LS+ +  + + ++ E+D +LF WF G E+
Sbjct: 9  RIRWAC-RRGMLELDVLFMPFVEEAYDSLSAEQQAIFQRLLTEEDPDLFAWFMGHEE 64


>gi|258567462|ref|XP_002584475.1| early meiotic induction protein 5 [Uncinocarpus reesii 1704]
 gi|237905921|gb|EEP80322.1| early meiotic induction protein 5 [Uncinocarpus reesii 1704]
          Length = 574

 Score = 39.7 bits (91), Expect = 0.14,   Method: Composition-based stats.
 Identities = 18/59 (30%), Positives = 36/59 (61%), Gaps = 2/59 (3%)

Query: 11  KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPP 69
           +++Y+  +RGT E DL+L +F    +  +S  EL   +  ++E+D +++ W T  ++PP
Sbjct: 423 RLLYQSRKRGTLESDLLLSTFAATNLSTMSKSELEEYDRFLDENDWDIYYWAT--QEPP 479


>gi|157374278|ref|YP_001472878.1| hypothetical protein Ssed_1139 [Shewanella sediminis HAW-EB3]
 gi|157316652|gb|ABV35750.1| protein of unknown function DUF339 [Shewanella sediminis HAW-EB3]
          Length = 83

 Score = 39.7 bits (91), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 35/60 (58%), Gaps = 1/60 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          ++ + C RRG  E+D++   FV+    +LS+ +  +   ++E +D  LF WF G E+ P+
Sbjct: 9  RVRWAC-RRGMLELDVLFQPFVESQYEQLSTKDKNIFVRLLEGEDPELFAWFMGHEQCPD 67


>gi|332305551|ref|YP_004433402.1| hypothetical protein Glaag_1173 [Glaciecola agarilytica
          4H-3-7+YE-5]
 gi|332172880|gb|AEE22134.1| protein of unknown function DUF339 [Glaciecola agarilytica
          4H-3-7+YE-5]
          Length = 83

 Score = 39.7 bits (91), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 34/66 (51%), Gaps = 4/66 (6%)

Query: 18 RRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPEYLRTPIF 77
          RRG  E+D+I   FV+    +LS  +    ES++  DD +L+ WF G +          +
Sbjct: 15 RRGMLELDVIFMPFVEEGFNDLSEADKLTFESLLTCDDPDLYAWFMGHQP----CHNAQY 70

Query: 78 KKIYDY 83
          K+I D+
Sbjct: 71 KRIIDH 76


>gi|332992342|gb|AEF02397.1| hypothetical protein ambt_04235 [Alteromonas sp. SN2]
          Length = 85

 Score = 39.7 bits (91), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 32/57 (56%), Gaps = 1/57 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEK 67
          ++ + C RRG  E+D++L  FVD     L   +  + E ++  DD +LF WF G ++
Sbjct: 9  RLKWAC-RRGMLELDVLLMPFVDEAFDSLDYEQQEIFERLLTSDDPDLFAWFMGHQQ 64


>gi|308198174|ref|XP_001387124.2| predicted protein [Scheffersomyces stipitis CBS 6054]
 gi|257096795|sp|A3GHR8|SDHF2_PICST RecName: Full=Succinate dehydrogenase assembly factor 2,
           mitochondrial; Short=SDH assembly factor 2; AltName:
           Full=Early meiotic induction protein 5; AltName:
           Full=Succinate dehydrogenase subunit 5, mitochondrial;
           Flags: Precursor
 gi|149389066|gb|EAZ63101.2| predicted protein [Pichia stipitis CBS 6054]
          Length = 149

 Score = 39.7 bits (91), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 16/61 (26%), Positives = 35/61 (57%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
           + M ++  +++Y+  +RG  E DL+L  F   ++ E +  EL   + +++E D +++ W 
Sbjct: 46  ETMEIKRARLIYQSRKRGILESDLLLSRFAKKYLNEFTEAELDEYDRLLDEPDWDIYYWA 105

Query: 63  T 63
           T
Sbjct: 106 T 106


>gi|195149508|ref|XP_002015699.1| GL10881 [Drosophila persimilis]
 gi|257096751|sp|B4GDB3|SDF2A_DROPE RecName: Full=Succinate dehydrogenase assembly factor 2-A,
           mitochondrial; Short=SDH assembly factor 2-A; AltName:
           Full=Succinate dehydrogenase subunit 5-A, mitochondrial;
           Flags: Precursor
 gi|194109546|gb|EDW31589.1| GL10881 [Drosophila persimilis]
          Length = 160

 Score = 39.7 bits (91), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 23/90 (25%), Positives = 49/90 (54%), Gaps = 4/90 (4%)

Query: 1   MKKNMNLQCRK--IVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIE--EDDS 56
           ++ N  L+ RK  ++Y+  +RG  E DL+L +F   ++ + S+ +  + + +I    +D 
Sbjct: 58  VRPNEPLETRKQRLLYQSRKRGMLENDLLLSTFAAKYLKDFSAEQTAIYDQLINGVSNDW 117

Query: 57  NLFKWFTGMEKPPEYLRTPIFKKIYDYYSN 86
           +++ W T ++  PE   T I K + ++  N
Sbjct: 118 DIYYWATEVKPTPEEYNTEIMKLLKEHVKN 147


>gi|296112888|ref|YP_003626826.1| hypothetical protein MCR_0664 [Moraxella catarrhalis RH4]
 gi|295920582|gb|ADG60933.1| conserved hypothetical protein [Moraxella catarrhalis RH4]
 gi|326561119|gb|EGE11484.1| hypothetical protein E9G_04719 [Moraxella catarrhalis 7169]
 gi|326564449|gb|EGE14676.1| hypothetical protein E9K_04357 [Moraxella catarrhalis 103P14B1]
 gi|326564575|gb|EGE14800.1| hypothetical protein E9O_06271 [Moraxella catarrhalis 12P80B1]
 gi|326567579|gb|EGE17694.1| hypothetical protein E9Q_06788 [Moraxella catarrhalis BC1]
 gi|326569427|gb|EGE19487.1| hypothetical protein E9U_07301 [Moraxella catarrhalis BC8]
 gi|326575342|gb|EGE25270.1| hypothetical protein E9W_05118 [Moraxella catarrhalis CO72]
 gi|326576573|gb|EGE26480.1| hypothetical protein E9Y_01115 [Moraxella catarrhalis 101P30B1]
          Length = 88

 Score = 39.3 bits (90), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 33/61 (54%), Gaps = 1/61 (1%)

Query: 10 RKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPP 69
          R+I+Y+  RRG +E+D  +  +V    L   + E    E+++  +D +L  +F G E P 
Sbjct: 10 RRIIYQA-RRGLKELDFYIDYYVKSHYLSADADEQQAFETLLSYEDPDLLVFFLGQETPS 68

Query: 70 E 70
          E
Sbjct: 69 E 69


>gi|198456280|ref|XP_002138209.1| GA24523 [Drosophila pseudoobscura pseudoobscura]
 gi|257096762|sp|B5DZ31|SDF2B_DROPS RecName: Full=Succinate dehydrogenase assembly factor 2-B,
           mitochondrial; Short=SDH assembly factor 2-B; AltName:
           Full=Succinate dehydrogenase subunit 5-B, mitochondrial;
           Flags: Precursor
 gi|198135557|gb|EDY68767.1| GA24523 [Drosophila pseudoobscura pseudoobscura]
          Length = 160

 Score = 39.3 bits (90), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 23/90 (25%), Positives = 49/90 (54%), Gaps = 4/90 (4%)

Query: 1   MKKNMNLQCRK--IVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIE--EDDS 56
           ++ N  L+ RK  ++Y+  +RG  E DL+L +F   ++ + S+ +  + + +I    +D 
Sbjct: 58  VRPNEPLETRKQRLLYQSRKRGMLENDLLLSTFAAKYLKDFSAEQTAIYDQLINGVSNDW 117

Query: 57  NLFKWFTGMEKPPEYLRTPIFKKIYDYYSN 86
           +++ W T ++  PE   T I K + ++  N
Sbjct: 118 DIYYWATEVKPTPEEYNTEIMKLLKEHVKN 147


>gi|61680288|pdb|1X6I|A Chain A, Crystal Structure Of Ygfy From Escherichia Coli
 gi|61680289|pdb|1X6I|B Chain B, Crystal Structure Of Ygfy From Escherichia Coli
 gi|61680290|pdb|1X6J|A Chain A, Crystal Structure Of Ygfy From Escherichia Coli
          Length = 91

 Score = 39.3 bits (90), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 35/67 (52%)

Query: 4  NMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFT 63
          +M++  +  ++   RRG RE+D+ +  F +H    LS  E  +   ++E DD +LF W  
Sbjct: 3  HMDINNKARIHWACRRGMRELDISIMPFFEHEYDSLSDDEKRIFIRLLECDDPDLFNWLM 62

Query: 64 GMEKPPE 70
             KP +
Sbjct: 63 NHGKPAD 69


>gi|323183451|gb|EFZ68848.1| hypothetical protein ECOK1357_3230 [Escherichia coli 1357]
          Length = 88

 Score = 39.3 bits (90), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 34/66 (51%)

Query: 5  MNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTG 64
          M++  +  ++   RRG RE+D+ +  F +H    LS  E  +   ++E DD +LF W   
Sbjct: 1  MDINNKARIHWACRRGMRELDISIMPFFEHEYDSLSDDEKRIFVRLLECDDPDLFNWLMN 60

Query: 65 MEKPPE 70
            KP +
Sbjct: 61 HGKPAD 66


>gi|270156717|ref|ZP_06185374.1| conserved domain protein [Legionella longbeachae D-4968]
 gi|289164836|ref|YP_003454974.1| hypothetical protein LLO_1502 [Legionella longbeachae NSW150]
 gi|269988742|gb|EEZ94996.1| conserved domain protein [Legionella longbeachae D-4968]
 gi|288858009|emb|CBJ11869.1| hypothetical protein LLO_1502 [Legionella longbeachae NSW150]
          Length = 81

 Score = 39.3 bits (90), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 35/65 (53%), Gaps = 1/65 (1%)

Query: 6  NLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGM 65
          N +  ++ + C RRG  E+DLIL  F++  +  +S  EL    +++   D  LF W  G 
Sbjct: 4  NQEKARLAWHC-RRGMLELDLILQRFLEKHLDFISRDELEAFNNLLSCTDPELFAWLMGH 62

Query: 66 EKPPE 70
          ++P E
Sbjct: 63 DEPQE 67


>gi|195381775|ref|XP_002049620.1| GJ20655 [Drosophila virilis]
 gi|194144417|gb|EDW60813.1| GJ20655 [Drosophila virilis]
          Length = 319

 Score = 39.3 bits (90), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 19/79 (24%), Positives = 42/79 (53%), Gaps = 2/79 (2%)

Query: 10  RKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIE--EDDSNLFKWFTGMEK 67
           ++++Y+  +RG  E DL+L +F   ++    + +  + + +I    +D +++ W TG++ 
Sbjct: 223 QRLLYQSRKRGMLENDLLLSTFAHKYLKNFDAKQTAIYDELINGVSNDWDIYYWATGVKP 282

Query: 68  PPEYLRTPIFKKIYDYYSN 86
            PE   T I K +  +  N
Sbjct: 283 TPEQYETEIMKLLKQHVKN 301


>gi|312220770|emb|CBY00711.1| similar to TPR repeat protein [Leptosphaeria maculans]
          Length = 318

 Score = 39.3 bits (90), Expect = 0.17,   Method: Composition-based stats.
 Identities = 18/69 (26%), Positives = 37/69 (53%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
           ++ N    +++Y+  +RGT E DL+L +F D  +  +S   L   +  ++E+D +++ W 
Sbjct: 145 EDANTMRARLLYQSRKRGTLESDLLLSTFADAHLSTMSVTVLEQYDLFLDENDWDIYYWA 204

Query: 63  TGMEKPPEY 71
           T    P  +
Sbjct: 205 TQEPTPTSH 213


>gi|270264910|ref|ZP_06193174.1| hypothetical protein SOD_j01260 [Serratia odorifera 4Rx13]
 gi|270041208|gb|EFA14308.1| hypothetical protein SOD_j01260 [Serratia odorifera 4Rx13]
          Length = 88

 Score = 39.3 bits (90), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 17/64 (26%), Positives = 33/64 (51%)

Query: 5  MNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTG 64
          M++  +  ++   RRG RE+D+ +  F +H   +L+  +  +   ++E DD +LF W   
Sbjct: 1  MDINNKARIHWACRRGMRELDISIMPFFEHEYDQLNDTDKALFIRLLESDDPDLFNWLMN 60

Query: 65 MEKP 68
             P
Sbjct: 61 HGAP 64


>gi|321478706|gb|EFX89663.1| hypothetical protein DAPPUDRAFT_40617 [Daphnia pulex]
          Length = 108

 Score = 39.3 bits (90), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 20/82 (24%), Positives = 44/82 (53%), Gaps = 2/82 (2%)

Query: 7  LQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIE--EDDSNLFKWFTG 64
          L+  +++Y+  +RG  E  LIL +F   ++  +S  ++++ + +I    +D +++ W TG
Sbjct: 14 LKKARLMYQSRKRGMLENGLILSTFASRYLDGMSDDQMSLYDRLINLPSNDWDIYYWATG 73

Query: 65 MEKPPEYLRTPIFKKIYDYYSN 86
          + + PE     I   + D+  N
Sbjct: 74 VRETPEEFNNEIMNLLKDHVKN 95


>gi|255947182|ref|XP_002564358.1| Pc22g03150 [Penicillium chrysogenum Wisconsin 54-1255]
 gi|257096775|sp|B6HRA4|SDHF2_PENCW RecName: Full=Succinate dehydrogenase assembly factor 2,
           mitochondrial; Short=SDH assembly factor 2; AltName:
           Full=Early meiotic induction protein 5; AltName:
           Full=Succinate dehydrogenase subunit 5, mitochondrial;
           Flags: Precursor
 gi|211591375|emb|CAP97603.1| Pc22g03150 [Penicillium chrysogenum Wisconsin 54-1255]
          Length = 310

 Score = 39.3 bits (90), Expect = 0.19,   Method: Composition-based stats.
 Identities = 17/60 (28%), Positives = 38/60 (63%), Gaps = 1/60 (1%)

Query: 11  KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
           +++Y+  +RG  E DL+L +F D ++ +++  +L   +S ++E+D +++ W T  + P E
Sbjct: 148 RLLYQSRKRGILESDLLLSTFADVYLGKMNYDQLVEYDSFLDENDWDIYYWAT-QDSPEE 206


>gi|320581059|gb|EFW95281.1| Succinate dehydrogenase assembly factor 2 [Pichia angusta DL-1]
          Length = 120

 Score = 39.3 bits (90), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 33/54 (61%)

Query: 10 RKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFT 63
          R+++Y+  +RG  E DL+L  F D ++  ++  EL   + +++E D +++ W T
Sbjct: 28 RRLLYQSRKRGILESDLLLSRFADKYLDTMTPSELEEYDKLLDEPDWDIYYWAT 81


>gi|237729837|ref|ZP_04560318.1| conserved hypothetical protein [Citrobacter sp. 30_2]
 gi|226908443|gb|EEH94361.1| conserved hypothetical protein [Citrobacter sp. 30_2]
          Length = 88

 Score = 39.3 bits (90), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 34/66 (51%)

Query: 5  MNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTG 64
          M++  +  ++   RRG RE+D+ +  F +H    LS  E  +   ++E DD +LF W   
Sbjct: 1  MDINNKARIHWACRRGMRELDISIMPFFEHEYDSLSDEEKRIFIRLLECDDPDLFNWLMN 60

Query: 65 MEKPPE 70
            KP +
Sbjct: 61 HGKPAD 66


>gi|146093692|ref|XP_001466957.1| hypothetical protein [Leishmania infantum JPCM5]
 gi|134071321|emb|CAM70007.1| conserved hypothetical protein [Leishmania infantum JPCM5]
          Length = 233

 Score = 39.3 bits (90), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 49/94 (52%), Gaps = 5/94 (5%)

Query: 6   NLQC--RKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFT 63
           +++C  R+++Y+   RG  EMDLI G F    +  L +  L   + ++++ DS LF+W  
Sbjct: 141 SVECKRRRLIYQSRYRGMVEMDLIFGHFARCKLETLDASMLDEYDVLLKQLDSELFRWLV 200

Query: 64  -GMEKPPEYLRTPIFKKIYDYYSNNLDRKNMLGS 96
            G++ P    +   F ++  +     +R  +LGS
Sbjct: 201 MGVDAPEGVAKLRCFDELRRFIKE--ERTELLGS 232


>gi|315054925|ref|XP_003176837.1| early meiotic induction protein 5 [Arthroderma gypseum CBS 118893]
 gi|311338683|gb|EFQ97885.1| early meiotic induction protein 5 [Arthroderma gypseum CBS 118893]
          Length = 261

 Score = 39.3 bits (90), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 38/59 (64%), Gaps = 2/59 (3%)

Query: 11  KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPP 69
           +++Y+  +RGT E DL+L +F   ++ +++  +L   +  ++E+D +++ W T  ++PP
Sbjct: 116 RLLYQSRKRGTLESDLLLSTFASTYLGKMTGSQLDEYDRFLDENDWDIYYWAT--QEPP 172


>gi|119471896|ref|ZP_01614204.1| hypothetical protein ATW7_04659 [Alteromonadales bacterium TW-7]
 gi|119445269|gb|EAW26559.1| hypothetical protein ATW7_04659 [Alteromonadales bacterium TW-7]
          Length = 83

 Score = 39.3 bits (90), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 34/57 (59%), Gaps = 1/57 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEK 67
          +I + C RRG  E+D++   FV+     L++ +  + + ++ ++D +LF WF G EK
Sbjct: 9  RIRWAC-RRGMLELDVLFMPFVEEAYDSLNAEQQAIFQRLLTQEDPDLFAWFMGHEK 64


>gi|304413500|ref|ZP_07394973.1| hypothetical protein REG_0578 [Candidatus Regiella insecticola
          LSR1]
 gi|304284343|gb|EFL92736.1| hypothetical protein REG_0578 [Candidatus Regiella insecticola
          LSR1]
          Length = 93

 Score = 38.9 bits (89), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 18/68 (26%), Positives = 37/68 (54%)

Query: 3  KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
          +N+ +  +  VY   RRG RE+D+++  F ++    LS+ +  +   +++ DD +LF W 
Sbjct: 4  QNVKIDNKARVYWACRRGMRELDIVIMPFFEYEYETLSNDDKGLFMRLLKSDDPDLFNWL 63

Query: 63 TGMEKPPE 70
              +P +
Sbjct: 64 MNYGEPQD 71


>gi|50290339|ref|XP_447601.1| hypothetical protein [Candida glabrata CBS 138]
 gi|74609509|sp|Q6FQ93|SDHF2_CANGA RecName: Full=Succinate dehydrogenase assembly factor 2,
           mitochondrial; Short=SDH assembly factor 2; AltName:
           Full=Early meiotic induction protein 5; AltName:
           Full=Succinate dehydrogenase subunit 5, mitochondrial;
           Flags: Precursor
 gi|49526911|emb|CAG60538.1| unnamed protein product [Candida glabrata]
          Length = 153

 Score = 38.9 bits (89), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 42/80 (52%), Gaps = 4/80 (5%)

Query: 11  KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEK--- 67
           +++Y+  +RG  E DL+L  F    +  +++ EL   ++++ E D +++ W T   K   
Sbjct: 60  RLIYQSRKRGILETDLLLSGFAAKHLRSMTNEELDEYDALLNELDWDIYYWVTKNYKTSP 119

Query: 68  -PPEYLRTPIFKKIYDYYSN 86
            P  +  + I KK+ D+  N
Sbjct: 120 VPERWKNSEILKKLQDFSEN 139


>gi|24114151|ref|NP_708661.1| hypothetical protein SF2883 [Shigella flexneri 2a str. 301]
 gi|110806800|ref|YP_690320.1| hypothetical protein SFV_2945 [Shigella flexneri 5 str. 8401]
 gi|33301883|sp|Q83JU2|YGFY_SHIFL RecName: Full=UPF0350 protein ygfY
 gi|24053291|gb|AAN44368.1| orf, conserved hypothetical protein [Shigella flexneri 2a str.
          301]
 gi|110616348|gb|ABF05015.1| conserved hypothetical protein [Shigella flexneri 5 str. 8401]
 gi|313647937|gb|EFS12383.1| hypothetical protein SF2457T_3535 [Shigella flexneri 2a str.
          2457T]
 gi|332752934|gb|EGJ83318.1| hypothetical protein SF434370_3112 [Shigella flexneri 4343-70]
 gi|332754705|gb|EGJ85071.1| hypothetical protein SF274771_3474 [Shigella flexneri 2747-71]
 gi|332765828|gb|EGJ96041.1| hypothetical protein SF293071_3386 [Shigella flexneri 2930-71]
 gi|332999670|gb|EGK19255.1| hypothetical protein SFVA6_3817 [Shigella flexneri VA-6]
 gi|332999947|gb|EGK19530.1| hypothetical protein SFK218_3892 [Shigella flexneri K-218]
 gi|333000716|gb|EGK20291.1| hypothetical protein SFK272_3653 [Shigella flexneri K-272]
 gi|333015228|gb|EGK34570.1| hypothetical protein SFK227_3684 [Shigella flexneri K-227]
          Length = 88

 Score = 38.9 bits (89), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 34/66 (51%)

Query: 5  MNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTG 64
          M++  +  ++   RRG RE+D+ +  F +H    LS  E  +   ++E DD +LF W   
Sbjct: 1  MDINNKARIHWACRRGMRELDISIMPFFEHEYDSLSDDEKRIFIRLLECDDPDLFNWLMN 60

Query: 65 MEKPPE 70
            KP +
Sbjct: 61 HGKPAD 66


>gi|15803433|ref|NP_289466.1| hypothetical protein Z4235 [Escherichia coli O157:H7 EDL933]
 gi|15833023|ref|NP_311796.1| hypothetical protein ECs3769 [Escherichia coli O157:H7 str.
          Sakai]
 gi|16130799|ref|NP_417373.1| conserved protein [Escherichia coli str. K-12 substr. MG1655]
 gi|26249312|ref|NP_755352.1| hypothetical protein c3477 [Escherichia coli CFT073]
 gi|30064209|ref|NP_838380.1| hypothetical protein S3082 [Shigella flexneri 2a str. 2457T]
 gi|74313455|ref|YP_311874.1| hypothetical protein SSON_3050 [Shigella sonnei Ss046]
 gi|82545480|ref|YP_409427.1| hypothetical protein SBO_3095 [Shigella boydii Sb227]
 gi|82778337|ref|YP_404686.1| hypothetical protein SDY_3185 [Shigella dysenteriae Sd197]
 gi|89109676|ref|AP_003456.1| hypothetical protein [Escherichia coli str. K-12 substr. W3110]
 gi|91212275|ref|YP_542261.1| hypothetical protein UTI89_C3282 [Escherichia coli UTI89]
 gi|110643045|ref|YP_670775.1| hypothetical protein ECP_2890 [Escherichia coli 536]
 gi|117625128|ref|YP_854116.1| hypothetical protein APECO1_3630 [Escherichia coli APEC O1]
 gi|157157949|ref|YP_001464234.1| hypothetical protein EcE24377A_3223 [Escherichia coli E24377A]
 gi|168747624|ref|ZP_02772646.1| TPR repeat protein [Escherichia coli O157:H7 str. EC4113]
 gi|168753835|ref|ZP_02778842.1| TPR repeat protein [Escherichia coli O157:H7 str. EC4401]
 gi|168760025|ref|ZP_02785032.1| TPR repeat protein [Escherichia coli O157:H7 str. EC4501]
 gi|168766890|ref|ZP_02791897.1| TPR repeat protein [Escherichia coli O157:H7 str. EC4486]
 gi|168775774|ref|ZP_02800781.1| TPR repeat protein [Escherichia coli O157:H7 str. EC4196]
 gi|168778910|ref|ZP_02803917.1| TPR repeat protein [Escherichia coli O157:H7 str. EC4076]
 gi|168785743|ref|ZP_02810750.1| TPR repeat protein [Escherichia coli O157:H7 str. EC869]
 gi|168800030|ref|ZP_02825037.1| TPR repeat protein [Escherichia coli O157:H7 str. EC508]
 gi|170018857|ref|YP_001723811.1| hypothetical protein EcolC_0812 [Escherichia coli ATCC 8739]
 gi|170082458|ref|YP_001731778.1| hypothetical protein ECDH10B_3071 [Escherichia coli str. K-12
          substr. DH10B]
 gi|170679885|ref|YP_001745050.1| hypothetical protein EcSMS35_3030 [Escherichia coli SMS-3-5]
 gi|170765739|ref|ZP_02900550.1| TPR repeat protein [Escherichia albertii TW07627]
 gi|187732511|ref|YP_001881666.1| hypothetical protein SbBS512_E3317 [Shigella boydii CDC 3083-94]
 gi|188495995|ref|ZP_03003265.1| TPR repeat protein [Escherichia coli 53638]
 gi|191166001|ref|ZP_03027837.1| TPR repeat protein [Escherichia coli B7A]
 gi|191173258|ref|ZP_03034789.1| TPR repeat protein [Escherichia coli F11]
 gi|193063569|ref|ZP_03044658.1| TPR repeat protein [Escherichia coli E22]
 gi|193070555|ref|ZP_03051494.1| TPR repeat protein [Escherichia coli E110019]
 gi|194426186|ref|ZP_03058741.1| TPR repeat protein [Escherichia coli B171]
 gi|194431723|ref|ZP_03064014.1| TPR repeat protein [Shigella dysenteriae 1012]
 gi|194436860|ref|ZP_03068960.1| TPR repeat protein [Escherichia coli 101-1]
 gi|195936515|ref|ZP_03081897.1| hypothetical protein EscherichcoliO157_08637 [Escherichia coli
          O157:H7 str. EC4024]
 gi|208806447|ref|ZP_03248784.1| TPR repeat protein [Escherichia coli O157:H7 str. EC4206]
 gi|208811923|ref|ZP_03253252.1| TPR repeat protein [Escherichia coli O157:H7 str. EC4045]
 gi|208820745|ref|ZP_03261065.1| TPR repeat protein [Escherichia coli O157:H7 str. EC4042]
 gi|209397339|ref|YP_002272371.1| TPR repeat protein [Escherichia coli O157:H7 str. EC4115]
 gi|209920351|ref|YP_002294435.1| hypothetical protein ECSE_3160 [Escherichia coli SE11]
 gi|215488197|ref|YP_002330628.1| hypothetical protein E2348C_3150 [Escherichia coli O127:H6 str.
          E2348/69]
 gi|217327300|ref|ZP_03443383.1| TPR repeat protein [Escherichia coli O157:H7 str. TW14588]
 gi|218550144|ref|YP_002383935.1| hypothetical protein EFER_2832 [Escherichia fergusonii ATCC
          35469]
 gi|218555445|ref|YP_002388358.1| hypothetical protein ECIAI1_3016 [Escherichia coli IAI1]
 gi|218559890|ref|YP_002392803.1| hypothetical protein ECS88_3177 [Escherichia coli S88]
 gi|218691022|ref|YP_002399234.1| hypothetical protein ECED1_3356 [Escherichia coli ED1a]
 gi|218696492|ref|YP_002404159.1| hypothetical protein EC55989_3183 [Escherichia coli 55989]
 gi|218701606|ref|YP_002409235.1| hypothetical protein ECIAI39_3313 [Escherichia coli IAI39]
 gi|218706403|ref|YP_002413922.1| hypothetical protein ECUMN_3239 [Escherichia coli UMN026]
 gi|227888446|ref|ZP_04006251.1| protein of hypothetical function DUF339 [Escherichia coli 83972]
 gi|237706458|ref|ZP_04536939.1| ygfY [Escherichia sp. 3_2_53FAA]
 gi|238902022|ref|YP_002927818.1| hypothetical protein BWG_2622 [Escherichia coli BW2952]
 gi|253772262|ref|YP_003035093.1| hypothetical protein ECBD_0840 [Escherichia coli
          'BL21-Gold(DE3)pLysS AG']
 gi|254037942|ref|ZP_04872000.1| TPR repeat protein [Escherichia sp. 1_1_43]
 gi|254162809|ref|YP_003045917.1| hypothetical protein ECB_02729 [Escherichia coli B str. REL606]
 gi|254794847|ref|YP_003079684.1| hypothetical protein ECSP_3865 [Escherichia coli O157:H7 str.
          TW14359]
 gi|256019305|ref|ZP_05433170.1| hypothetical protein ShiD9_10336 [Shigella sp. D9]
 gi|256024593|ref|ZP_05438458.1| hypothetical protein E4_14544 [Escherichia sp. 4_1_40B]
 gi|260845565|ref|YP_003223343.1| hypothetical protein ECO103_3472 [Escherichia coli O103:H2 str.
          12009]
 gi|260857020|ref|YP_003230911.1| hypothetical protein ECO26_3986 [Escherichia coli O26:H11 str.
          11368]
 gi|260869574|ref|YP_003235976.1| hypothetical protein ECO111_3635 [Escherichia coli O111:H- str.
          11128]
 gi|261226210|ref|ZP_05940491.1| hypothetical protein EscherichiacoliO157_16668 [Escherichia coli
          O157:H7 str. FRIK2000]
 gi|261256535|ref|ZP_05949068.1| hypothetical protein EscherichiacoliO157EcO_11956 [Escherichia
          coli O157:H7 str. FRIK966]
 gi|291284216|ref|YP_003501034.1| hypothetical protein G2583_3550 [Escherichia coli O55:H7 str.
          CB9615]
 gi|293406396|ref|ZP_06650322.1| hypothetical protein ECGG_01692 [Escherichia coli FVEC1412]
 gi|293412256|ref|ZP_06654979.1| hypothetical protein ECEG_02261 [Escherichia coli B354]
 gi|293416150|ref|ZP_06658790.1| ygfY protein [Escherichia coli B185]
 gi|293449219|ref|ZP_06663640.1| hypothetical protein ECCG_02249 [Escherichia coli B088]
 gi|297518189|ref|ZP_06936575.1| hypothetical protein EcolOP_11161 [Escherichia coli OP50]
 gi|298382132|ref|ZP_06991729.1| hypothetical protein ECFG_01877 [Escherichia coli FVEC1302]
 gi|301027410|ref|ZP_07190747.1| TPR repeat region protein [Escherichia coli MS 69-1]
 gi|301027805|ref|ZP_07191110.1| TPR repeat region [Escherichia coli MS 196-1]
 gi|306812201|ref|ZP_07446399.1| hypothetical protein ECNC101_09819 [Escherichia coli NC101]
 gi|307139584|ref|ZP_07498940.1| hypothetical protein EcolH7_15849 [Escherichia coli H736]
 gi|307310484|ref|ZP_07590132.1| protein of unknown function DUF339 [Escherichia coli W]
 gi|309785296|ref|ZP_07679927.1| conserved hypothetical protein [Shigella dysenteriae 1617]
 gi|312964843|ref|ZP_07779083.1| conserved hypothetical protein [Escherichia coli 2362-75]
 gi|312972861|ref|ZP_07787034.1| conserved hypothetical protein [Escherichia coli 1827-70]
 gi|331643587|ref|ZP_08344718.1| putative cytoplasmic protein [Escherichia coli H736]
 gi|331654395|ref|ZP_08355395.1| putative cytoplasmic protein [Escherichia coli M718]
 gi|331659027|ref|ZP_08359969.1| putative cytoplasmic protein [Escherichia coli TA206]
 gi|331664470|ref|ZP_08365376.1| putative cytoplasmic protein [Escherichia coli TA143]
 gi|331669632|ref|ZP_08370478.1| putative cytoplasmic protein [Escherichia coli TA271]
 gi|331674382|ref|ZP_08375142.1| putative cytoplasmic protein [Escherichia coli TA280]
 gi|331678884|ref|ZP_08379558.1| putative cytoplasmic protein [Escherichia coli H591]
 gi|331684523|ref|ZP_08385115.1| putative cytoplasmic protein [Escherichia coli H299]
 gi|332280418|ref|ZP_08392831.1| conserved hypothetical protein [Shigella sp. D9]
 gi|54040231|sp|P64560|YGFY_ECOL6 RecName: Full=UPF0350 protein ygfY
 gi|54040232|sp|P64561|YGFY_ECO57 RecName: Full=UPF0350 protein ygfY
 gi|54042398|sp|P64559|YGFY_ECOLI RecName: Full=UPF0350 protein ygfY
 gi|12517425|gb|AAG58025.1|AE005520_3 orf, hypothetical protein [Escherichia coli O157:H7 str. EDL933]
 gi|26109720|gb|AAN81925.1|AE016766_13 Hypothetical protein ygfY [Escherichia coli CFT073]
 gi|887847|gb|AAA83078.1| ORF_f88 [Escherichia coli]
 gi|1789264|gb|AAC75935.1| conserved protein [Escherichia coli str. K-12 substr. MG1655]
 gi|13363241|dbj|BAB37192.1| hypothetical protein [Escherichia coli O157:H7 str. Sakai]
 gi|30042466|gb|AAP18190.1| hypothetical protein S3082 [Shigella flexneri 2a str. 2457T]
 gi|73856932|gb|AAZ89639.1| conserved hypothetical protein [Shigella sonnei Ss046]
 gi|81242485|gb|ABB63195.1| conserved hypothetical protein [Shigella dysenteriae Sd197]
 gi|81246891|gb|ABB67599.1| conserved hypothetical protein [Shigella boydii Sb227]
 gi|85675709|dbj|BAE76962.1| conserved hypothetical protein [Escherichia coli str. K12 substr.
          W3110]
 gi|91073849|gb|ABE08730.1| hypothetical protein UTI89_C3282 [Escherichia coli UTI89]
 gi|110344637|gb|ABG70874.1| putative cytoplasmic protein [Escherichia coli 536]
 gi|115514252|gb|ABJ02327.1| conserved hypothetical protein [Escherichia coli APEC O1]
 gi|157079979|gb|ABV19687.1| TPR repeat protein [Escherichia coli E24377A]
 gi|169753785|gb|ACA76484.1| protein of unknown function DUF339 [Escherichia coli ATCC 8739]
 gi|169890293|gb|ACB04000.1| conserved protein [Escherichia coli str. K-12 substr. DH10B]
 gi|170124885|gb|EDS93816.1| TPR repeat protein [Escherichia albertii TW07627]
 gi|170517603|gb|ACB15781.1| TPR repeat protein [Escherichia coli SMS-3-5]
 gi|187429503|gb|ACD08777.1| TPR repeat protein [Shigella boydii CDC 3083-94]
 gi|187768798|gb|EDU32642.1| TPR repeat protein [Escherichia coli O157:H7 str. EC4196]
 gi|188017748|gb|EDU55870.1| TPR repeat protein [Escherichia coli O157:H7 str. EC4113]
 gi|188491194|gb|EDU66297.1| TPR repeat protein [Escherichia coli 53638]
 gi|189003162|gb|EDU72148.1| TPR repeat protein [Escherichia coli O157:H7 str. EC4076]
 gi|189358708|gb|EDU77127.1| TPR repeat protein [Escherichia coli O157:H7 str. EC4401]
 gi|189363659|gb|EDU82078.1| TPR repeat protein [Escherichia coli O157:H7 str. EC4486]
 gi|189369361|gb|EDU87777.1| TPR repeat protein [Escherichia coli O157:H7 str. EC4501]
 gi|189373927|gb|EDU92343.1| TPR repeat protein [Escherichia coli O157:H7 str. EC869]
 gi|189377651|gb|EDU96067.1| TPR repeat protein [Escherichia coli O157:H7 str. EC508]
 gi|190903949|gb|EDV63662.1| TPR repeat protein [Escherichia coli B7A]
 gi|190906509|gb|EDV66117.1| TPR repeat protein [Escherichia coli F11]
 gi|192930846|gb|EDV83451.1| TPR repeat protein [Escherichia coli E22]
 gi|192956138|gb|EDV86602.1| TPR repeat protein [Escherichia coli E110019]
 gi|194415494|gb|EDX31761.1| TPR repeat protein [Escherichia coli B171]
 gi|194420079|gb|EDX36157.1| TPR repeat protein [Shigella dysenteriae 1012]
 gi|194424342|gb|EDX40329.1| TPR repeat protein [Escherichia coli 101-1]
 gi|208726248|gb|EDZ75849.1| TPR repeat protein [Escherichia coli O157:H7 str. EC4206]
 gi|208733200|gb|EDZ81887.1| TPR repeat protein [Escherichia coli O157:H7 str. EC4045]
 gi|208740868|gb|EDZ88550.1| TPR repeat protein [Escherichia coli O157:H7 str. EC4042]
 gi|209158739|gb|ACI36172.1| TPR repeat protein [Escherichia coli O157:H7 str. EC4115]
 gi|209760548|gb|ACI78586.1| hypothetical protein ECs3769 [Escherichia coli]
 gi|209760550|gb|ACI78587.1| hypothetical protein ECs3769 [Escherichia coli]
 gi|209760552|gb|ACI78588.1| hypothetical protein ECs3769 [Escherichia coli]
 gi|209760554|gb|ACI78589.1| hypothetical protein ECs3769 [Escherichia coli]
 gi|209760556|gb|ACI78590.1| hypothetical protein ECs3769 [Escherichia coli]
 gi|209913610|dbj|BAG78684.1| conserved hypothetical protein [Escherichia coli SE11]
 gi|215266269|emb|CAS10698.1| predicted protein [Escherichia coli O127:H6 str. E2348/69]
 gi|217319667|gb|EEC28092.1| TPR repeat protein [Escherichia coli O157:H7 str. TW14588]
 gi|218353224|emb|CAU99144.1| conserved hypothetical protein [Escherichia coli 55989]
 gi|218357685|emb|CAQ90326.1| conserved hypothetical protein [Escherichia fergusonii ATCC
          35469]
 gi|218362213|emb|CAQ99831.1| conserved hypothetical protein [Escherichia coli IAI1]
 gi|218366659|emb|CAR04413.1| conserved hypothetical protein [Escherichia coli S88]
 gi|218371592|emb|CAR19431.1| conserved hypothetical protein [Escherichia coli IAI39]
 gi|218428586|emb|CAR09367.1| conserved hypothetical protein [Escherichia coli ED1a]
 gi|218433500|emb|CAR14403.1| conserved hypothetical protein [Escherichia coli UMN026]
 gi|222034592|emb|CAP77334.1| UPF0350 protein ygfY [Escherichia coli LF82]
 gi|226839566|gb|EEH71587.1| TPR repeat protein [Escherichia sp. 1_1_43]
 gi|226899498|gb|EEH85757.1| ygfY [Escherichia sp. 3_2_53FAA]
 gi|227834715|gb|EEJ45181.1| protein of hypothetical function DUF339 [Escherichia coli 83972]
 gi|238860373|gb|ACR62371.1| conserved protein [Escherichia coli BW2952]
 gi|242378428|emb|CAQ33209.1| conserved protein [Escherichia coli BL21(DE3)]
 gi|253323306|gb|ACT27908.1| protein of unknown function DUF339 [Escherichia coli
          'BL21-Gold(DE3)pLysS AG']
 gi|253974710|gb|ACT40381.1| hypothetical protein ECB_02729 [Escherichia coli B str. REL606]
 gi|253978876|gb|ACT44546.1| hypothetical protein ECD_02729 [Escherichia coli BL21(DE3)]
 gi|254594247|gb|ACT73608.1| conserved protein [Escherichia coli O157:H7 str. TW14359]
 gi|257755669|dbj|BAI27171.1| conserved predicted protein [Escherichia coli O26:H11 str. 11368]
 gi|257760712|dbj|BAI32209.1| conserved predicted protein [Escherichia coli O103:H2 str. 12009]
 gi|257765930|dbj|BAI37425.1| conserved predicted protein [Escherichia coli O111:H- str. 11128]
 gi|260448057|gb|ACX38479.1| protein of unknown function DUF339 [Escherichia coli DH1]
 gi|290764089|gb|ADD58050.1| UPF0350 protein ygfY [Escherichia coli O55:H7 str. CB9615]
 gi|291322309|gb|EFE61738.1| hypothetical protein ECCG_02249 [Escherichia coli B088]
 gi|291426402|gb|EFE99434.1| hypothetical protein ECGG_01692 [Escherichia coli FVEC1412]
 gi|291432339|gb|EFF05321.1| ygfY protein [Escherichia coli B185]
 gi|291469027|gb|EFF11518.1| hypothetical protein ECEG_02261 [Escherichia coli B354]
 gi|294493677|gb|ADE92433.1| TPR repeat protein [Escherichia coli IHE3034]
 gi|298277272|gb|EFI18788.1| hypothetical protein ECFG_01877 [Escherichia coli FVEC1302]
 gi|299879067|gb|EFI87278.1| TPR repeat region [Escherichia coli MS 196-1]
 gi|300394918|gb|EFJ78456.1| TPR repeat region protein [Escherichia coli MS 69-1]
 gi|305854239|gb|EFM54677.1| hypothetical protein ECNC101_09819 [Escherichia coli NC101]
 gi|306909379|gb|EFN39874.1| protein of unknown function DUF339 [Escherichia coli W]
 gi|307554874|gb|ADN47649.1| TPR repeat protein [Escherichia coli ABU 83972]
 gi|307625530|gb|ADN69834.1| hypothetical protein UM146_02035 [Escherichia coli UM146]
 gi|308926416|gb|EFP71892.1| conserved hypothetical protein [Shigella dysenteriae 1617]
 gi|309703257|emb|CBJ02592.1| conserved hypothetical protein [Escherichia coli ETEC H10407]
 gi|310332803|gb|EFQ00017.1| conserved hypothetical protein [Escherichia coli 1827-70]
 gi|312290399|gb|EFR18279.1| conserved hypothetical protein [Escherichia coli 2362-75]
 gi|312947430|gb|ADR28257.1| hypothetical protein NRG857_14220 [Escherichia coli O83:H1 str.
          NRG 857C]
 gi|315062201|gb|ADT76528.1| conserved hypothetical protein [Escherichia coli W]
 gi|315137496|dbj|BAJ44655.1| hypothetical protein ECDH1ME8569_2799 [Escherichia coli DH1]
 gi|315614947|gb|EFU95585.1| conserved hypothetical protein [Escherichia coli 3431]
 gi|320175915|gb|EFW50993.1| hypothetical protein SDB_01607 [Shigella dysenteriae CDC 74-1112]
 gi|320182200|gb|EFW57103.1| hypothetical protein SGB_00570 [Shigella boydii ATCC 9905]
 gi|320184559|gb|EFW59360.1| hypothetical protein SGF_03273 [Shigella flexneri CDC 796-83]
 gi|320189241|gb|EFW63900.1| hypothetical protein ECoD_04243 [Escherichia coli O157:H7 str.
          EC1212]
 gi|320195016|gb|EFW69645.1| hypothetical protein EcoM_02777 [Escherichia coli WV_060327]
 gi|320202557|gb|EFW77127.1| hypothetical protein ECoL_00218 [Escherichia coli EC4100B]
 gi|320640540|gb|EFX10079.1| hypothetical protein ECO5101_03969 [Escherichia coli O157:H7 str.
          G5101]
 gi|320645787|gb|EFX14772.1| hypothetical protein ECO9389_23456 [Escherichia coli O157:H- str.
          493-89]
 gi|320651087|gb|EFX19527.1| hypothetical protein ECO2687_11443 [Escherichia coli O157:H- str.
          H 2687]
 gi|320656583|gb|EFX24479.1| hypothetical protein ECO7815_01600 [Escherichia coli O55:H7 str.
          3256-97 TW 07815]
 gi|320662103|gb|EFX29504.1| hypothetical protein ECO5905_09543 [Escherichia coli O55:H7 str.
          USDA 5905]
 gi|320667178|gb|EFX34141.1| hypothetical protein ECOSU61_08619 [Escherichia coli O157:H7 str.
          LSU-61]
 gi|323162512|gb|EFZ48362.1| hypothetical protein ECE128010_1277 [Escherichia coli E128010]
 gi|323167897|gb|EFZ53587.1| hypothetical protein SS53G_1776 [Shigella sonnei 53G]
 gi|323173895|gb|EFZ59524.1| hypothetical protein ECLT68_2214 [Escherichia coli LT-68]
 gi|323188704|gb|EFZ73989.1| hypothetical protein ECRN5871_3124 [Escherichia coli RN587/1]
 gi|323377215|gb|ADX49483.1| protein of unknown function DUF339 [Escherichia coli KO11]
 gi|323935871|gb|EGB32170.1| ygfY [Escherichia coli E1520]
 gi|323941582|gb|EGB37762.1| ygfY [Escherichia coli E482]
 gi|323946617|gb|EGB42640.1| ygfY [Escherichia coli H120]
 gi|323951664|gb|EGB47539.1| ygfY [Escherichia coli H252]
 gi|323957382|gb|EGB53104.1| ygfY [Escherichia coli H263]
 gi|323960806|gb|EGB56427.1| ygfY [Escherichia coli H489]
 gi|323966698|gb|EGB62130.1| ygfY [Escherichia coli M863]
 gi|323971665|gb|EGB66894.1| ygfY [Escherichia coli TA007]
 gi|323978811|gb|EGB73892.1| ygfY [Escherichia coli TW10509]
 gi|324115086|gb|EGC09051.1| ygfY [Escherichia fergusonii B253]
 gi|324119938|gb|EGC13817.1| ygfY [Escherichia coli E1167]
 gi|325498458|gb|EGC96317.1| hypothetical protein ECD227_2555 [Escherichia fergusonii ECD227]
 gi|326339019|gb|EGD62834.1| protein of unknown function DUF339 [Escherichia coli O157:H7 str.
          1044]
 gi|326343099|gb|EGD66867.1| hypothetical protein ECF_02610 [Escherichia coli O157:H7 str.
          1125]
 gi|327251660|gb|EGE63346.1| hypothetical protein ECSTEC7V_3511 [Escherichia coli STEC_7v]
 gi|331037058|gb|EGI09282.1| putative cytoplasmic protein [Escherichia coli H736]
 gi|331047777|gb|EGI19854.1| putative cytoplasmic protein [Escherichia coli M718]
 gi|331053609|gb|EGI25638.1| putative cytoplasmic protein [Escherichia coli TA206]
 gi|331058401|gb|EGI30382.1| putative cytoplasmic protein [Escherichia coli TA143]
 gi|331063300|gb|EGI35213.1| putative cytoplasmic protein [Escherichia coli TA271]
 gi|331068476|gb|EGI39871.1| putative cytoplasmic protein [Escherichia coli TA280]
 gi|331073714|gb|EGI45035.1| putative cytoplasmic protein [Escherichia coli H591]
 gi|331078138|gb|EGI49344.1| putative cytoplasmic protein [Escherichia coli H299]
 gi|332086822|gb|EGI91958.1| hypothetical protein SB521682_3448 [Shigella boydii 5216-82]
 gi|332087676|gb|EGI92803.1| hypothetical protein SD15574_3456 [Shigella dysenteriae 155-74]
 gi|332090917|gb|EGI96008.1| hypothetical protein SB359474_3591 [Shigella boydii 3594-74]
 gi|332102770|gb|EGJ06116.1| conserved hypothetical protein [Shigella sp. D9]
 gi|332344793|gb|AEE58127.1| conserved hypothetical protein [Escherichia coli UMNK88]
          Length = 88

 Score = 38.9 bits (89), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 34/66 (51%)

Query: 5  MNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTG 64
          M++  +  ++   RRG RE+D+ +  F +H    LS  E  +   ++E DD +LF W   
Sbjct: 1  MDINNKARIHWACRRGMRELDISIMPFFEHEYDSLSDDEKRIFIRLLECDDPDLFNWLMN 60

Query: 65 MEKPPE 70
            KP +
Sbjct: 61 HGKPAD 66


>gi|119943856|ref|YP_941536.1| hypothetical protein Ping_0063 [Psychromonas ingrahamii 37]
 gi|119862460|gb|ABM01937.1| protein of unknown function DUF339 [Psychromonas ingrahamii 37]
          Length = 83

 Score = 38.9 bits (89), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 36/70 (51%), Gaps = 1/70 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          ++++ C RRG  E+D++   FV     +LS  E    E ++  +D +LF WF G +  P+
Sbjct: 9  RLLWAC-RRGMLELDVLFIPFVKEAYDDLSYSEQLTFERLLTNEDPDLFAWFMGHKSCPD 67

Query: 71 YLRTPIFKKI 80
            +  I   I
Sbjct: 68 AEQAKIIDVI 77


>gi|326478048|gb|EGE02058.1| hypothetical protein TEQG_01098 [Trichophyton equinum CBS 127.97]
          Length = 259

 Score = 38.9 bits (89), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 38/59 (64%), Gaps = 2/59 (3%)

Query: 11  KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPP 69
           +++Y+  +RGT E DL+L +F   ++ +++  +L   +  ++E+D +++ W T  ++PP
Sbjct: 114 RLLYQSRKRGTLESDLLLSTFASTYLGKMTGSQLDEYDRFLDENDWDIYYWAT--QEPP 170


>gi|317493829|ref|ZP_07952246.1| hypothetical protein HMPREF0864_03014 [Enterobacteriaceae
          bacterium 9_2_54FAA]
 gi|316918156|gb|EFV39498.1| hypothetical protein HMPREF0864_03014 [Enterobacteriaceae
          bacterium 9_2_54FAA]
          Length = 88

 Score = 38.9 bits (89), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 35/68 (51%), Gaps = 2/68 (2%)

Query: 5  MNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF-- 62
          M+++ +  ++   RRG RE+D+ +  F +H    LS  +      ++E DD +LF W   
Sbjct: 1  MDIENKSRIHWACRRGMRELDISIMPFFEHEYDSLSDTDKQTFVRLLECDDPDLFNWLMN 60

Query: 63 TGMEKPPE 70
           G  K PE
Sbjct: 61 HGSPKDPE 68


>gi|284922845|emb|CBG35934.1| conserved hypothetical protein [Escherichia coli 042]
          Length = 88

 Score = 38.9 bits (89), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 34/66 (51%)

Query: 5  MNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTG 64
          M++  +  ++   RRG RE+D+ +  F +H    LS  E  +   ++E DD +LF W   
Sbjct: 1  MDINNKARIHWACRRGMRELDISIMPFFEHEYDSLSDDEKRIFIRLLECDDPDLFNWLMN 60

Query: 65 MEKPPE 70
            KP +
Sbjct: 61 HGKPAD 66


>gi|115389748|ref|XP_001212379.1| conserved hypothetical protein [Aspergillus terreus NIH2624]
 gi|121740191|sp|Q0CSY3|SDHF2_ASPTN RecName: Full=Succinate dehydrogenase assembly factor 2,
           mitochondrial; Short=SDH assembly factor 2; AltName:
           Full=Early meiotic induction protein 5; AltName:
           Full=Succinate dehydrogenase subunit 5, mitochondrial;
           Flags: Precursor
 gi|114194775|gb|EAU36475.1| conserved hypothetical protein [Aspergillus terreus NIH2624]
          Length = 295

 Score = 38.9 bits (89), Expect = 0.24,   Method: Composition-based stats.
 Identities = 16/60 (26%), Positives = 37/60 (61%), Gaps = 2/60 (3%)

Query: 11  KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
           +++Y+  +RG  E DL+L +F D ++ +++  +L   +  ++E+D +++ W T  +  PE
Sbjct: 152 RLLYQSRKRGILESDLLLSTFADVYLAKMNHEQLQEYDRFLDENDWDIYYWAT--QDAPE 209


>gi|326470793|gb|EGD94802.1| hypothetical protein TESG_02307 [Trichophyton tonsurans CBS 112818]
          Length = 258

 Score = 38.9 bits (89), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 38/59 (64%), Gaps = 2/59 (3%)

Query: 11  KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPP 69
           +++Y+  +RGT E DL+L +F   ++ +++  +L   +  ++E+D +++ W T  ++PP
Sbjct: 113 RLLYQSRKRGTLESDLLLSTFASTYLGKMTGSQLDEYDRFLDENDWDIYYWAT--QEPP 169


>gi|167623008|ref|YP_001673302.1| hypothetical protein Shal_1074 [Shewanella halifaxensis HAW-EB4]
 gi|167353030|gb|ABZ75643.1| protein of unknown function DUF339 [Shewanella halifaxensis
          HAW-EB4]
          Length = 79

 Score = 38.9 bits (89), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 37/70 (52%), Gaps = 5/70 (7%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          ++ + C RRG  E+D++   FV+     +S  +  +L  ++E +D  LF WF G E  P 
Sbjct: 5  RVKWAC-RRGMLELDVLFQPFVEEHYEAMSVEDKIVLVKLLECEDPELFAWFMGHEVCP- 62

Query: 71 YLRTPIFKKI 80
             TP F ++
Sbjct: 63 ---TPAFAEM 69


>gi|71003003|ref|XP_756182.1| hypothetical protein UM00035.1 [Ustilago maydis 521]
 gi|46096187|gb|EAK81420.1| hypothetical protein UM00035.1 [Ustilago maydis 521]
          Length = 249

 Score = 38.9 bits (89), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 33/59 (55%)

Query: 11  KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPP 69
           +++Y+  +RGT E DL+L +F    +  L   EL   + +++E D ++F W T  +  P
Sbjct: 157 RLIYQTRKRGTLETDLLLSTFAKKELKNLPDAELDEFDRLLDEPDWDIFYWCTQRKPIP 215


>gi|330828472|ref|YP_004391424.1| TPR repeat-containing protein [Aeromonas veronii B565]
 gi|328803608|gb|AEB48807.1| TPR repeat protein [Aeromonas veronii B565]
          Length = 89

 Score = 38.5 bits (88), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 36/82 (43%), Gaps = 1/82 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          ++ + C RRG  E+D+I   F +H    LS  +      ++  DD +LFKW  G   P +
Sbjct: 9  RLKWAC-RRGMLELDVIFMPFFEHEFDSLSEADQQTFIRLLASDDPDLFKWCMGHGVPAD 67

Query: 71 YLRTPIFKKIYDYYSNNLDRKN 92
               +   I +      DR+ 
Sbjct: 68 PAFAAMIPMILERNQARHDRQG 89


>gi|310793704|gb|EFQ29165.1| hypothetical protein GLRG_04309 [Glomerella graminicola M1.001]
          Length = 231

 Score = 38.5 bits (88), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 14/58 (24%), Positives = 35/58 (60%)

Query: 11  KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKP 68
           +++Y+  +RGT E DL++ +F +  +  ++  ++   +  ++E+D +++ W T  E P
Sbjct: 75  RLLYQSRKRGTLESDLLMSTFANEHLPHMTKAQMQQYDLFLDENDWDIYYWATQEEAP 132


>gi|165976950|ref|YP_001652543.1| hypothetical protein APJL_1547 [Actinobacillus pleuropneumoniae
          serovar 3 str. JL03]
 gi|190150850|ref|YP_001969375.1| hypothetical protein APP7_1581 [Actinobacillus pleuropneumoniae
          serovar 7 str. AP76]
 gi|303250939|ref|ZP_07337129.1| hypothetical protein APP6_2066 [Actinobacillus pleuropneumoniae
          serovar 6 str. Femo]
 gi|303253401|ref|ZP_07339544.1| hypothetical protein APP2_2077 [Actinobacillus pleuropneumoniae
          serovar 2 str. 4226]
 gi|307246438|ref|ZP_07528511.1| hypothetical protein appser1_16360 [Actinobacillus
          pleuropneumoniae serovar 1 str. 4074]
 gi|307248563|ref|ZP_07530578.1| hypothetical protein appser2_15310 [Actinobacillus
          pleuropneumoniae serovar 2 str. S1536]
 gi|307250796|ref|ZP_07532725.1| hypothetical protein appser4_15610 [Actinobacillus
          pleuropneumoniae serovar 4 str. M62]
 gi|307253172|ref|ZP_07535050.1| hypothetical protein appser6_16730 [Actinobacillus
          pleuropneumoniae serovar 6 str. Femo]
 gi|307255421|ref|ZP_07537228.1| hypothetical protein appser9_16480 [Actinobacillus
          pleuropneumoniae serovar 9 str. CVJ13261]
 gi|307257590|ref|ZP_07539350.1| hypothetical protein appser10_15780 [Actinobacillus
          pleuropneumoniae serovar 10 str. D13039]
 gi|307259873|ref|ZP_07541587.1| hypothetical protein appser11_16610 [Actinobacillus
          pleuropneumoniae serovar 11 str. 56153]
 gi|307264200|ref|ZP_07545791.1| hypothetical protein appser13_15960 [Actinobacillus
          pleuropneumoniae serovar 13 str. N273]
 gi|165877051|gb|ABY70099.1| hypothetical protein APJL_1547 [Actinobacillus pleuropneumoniae
          serovar 3 str. JL03]
 gi|189915981|gb|ACE62233.1| hypothetical protein APP7_1581 [Actinobacillus pleuropneumoniae
          serovar 7 str. AP76]
 gi|302647746|gb|EFL77959.1| hypothetical protein APP2_2077 [Actinobacillus pleuropneumoniae
          serovar 2 str. 4226]
 gi|302650211|gb|EFL80377.1| hypothetical protein APP6_2066 [Actinobacillus pleuropneumoniae
          serovar 6 str. Femo]
 gi|306852642|gb|EFM84874.1| hypothetical protein appser1_16360 [Actinobacillus
          pleuropneumoniae serovar 1 str. 4074]
 gi|306854913|gb|EFM87101.1| hypothetical protein appser2_15310 [Actinobacillus
          pleuropneumoniae serovar 2 str. S1536]
 gi|306857155|gb|EFM89282.1| hypothetical protein appser4_15610 [Actinobacillus
          pleuropneumoniae serovar 4 str. M62]
 gi|306859357|gb|EFM91392.1| hypothetical protein appser6_16730 [Actinobacillus
          pleuropneumoniae serovar 6 str. Femo]
 gi|306861605|gb|EFM93592.1| hypothetical protein appser9_16480 [Actinobacillus
          pleuropneumoniae serovar 9 str. CVJ13261]
 gi|306863893|gb|EFM95816.1| hypothetical protein appser10_15780 [Actinobacillus
          pleuropneumoniae serovar 10 str. D13039]
 gi|306866043|gb|EFM97917.1| hypothetical protein appser11_16610 [Actinobacillus
          pleuropneumoniae serovar 11 str. 56153]
 gi|306870446|gb|EFN02199.1| hypothetical protein appser13_15960 [Actinobacillus
          pleuropneumoniae serovar 13 str. N273]
          Length = 82

 Score = 38.5 bits (88), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 31/59 (52%), Gaps = 1/59 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPP 69
          +I + C RRG RE+D ++  F   +  ELS  +   L ++++  D  LF+WF      P
Sbjct: 8  RIEWEC-RRGMRELDKMIMPFYKEYFDELSEAQQQTLVAMLKYTDPELFRWFMHQAPAP 65


>gi|289617735|emb|CBI61458.1| unnamed protein product [Sordaria macrospora]
          Length = 219

 Score = 38.5 bits (88), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 36/59 (61%), Gaps = 2/59 (3%)

Query: 11  KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPP 69
           +++Y+  +RGT E DLIL +F    +  ++  +L   +  ++E+D +++ W T  ++PP
Sbjct: 81  RLLYQSRKRGTLESDLILSTFAQSHLQSMTPEQLKQYDLFLDENDWDIYYWAT--QEPP 137


>gi|152971843|ref|YP_001336952.1| hypothetical protein KPN_03325 [Klebsiella pneumoniae subsp.
          pneumoniae MGH 78578]
 gi|206576457|ref|YP_002236646.1| TPR repeat protein [Klebsiella pneumoniae 342]
 gi|238896437|ref|YP_002921175.1| hypothetical protein KP1_4613 [Klebsiella pneumoniae NTUH-K2044]
 gi|288933623|ref|YP_003437682.1| hypothetical protein Kvar_0740 [Klebsiella variicola At-22]
 gi|290511311|ref|ZP_06550680.1| ygfY [Klebsiella sp. 1_1_55]
 gi|330010969|ref|ZP_08306934.1| TPR repeat region [Klebsiella sp. MS 92-3]
 gi|150956692|gb|ABR78722.1| hypothetical protein KPN_03325 [Klebsiella pneumoniae subsp.
          pneumoniae MGH 78578]
 gi|206565515|gb|ACI07291.1| TPR repeat protein [Klebsiella pneumoniae 342]
 gi|238548757|dbj|BAH65108.1| hypothetical protein KP1_4613 [Klebsiella pneumoniae subsp.
          pneumoniae NTUH-K2044]
 gi|288888352|gb|ADC56670.1| protein of unknown function DUF339 [Klebsiella variicola At-22]
 gi|289776304|gb|EFD84303.1| ygfY [Klebsiella sp. 1_1_55]
 gi|328534346|gb|EGF60956.1| TPR repeat region [Klebsiella sp. MS 92-3]
          Length = 88

 Score = 38.5 bits (88), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 34/66 (51%)

Query: 5  MNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTG 64
          M++  +  ++   RRG RE+D+ +  F ++    LS  +  +   ++E DD +LF W   
Sbjct: 1  MDINNKARIHWACRRGMRELDISIMPFFEYEYDTLSDADKQLFIRLLENDDPDLFNWLMN 60

Query: 65 MEKPPE 70
            KP +
Sbjct: 61 HGKPAD 66


>gi|262042538|ref|ZP_06015695.1| TPR repeat protein [Klebsiella pneumoniae subsp. rhinoscleromatis
          ATCC 13884]
 gi|259040098|gb|EEW41212.1| TPR repeat protein [Klebsiella pneumoniae subsp. rhinoscleromatis
          ATCC 13884]
          Length = 88

 Score = 38.5 bits (88), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 34/66 (51%)

Query: 5  MNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTG 64
          M++  +  ++   RRG RE+D+ +  F ++    LS  +  +   ++E DD +LF W   
Sbjct: 1  MDINNKARIHWACRRGMRELDISIMPFFEYEYDTLSDADKQLFIRLLENDDPDLFNWLMN 60

Query: 65 MEKPPE 70
            KP +
Sbjct: 61 HGKPAD 66


>gi|238921203|ref|YP_002934718.1| hypothetical protein NT01EI_3345 [Edwardsiella ictaluri 93-146]
 gi|238870772|gb|ACR70483.1| conserved hypothetical protein [Edwardsiella ictaluri 93-146]
          Length = 88

 Score = 38.5 bits (88), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 31/64 (48%)

Query: 5  MNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTG 64
          M++  +  V+   RRG RE+D+ +  F +H    L+  +      ++  DD  LFKW   
Sbjct: 1  MDINNKARVHWACRRGMRELDIAIMPFFEHEYDALNDADKQTFVRLLSCDDPELFKWLMN 60

Query: 65 MEKP 68
            KP
Sbjct: 61 QGKP 64


>gi|269140275|ref|YP_003296976.1| hypothetical protein ETAE_2932 [Edwardsiella tarda EIB202]
 gi|267985936|gb|ACY85765.1| hypothetical protein ETAE_2932 [Edwardsiella tarda EIB202]
 gi|281181714|dbj|BAI58036.1| hypothetical protein [Edwardsiella tarda]
 gi|304560102|gb|ADM42766.1| YgfY [Edwardsiella tarda FL6-60]
          Length = 88

 Score = 38.5 bits (88), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 31/64 (48%)

Query: 5  MNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTG 64
          M++  +  V+   RRG RE+D+ +  F +H    L+  +      ++  DD  LFKW   
Sbjct: 1  MDINNKARVHWACRRGMRELDIAIMPFFEHEYDALNDADKQTFVRLLACDDPELFKWLMN 60

Query: 65 MEKP 68
            KP
Sbjct: 61 QGKP 64


>gi|302504188|ref|XP_003014053.1| hypothetical protein ARB_07773 [Arthroderma benhamiae CBS 112371]
 gi|291177620|gb|EFE33413.1| hypothetical protein ARB_07773 [Arthroderma benhamiae CBS 112371]
          Length = 747

 Score = 38.5 bits (88), Expect = 0.30,   Method: Composition-based stats.
 Identities = 15/52 (28%), Positives = 33/52 (63%), Gaps = 2/52 (3%)

Query: 18  RRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPP 69
           +RGT E DL+L +F   ++ +++  +L   +  ++E+D +++ W T  ++PP
Sbjct: 609 KRGTLESDLLLSTFASTYLAKMTGSQLDEYDRFLDENDWDIYYWAT--QEPP 658


>gi|127511978|ref|YP_001093175.1| hypothetical protein Shew_1045 [Shewanella loihica PV-4]
 gi|126637273|gb|ABO22916.1| protein of unknown function DUF339 [Shewanella loihica PV-4]
          Length = 83

 Score = 38.5 bits (88), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 38/70 (54%), Gaps = 3/70 (4%)

Query: 1  MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
          M + MN+   ++ + C RRG  E+D++   FV+    +LS  +  +   ++E +D  LF 
Sbjct: 1  MSEPMNIA--RVRWAC-RRGMLELDVLFQPFVETQYEQLSIDDKAVFVRLLECEDPELFA 57

Query: 61 WFTGMEKPPE 70
          WF G E  P+
Sbjct: 58 WFMGHEACPD 67


>gi|326794159|ref|YP_004311979.1| hypothetical protein Marme_0868 [Marinomonas mediterranea MMB-1]
 gi|326544923|gb|ADZ90143.1| protein of unknown function DUF339 [Marinomonas mediterranea
          MMB-1]
          Length = 91

 Score = 38.5 bits (88), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 38/83 (45%), Gaps = 5/83 (6%)

Query: 10 RKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPP 69
          +++ + C RRG  E+DL+L  F+D   L L   +      +I+ +D  +F WF   E P 
Sbjct: 11 KRLKWHC-RRGMLELDLLLEPFLDEVFLTLDEEDQKRFYKLIQCEDQEIFPWFMQKEVP- 68

Query: 70 EYLRTPIFKKIYDYYSNNLDRKN 92
               P   +I D     +  +N
Sbjct: 69 ---EDPDLARIVDIIVTRVQPEN 88


>gi|149247217|ref|XP_001528030.1| early meiotic induction protein 5, mitochondrial precursor
           [Lodderomyces elongisporus NRRL YB-4239]
 gi|257096774|sp|A5DT64|SDHF2_LODEL RecName: Full=Succinate dehydrogenase assembly factor 2,
           mitochondrial; Short=SDH assembly factor 2; AltName:
           Full=Early meiotic induction protein 5; AltName:
           Full=Succinate dehydrogenase subunit 5, mitochondrial;
           Flags: Precursor
 gi|146447984|gb|EDK42372.1| early meiotic induction protein 5, mitochondrial precursor
           [Lodderomyces elongisporus NRRL YB-4239]
          Length = 164

 Score = 38.5 bits (88), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 44/80 (55%), Gaps = 5/80 (6%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
           + ++++  ++VY+  +RG  E DL+L  F   ++ +++  EL   + +++E D +++ W 
Sbjct: 47  ETIDVKRARLVYQSRKRGILESDLLLSRFAKKYLKQMTMEELDEYDKLLDEADWDIYYWA 106

Query: 63  TGMEKPPEYLRTPIFKKIYD 82
           T       Y  TP+ KK  D
Sbjct: 107 TK-----NYDTTPLPKKWED 121


>gi|50555804|ref|XP_505310.1| YALI0F11957p [Yarrowia lipolytica]
 gi|74632669|sp|Q6C202|SDHF2_YARLI RecName: Full=Succinate dehydrogenase assembly factor 2,
           mitochondrial; Short=SDH assembly factor 2; AltName:
           Full=Early meiotic induction protein 5; AltName:
           Full=Succinate dehydrogenase subunit 5, mitochondrial;
           Flags: Precursor
 gi|49651180|emb|CAG78117.1| YALI0F11957p [Yarrowia lipolytica]
          Length = 145

 Score = 38.5 bits (88), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 18/80 (22%), Positives = 44/80 (55%), Gaps = 4/80 (5%)

Query: 11  KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEK--- 67
           +++Y+  +RG  E DL+L  +   ++ +++  EL   + +++E D ++F W T  +    
Sbjct: 55  RLLYQSRKRGILETDLLLSRYAKLYLKDMTREELEEYDKLLDEPDWDIFYWATRNDNIKP 114

Query: 68  -PPEYLRTPIFKKIYDYYSN 86
            P  + ++P+ +K+ +   N
Sbjct: 115 CPERWAKSPVMEKLRELAEN 134


>gi|254448814|ref|ZP_05062271.1| hypothetical protein GP5015_796 [gamma proteobacterium HTCC5015]
 gi|198261655|gb|EDY85943.1| hypothetical protein GP5015_796 [gamma proteobacterium HTCC5015]
          Length = 106

 Score = 38.5 bits (88), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 43/78 (55%), Gaps = 2/78 (2%)

Query: 4  NMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEE-DDSNLFKWF 62
          N   +  ++ +RC RRG +E+D ++  ++D + LE SS E    E+++ + ++  LF+  
Sbjct: 21 NTENKVAQLKWRC-RRGMKELDQLMLRYLDLYYLEASSSEQQAFETLLNDYEEPLLFRLL 79

Query: 63 TGMEKPPEYLRTPIFKKI 80
           G E+  E     + +KI
Sbjct: 80 NGQEQAEEASIAEVIEKI 97


>gi|331648643|ref|ZP_08349731.1| putative cytoplasmic protein [Escherichia coli M605]
 gi|281179902|dbj|BAI56232.1| conserved hypothetical protein [Escherichia coli SE15]
 gi|330908929|gb|EGH37443.1| ygfY [Escherichia coli AA86]
 gi|331042390|gb|EGI14532.1| putative cytoplasmic protein [Escherichia coli M605]
          Length = 88

 Score = 38.5 bits (88), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 33/66 (50%)

Query: 5  MNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTG 64
          M++  +  ++   RRG RE+D+ +  F +H    LS  E      ++E DD +LF W   
Sbjct: 1  MDINNKARIHWACRRGMRELDISIMPFFEHEYDSLSDDEKRTFIRLLECDDPDLFNWLMN 60

Query: 65 MEKPPE 70
            KP +
Sbjct: 61 HGKPAD 66


>gi|56756461|gb|AAW26403.1| SJCHGC09209 protein [Schistosoma japonicum]
          Length = 148

 Score = 38.5 bits (88), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 16/70 (22%), Positives = 39/70 (55%), Gaps = 2/70 (2%)

Query: 11  KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDS--NLFKWFTGMEKP 68
           +++Y+  +RG  E  ++L +F   ++  ++  +L   + +I   D+  +L+ W T  ++ 
Sbjct: 71  RLLYQSRKRGNLENGILLSTFAAQYLNTMTHEQLIAYDDLINLPDNEWDLYYWITKAKQA 130

Query: 69  PEYLRTPIFK 78
           PEY +T + +
Sbjct: 131 PEYFQTDVLQ 140


>gi|154341601|ref|XP_001566752.1| hypothetical protein [Leishmania braziliensis MHOM/BR/75/M2904]
 gi|134064077|emb|CAM40268.1| conserved hypothetical protein [Leishmania braziliensis
           MHOM/BR/75/M2904]
          Length = 226

 Score = 38.1 bits (87), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 44/86 (51%), Gaps = 3/86 (3%)

Query: 10  RKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFT-GMEKP 68
           R+++Y+   RG  EMDLI G F    +  L +  L   + ++++ DS LF W   G++ P
Sbjct: 140 RRLIYQSRYRGMVEMDLIFGHFARCKLETLDAAMLNEYDILLKQLDSELFCWLVMGVDAP 199

Query: 69  PEYLRTPIFKKIYDYYSNNLDRKNML 94
            E  +   F ++  +   N +R  +L
Sbjct: 200 EEVSKLRCFDELRRFI--NEERAELL 223


>gi|332140421|ref|YP_004426159.1| TPR repeat protein [Alteromonas macleodii str. 'Deep ecotype']
 gi|332141909|ref|YP_004427647.1| TPR repeat protein [Alteromonas macleodii str. 'Deep ecotype']
 gi|327550443|gb|AEA97161.1| TPR repeat protein [Alteromonas macleodii str. 'Deep ecotype']
 gi|327551931|gb|AEA98649.1| TPR repeat protein [Alteromonas macleodii str. 'Deep ecotype']
          Length = 83

 Score = 38.1 bits (87), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 34/63 (53%), Gaps = 3/63 (4%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEK--P 68
          ++ + C RRG  E+D++L  FV+     LS  E    E ++  DD +LF W  G +K   
Sbjct: 9  RLKWAC-RRGMLELDVLLLPFVEEAFDSLSYEEQETFERLLTSDDPDLFAWIMGHQKCED 67

Query: 69 PEY 71
          PE+
Sbjct: 68 PEF 70


>gi|296415391|ref|XP_002837373.1| hypothetical protein [Tuber melanosporum Mel28]
 gi|295633238|emb|CAZ81564.1| unnamed protein product [Tuber melanosporum]
          Length = 305

 Score = 38.1 bits (87), Expect = 0.39,   Method: Composition-based stats.
 Identities = 16/59 (27%), Positives = 35/59 (59%), Gaps = 2/59 (3%)

Query: 11  KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPP 69
           +++Y+  +RG  E DL+L +F D  + ++   +L   +  ++E+D +++ W T  + PP
Sbjct: 155 RLLYQSRKRGILETDLLLSTFADENLGKMGMEQLDAYDRFLDENDWDIYYWAT--QTPP 211


>gi|260599237|ref|YP_003211808.1| hypothetical protein CTU_34450 [Cronobacter turicensis z3032]
 gi|260218414|emb|CBA33505.1| UPF0350 protein ygfY [Cronobacter turicensis z3032]
          Length = 86

 Score = 38.1 bits (87), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 32/60 (53%), Gaps = 1/60 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          +I + C RRG RE+D+ +  F +H    LS  +  +   ++E DD +LF W     KP +
Sbjct: 6  RIHWAC-RRGMRELDISIMPFFEHDYDSLSEEDKRVFVRLLECDDPDLFNWLMNHGKPAD 64


>gi|332023926|gb|EGI64144.1| Succinate dehydrogenase subunit 5, mitochondrial [Acromyrmex
           echinatior]
          Length = 181

 Score = 38.1 bits (87), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 41/72 (56%), Gaps = 3/72 (4%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIE--EDDSNLFK 60
           +N NL+  ++ Y+  +RG  E  ++L +F + ++      +L + + +I    +D ++F 
Sbjct: 84  ENANLKRARLTYQSRKRGMLENGILLSTFANKYLNTFDDKQLRLYDQLINLPSNDWDIFY 143

Query: 61  WFTGMEK-PPEY 71
           W TG++  PPE+
Sbjct: 144 WATGVKPTPPEF 155


>gi|88858213|ref|ZP_01132855.1| hypothetical protein PTD2_12524 [Pseudoalteromonas tunicata D2]
 gi|88819830|gb|EAR29643.1| hypothetical protein PTD2_12524 [Pseudoalteromonas tunicata D2]
          Length = 83

 Score = 38.1 bits (87), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 29/49 (59%)

Query: 18 RRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGME 66
          RRG  E+D++L  FV+     LS+ +  + + ++ ++D  LF WF G E
Sbjct: 15 RRGMLELDVLLMPFVEEGYDALSAEDKVIFQHLLTQEDPELFAWFMGHE 63


>gi|225682489|gb|EEH20773.1| endoplasmic reticulum vesicle protein [Paracoccidioides
           brasiliensis Pb03]
          Length = 415

 Score = 38.1 bits (87), Expect = 0.42,   Method: Composition-based stats.
 Identities = 15/59 (25%), Positives = 35/59 (59%)

Query: 11  KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPP 69
           +++Y+  +RGT E DL+L +F    +  +++ +L   +  ++E+D +++ W T   + P
Sbjct: 260 RLLYQSRKRGTLESDLLLSTFASKNLPTMTAQQLEEFDKFLDENDWDIYYWATQEAEDP 318


>gi|171691895|ref|XP_001910872.1| hypothetical protein [Podospora anserina S mat+]
 gi|170945896|emb|CAP72697.1| unnamed protein product [Podospora anserina S mat+]
          Length = 259

 Score = 38.1 bits (87), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 14/53 (26%), Positives = 34/53 (64%)

Query: 11  KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFT 63
           +++Y+  +RGT E DL+L +F    + +++  +L+  +  ++E+D +++ W T
Sbjct: 73  RLLYQSRKRGTLESDLLLSTFAASHLPKMTPAQLSEYDRFLDENDWDIYYWAT 125


>gi|326564771|gb|EGE14983.1| hypothetical protein E9M_00486 [Moraxella catarrhalis 46P47B1]
 gi|326577410|gb|EGE27294.1| hypothetical protein EA1_03270 [Moraxella catarrhalis O35E]
          Length = 88

 Score = 38.1 bits (87), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 32/59 (54%), Gaps = 1/59 (1%)

Query: 10 RKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKP 68
          R+I+Y+  RRG +E+D  +  +V    L   + E    E+++  +D +L  +F G E P
Sbjct: 10 RRIIYQA-RRGLKELDFYIDYYVKSHYLSADADEQQAFETLLSYEDPDLLVFFLGQETP 67


>gi|212535072|ref|XP_002147692.1| TPR repeat protein [Penicillium marneffei ATCC 18224]
 gi|210070091|gb|EEA24181.1| TPR repeat protein [Penicillium marneffei ATCC 18224]
          Length = 267

 Score = 37.7 bits (86), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 35/60 (58%)

Query: 11  KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
           +++Y+  +RG  E DL+L +F D ++  +S  +L   +  ++E+D +++ W T   K  E
Sbjct: 112 RLLYQSRKRGILETDLLLSTFADVYLGNMSKEQLQQYDKFLDENDWDIYYWATQEPKAAE 171


>gi|170725595|ref|YP_001759621.1| hypothetical protein Swoo_1234 [Shewanella woodyi ATCC 51908]
 gi|169810942|gb|ACA85526.1| protein of unknown function DUF339 [Shewanella woodyi ATCC 51908]
          Length = 83

 Score = 37.7 bits (86), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 37/67 (55%), Gaps = 3/67 (4%)

Query: 1  MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
          M + MN+   ++ + C RRG  E+D++   FV+    ++S  +  +   ++E +D  LF 
Sbjct: 1  MSEPMNIA--RVRWAC-RRGMLELDVLFQPFVEKHYEQMSVEDKHIFVRLLEGEDPVLFA 57

Query: 61 WFTGMEK 67
          WF G EK
Sbjct: 58 WFMGHEK 64


>gi|156846808|ref|XP_001646290.1| hypothetical protein Kpol_1032p25 [Vanderwaltozyma polyspora DSM
           70294]
 gi|156116965|gb|EDO18432.1| hypothetical protein Kpol_1032p25 [Vanderwaltozyma polyspora DSM
           70294]
          Length = 201

 Score = 37.7 bits (86), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 20/80 (25%), Positives = 43/80 (53%), Gaps = 4/80 (5%)

Query: 11  KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFT----GME 66
           +++Y+  +RG  E DL+L  F   ++ E++  EL   ++++ E D +++ W T       
Sbjct: 107 RLIYQSRKRGILETDLLLSGFAAKYLKEMTPEELDEYDNLLNELDWDIYYWATKNYDTTP 166

Query: 67  KPPEYLRTPIFKKIYDYYSN 86
            P ++  + I KK+ ++  N
Sbjct: 167 LPDKWKDSKILKKLQEFSEN 186


>gi|94500783|ref|ZP_01307312.1| hypothetical protein RED65_03570 [Oceanobacter sp. RED65]
 gi|94427105|gb|EAT12086.1| hypothetical protein RED65_03570 [Oceanobacter sp. RED65]
          Length = 93

 Score = 37.7 bits (86), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 32/57 (56%), Gaps = 3/57 (5%)

Query: 15 RCW---RRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKP 68
          R W   RRG  E+D++L  F++    +LS  +     ++++ +D  LFKWF   EKP
Sbjct: 18 RLWWHSRRGMLELDVLLLPFLEEVYDDLSEEDKARYRNLLDVEDPELFKWFMQKEKP 74


>gi|240281951|gb|EER45454.1| TPR domain-containing protein [Ajellomyces capsulatus H143]
          Length = 543

 Score = 37.7 bits (86), Expect = 0.52,   Method: Composition-based stats.
 Identities = 17/65 (26%), Positives = 36/65 (55%), Gaps = 1/65 (1%)

Query: 5   MNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTG 64
           M ++ R ++Y+  +RG  E DL+L +F    +  ++  +L   +  ++E+D +++ W T 
Sbjct: 380 MTMRAR-LLYQSRKRGILESDLLLSTFASRHLPTMTERQLQEYDKFLDENDWDIYYWATQ 438

Query: 65  MEKPP 69
             K P
Sbjct: 439 EAKDP 443


>gi|325088091|gb|EGC41401.1| G-protein comlpex beta subunit CpcB [Ajellomyces capsulatus H88]
          Length = 934

 Score = 37.7 bits (86), Expect = 0.54,   Method: Composition-based stats.
 Identities = 17/65 (26%), Positives = 36/65 (55%), Gaps = 1/65 (1%)

Query: 5   MNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTG 64
           M ++ R ++Y+  +RG  E DL+L +F    +  ++  +L   +  ++E+D +++ W T 
Sbjct: 380 MTMRAR-LLYQSRKRGILESDLLLSTFASRHLPTMTERQLQEYDKFLDENDWDIYYWATQ 438

Query: 65  MEKPP 69
             K P
Sbjct: 439 EAKDP 443


>gi|315127406|ref|YP_004069409.1| hypothetical protein PSM_A2344 [Pseudoalteromonas sp. SM9913]
 gi|315015920|gb|ADT69258.1| hypothetical protein PSM_A2344 [Pseudoalteromonas sp. SM9913]
          Length = 83

 Score = 37.7 bits (86), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 32/57 (56%), Gaps = 1/57 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEK 67
          +I + C RRG  E+D++   FV+     L + +    + ++ ++D +LF WF G EK
Sbjct: 9  RIRWAC-RRGMLELDVLFMPFVEEAYDSLDAKQQATFQRLLTQEDPDLFAWFMGHEK 64


>gi|307545456|ref|YP_003897935.1| hypothetical protein HELO_2866 [Halomonas elongata DSM 2581]
 gi|307217480|emb|CBV42750.1| K09159 hypothetical protein [Halomonas elongata DSM 2581]
          Length = 214

 Score = 37.7 bits (86), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 38/74 (51%)

Query: 10  RKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPP 69
           RK +Y   RRG  E+DL+L  F++    +L   +     ++I E+D +LF W    + P 
Sbjct: 129 RKRLYWHSRRGMWELDLLLVPFLEQRYDDLDERDQAAYRALIGEEDQDLFFWLMRRDWPE 188

Query: 70  EYLRTPIFKKIYDY 83
           E  R  I K I ++
Sbjct: 189 EPERRRIVKMIVEH 202


>gi|225559027|gb|EEH07310.1| G-protein comlpex beta subunit CpcB [Ajellomyces capsulatus G186AR]
          Length = 934

 Score = 37.7 bits (86), Expect = 0.54,   Method: Composition-based stats.
 Identities = 17/65 (26%), Positives = 36/65 (55%), Gaps = 1/65 (1%)

Query: 5   MNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTG 64
           M ++ R ++Y+  +RG  E DL+L +F    +  ++  +L   +  ++E+D +++ W T 
Sbjct: 380 MTMRAR-LLYQSRKRGILESDLLLSTFASRHLPTMTERQLQEYDKFLDENDWDIYYWATQ 438

Query: 65  MEKPP 69
             K P
Sbjct: 439 EAKDP 443


>gi|71083685|ref|YP_266405.1| hypothetical protein SAR11_0994 [Candidatus Pelagibacter ubique
          HTCC1062]
 gi|71062798|gb|AAZ21801.1| Protein of unknown function DUF339 [Candidatus Pelagibacter
          ubique HTCC1062]
          Length = 88

 Score = 37.7 bits (86), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 21/33 (63%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVE 43
          KI YR   RGT+EMD +LGSF   +I + +  E
Sbjct: 11 KITYRANYRGTKEMDKLLGSFTKKYIDQFNEQE 43


>gi|145300370|ref|YP_001143211.1| hypothetical protein ASA_3495 [Aeromonas salmonicida subsp.
          salmonicida A449]
 gi|142853142|gb|ABO91463.1| conserved hypothetical protein [Aeromonas salmonicida subsp.
          salmonicida A449]
          Length = 89

 Score = 37.7 bits (86), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 31/60 (51%), Gaps = 1/60 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          ++ + C RRG  E+D+I   F +H    LS  +      ++E DD +LFKW  G   P +
Sbjct: 9  RLKWAC-RRGMLELDVIFMPFFEHEFDSLSDEQQQTFIRLLESDDPDLFKWCMGHGVPAD 67


>gi|85102955|ref|XP_961429.1| hypothetical protein NCU01343 [Neurospora crassa OR74A]
 gi|11595613|emb|CAC18233.1| conserved hypothetical protein [Neurospora crassa]
 gi|28922974|gb|EAA32193.1| conserved hypothetical protein [Neurospora crassa OR74A]
          Length = 221

 Score = 37.7 bits (86), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 36/59 (61%), Gaps = 2/59 (3%)

Query: 11  KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPP 69
           +++Y+  +RGT E DLIL +F    +  ++  +L   +  ++E+D +++ W T  ++PP
Sbjct: 79  RLLYQSRKRGTLESDLILSTFAAAHLGSMTPEQLKQYDLFLDENDWDIYYWAT--QEPP 135


>gi|154273517|ref|XP_001537610.1| conserved hypothetical protein [Ajellomyces capsulatus NAm1]
 gi|150415218|gb|EDN10571.1| conserved hypothetical protein [Ajellomyces capsulatus NAm1]
          Length = 308

 Score = 37.7 bits (86), Expect = 0.56,   Method: Composition-based stats.
 Identities = 17/65 (26%), Positives = 36/65 (55%), Gaps = 1/65 (1%)

Query: 5   MNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTG 64
           M ++ R ++Y+  +RG  E DL+L +F    +  ++  +L   +  ++E+D +++ W T 
Sbjct: 145 MTMRAR-LLYQSRKRGILESDLLLSTFASRHLPTMTERQLQEYDKFLDENDWDIYYWATQ 203

Query: 65  MEKPP 69
             K P
Sbjct: 204 EAKDP 208


>gi|296104559|ref|YP_003614705.1| hypothetical protein ECL_04223 [Enterobacter cloacae subsp.
          cloacae ATCC 13047]
 gi|295059018|gb|ADF63756.1| hypothetical protein ECL_04223 [Enterobacter cloacae subsp.
          cloacae ATCC 13047]
          Length = 88

 Score = 37.7 bits (86), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 34/66 (51%)

Query: 5  MNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTG 64
          M++  +  ++   RRG RE+D+ +  F ++    LS  +  +   ++E DD +LF W   
Sbjct: 1  MDINNKARIHWACRRGMRELDISIMPFFEYEYDSLSDEDKRLFVRLLESDDPDLFNWLMN 60

Query: 65 MEKPPE 70
            KP +
Sbjct: 61 HGKPAD 66


>gi|295097433|emb|CBK86523.1| Uncharacterized conserved protein [Enterobacter cloacae subsp.
          cloacae NCTC 9394]
          Length = 88

 Score = 37.7 bits (86), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 34/66 (51%)

Query: 5  MNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTG 64
          M++  +  ++   RRG RE+D+ +  F ++    LS  +  +   ++E DD +LF W   
Sbjct: 1  MDINNKARIHWACRRGMRELDISIMPFFEYEYDSLSDDDKRLFVRLLESDDPDLFNWLMN 60

Query: 65 MEKPPE 70
            KP +
Sbjct: 61 HGKPAD 66


>gi|254785326|ref|YP_003072755.1| response regulator receiver domain-containing protein
          [Teredinibacter turnerae T7901]
 gi|237685750|gb|ACR13014.1| response regulator receiver domain protein [Teredinibacter
          turnerae T7901]
          Length = 107

 Score = 37.4 bits (85), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 32/53 (60%)

Query: 18 RRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          RRG  E+DL+L  F+++    L++ +  + E+++E +D +LF WF     P +
Sbjct: 35 RRGMLELDLVLLPFLENHFHSLNAEDQQLFETLLECEDQDLFNWFLRKNLPDD 87


>gi|261364262|ref|ZP_05977145.1| TPR repeat protein [Neisseria mucosa ATCC 25996]
 gi|288567504|gb|EFC89064.1| TPR repeat protein [Neisseria mucosa ATCC 25996]
          Length = 82

 Score = 37.4 bits (85), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 37/75 (49%), Gaps = 1/75 (1%)

Query: 6  NLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGM 65
          ++  RKI ++  RRG  E+DLI G F++    +LS  EL+    I+E  D  L     G 
Sbjct: 6  DIAKRKIRFQT-RRGLLELDLIFGRFMEKEFEQLSDKELSEFSEILEFQDQELLALINGH 64

Query: 66 EKPPEYLRTPIFKKI 80
              +    P+ +KI
Sbjct: 65 SATDKEHLIPMLEKI 79


>gi|259149415|emb|CAY86219.1| Emi5p [Saccharomyces cerevisiae EC1118]
          Length = 162

 Score = 37.4 bits (85), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 19/80 (23%), Positives = 44/80 (55%), Gaps = 4/80 (5%)

Query: 11  KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEK--- 67
           +++Y+  +RG  E DL+L  F   ++ +++  EL   +S++ E D +++ W T   K   
Sbjct: 68  RLIYQSRKRGILETDLLLSGFAAKYLKKMNEEELEEYDSLLNELDWDIYYWATKNFKTSP 127

Query: 68  -PPEYLRTPIFKKIYDYYSN 86
            P ++  + + K++ ++  N
Sbjct: 128 LPDKWANSKLLKQLQEFSEN 147


>gi|6324501|ref|NP_014570.1| Emi5p [Saccharomyces cerevisiae S288c]
 gi|73620872|sp|Q08230|SDHF2_YEAST RecName: Full=Succinate dehydrogenase assembly factor 2,
           mitochondrial; Short=SDH assembly factor 2; AltName:
           Full=Early meiotic induction protein 5; AltName:
           Full=Succinate dehydrogenase subunit 5, mitochondrial;
           Flags: Precursor
 gi|1419897|emb|CAA99081.1| unnamed protein product [Saccharomyces cerevisiae]
 gi|256273938|gb|EEU08857.1| Emi5p [Saccharomyces cerevisiae JAY291]
 gi|285814819|tpg|DAA10712.1| TPA: Emi5p [Saccharomyces cerevisiae S288c]
          Length = 162

 Score = 37.4 bits (85), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 19/80 (23%), Positives = 44/80 (55%), Gaps = 4/80 (5%)

Query: 11  KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEK--- 67
           +++Y+  +RG  E DL+L  F   ++ +++  EL   +S++ E D +++ W T   K   
Sbjct: 68  RLIYQSRKRGILETDLLLSGFAAKYLKKMNEEELEEYDSLLNELDWDIYYWATKNFKTSP 127

Query: 68  -PPEYLRTPIFKKIYDYYSN 86
            P ++  + + K++ ++  N
Sbjct: 128 LPDKWANSKLLKQLQEFSEN 147


>gi|119774008|ref|YP_926748.1| hypothetical protein Sama_0871 [Shewanella amazonensis SB2B]
 gi|119766508|gb|ABL99078.1| conserved hypothetical protein [Shewanella amazonensis SB2B]
          Length = 79

 Score = 37.4 bits (85), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 33/60 (55%), Gaps = 1/60 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          ++ + C RRG  E+D++   FV++    LS  +  +   ++  +D  LF WF G E+ P+
Sbjct: 5  RVRWAC-RRGMLELDVLFQPFVENHYEALSDEQKAVFVRLLACEDPELFAWFMGHEQCPD 63


>gi|257096792|sp|B3LIY9|SDHF2_YEAS1 RecName: Full=Succinate dehydrogenase assembly factor 2,
           mitochondrial; Short=SDH assembly factor 2; AltName:
           Full=Early meiotic induction protein 5; AltName:
           Full=Succinate dehydrogenase subunit 5, mitochondrial;
           Flags: Precursor
 gi|257096793|sp|A6ZND9|SDHF2_YEAS7 RecName: Full=Succinate dehydrogenase assembly factor 2,
           mitochondrial; Short=SDH assembly factor 2; AltName:
           Full=Early meiotic induction protein 5; AltName:
           Full=Succinate dehydrogenase subunit 5, mitochondrial;
           Flags: Precursor
 gi|151945563|gb|EDN63804.1| early meiotic induction protein [Saccharomyces cerevisiae YJM789]
 gi|190407275|gb|EDV10542.1| early meiotic induction protein 5, mitochondrial precursor
           [Saccharomyces cerevisiae RM11-1a]
          Length = 162

 Score = 37.4 bits (85), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 19/80 (23%), Positives = 44/80 (55%), Gaps = 4/80 (5%)

Query: 11  KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEK--- 67
           +++Y+  +RG  E DL+L  F   ++ +++  EL   +S++ E D +++ W T   K   
Sbjct: 68  RLIYQSRKRGILETDLLLSGFAAKYLKKMNEEELEEYDSLLNELDWDIYYWATKNFKTSP 127

Query: 68  -PPEYLRTPIFKKIYDYYSN 86
            P ++  + + K++ ++  N
Sbjct: 128 LPDKWANSKLLKQLQEFSEN 147


>gi|195123470|ref|XP_002006229.1| GI20928 [Drosophila mojavensis]
 gi|257096760|sp|B4KPG8|SDF2B_DROMO RecName: Full=Succinate dehydrogenase assembly factor 2-B,
           mitochondrial; Short=SDH assembly factor 2-B; AltName:
           Full=Succinate dehydrogenase subunit 5-B, mitochondrial;
           Flags: Precursor
 gi|193911297|gb|EDW10164.1| GI20928 [Drosophila mojavensis]
          Length = 157

 Score = 37.4 bits (85), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 44/76 (57%), Gaps = 4/76 (5%)

Query: 7   LQCRK--IVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIE--EDDSNLFKWF 62
           L+ RK  ++Y+  +RG  E DL+L +F   ++ + ++ +  + + +I    +D +++ W 
Sbjct: 56  LETRKQRLMYQSRKRGMLENDLLLSTFAHKYLKDFNAEQTALYDDLINGVSNDWDIYYWA 115

Query: 63  TGMEKPPEYLRTPIFK 78
           TG+++ P+   T I K
Sbjct: 116 TGVKQTPKEYDTEIMK 131


>gi|195026384|ref|XP_001986244.1| GH20634 [Drosophila grimshawi]
 gi|193902244|gb|EDW01111.1| GH20634 [Drosophila grimshawi]
          Length = 206

 Score = 37.4 bits (85), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 39/65 (60%), Gaps = 3/65 (4%)

Query: 10  RKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIE--EDDSNLFKWFTGMEK 67
           ++++Y+  +RG  E DL+L +FV  ++ + S+ +  + + +I    +D +++ W T  + 
Sbjct: 116 QRLLYQSRKRGMLENDLLLSTFVAKYLKDFSAEQTALYDQLINGVSNDWDIYYWATNTKP 175

Query: 68  -PPEY 71
            PPEY
Sbjct: 176 TPPEY 180


>gi|323346709|gb|EGA80993.1| Emi5p [Saccharomyces cerevisiae Lalvin QA23]
          Length = 159

 Score = 37.4 bits (85), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 19/80 (23%), Positives = 44/80 (55%), Gaps = 4/80 (5%)

Query: 11  KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEK--- 67
           +++Y+  +RG  E DL+L  F   ++ +++  EL   +S++ E D +++ W T   K   
Sbjct: 65  RLIYQSRKRGILETDLLLSGFAAKYLKKMNEEELEEYDSLLNELDWDIYYWATKNFKTSP 124

Query: 68  -PPEYLRTPIFKKIYDYYSN 86
            P ++  + + K++ ++  N
Sbjct: 125 LPDKWANSKLLKQLQEFSEN 144


>gi|71281404|ref|YP_270786.1| TPR repeat-containing protein [Colwellia psychrerythraea 34H]
 gi|81175085|sp|Q47WN6|Y4131_COLP3 RecName: Full=UPF0350 protein CPS_4131
 gi|71147144|gb|AAZ27617.1| TPR repeat protein [Colwellia psychrerythraea 34H]
          Length = 91

 Score = 37.4 bits (85), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 30/56 (53%), Gaps = 1/56 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGME 66
          ++ + C RRG  E+D++   FVD    ELS+ +    E ++   D  LF WF G E
Sbjct: 17 RLKWAC-RRGMLELDVLFIPFVDEAYDELSTKDQFTFERLLTGQDPELFAWFMGHE 71


>gi|323303142|gb|EGA56944.1| Emi5p [Saccharomyces cerevisiae FostersB]
          Length = 162

 Score = 37.4 bits (85), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 19/80 (23%), Positives = 44/80 (55%), Gaps = 4/80 (5%)

Query: 11  KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEK--- 67
           +++Y+  +RG  E DL+L  F   ++ +++  EL   +S++ E D +++ W T   K   
Sbjct: 68  RLIYQSRKRGILETDLLLSGFAAKYLKKMNEEELEEYDSLLNELDWDIYYWATKNFKTSP 127

Query: 68  -PPEYLRTPIFKKIYDYYSN 86
            P ++  + + K++ ++  N
Sbjct: 128 LPDKWXNSKLLKQLQEFSEN 147


>gi|261342300|ref|ZP_05970158.1| TPR repeat protein [Enterobacter cancerogenus ATCC 35316]
 gi|288315641|gb|EFC54579.1| TPR repeat protein [Enterobacter cancerogenus ATCC 35316]
          Length = 88

 Score = 37.4 bits (85), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 34/66 (51%)

Query: 5  MNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTG 64
          M++  +  ++   RRG RE+D+ +  F ++    LS  +  +   ++E DD +LF W   
Sbjct: 1  MDINNKARIHWACRRGMRELDISIMPFFEYEYDTLSDDDKRLFVRLLESDDPDLFNWLMN 60

Query: 65 MEKPPE 70
            KP +
Sbjct: 61 HGKPAD 66


>gi|307262003|ref|ZP_07543658.1| hypothetical protein appser12_15530 [Actinobacillus
          pleuropneumoniae serovar 12 str. 1096]
 gi|306868286|gb|EFN00108.1| hypothetical protein appser12_15530 [Actinobacillus
          pleuropneumoniae serovar 12 str. 1096]
          Length = 82

 Score = 37.4 bits (85), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 30/59 (50%), Gaps = 1/59 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPP 69
          +I + C RRG RE+D ++  F   +  ELS  +     ++++  D  LF+WF      P
Sbjct: 8  RIEWEC-RRGMRELDKMIMPFYKEYFDELSEAQQQTFVAMLKYTDPELFRWFMHQAPAP 65


>gi|323331664|gb|EGA73078.1| Emi5p [Saccharomyces cerevisiae AWRI796]
          Length = 159

 Score = 37.4 bits (85), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 19/80 (23%), Positives = 44/80 (55%), Gaps = 4/80 (5%)

Query: 11  KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEK--- 67
           +++Y+  +RG  E DL+L  F   ++ +++  EL   +S++ E D +++ W T   K   
Sbjct: 65  RLIYQSRKRGILETDLLLSGFAAKYLKKMNEEELEEYDSLLNELDWDIYYWATKNFKTSP 124

Query: 68  -PPEYLRTPIFKKIYDYYSN 86
            P ++  + + K++ ++  N
Sbjct: 125 LPDKWANSKLLKQLQEFSEN 144


>gi|50422655|ref|XP_459903.1| DEHA2E13750p [Debaryomyces hansenii CBS767]
 gi|74601961|sp|Q6BPG7|SDHF2_DEBHA RecName: Full=Succinate dehydrogenase assembly factor 2,
           mitochondrial; Short=SDH assembly factor 2; AltName:
           Full=Early meiotic induction protein 5; AltName:
           Full=Succinate dehydrogenase subunit 5, mitochondrial;
           Flags: Precursor
 gi|49655571|emb|CAG88145.1| DEHA2E13750p [Debaryomyces hansenii]
          Length = 142

 Score = 37.4 bits (85), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 16/61 (26%), Positives = 36/61 (59%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
           ++++++  ++VY+  +RG  E DL+L  F   ++   S  EL   + +++E D +++ W 
Sbjct: 44  ESIDVKRARLVYQSRKRGILESDLLLSRFAKRYLSGFSQEELDEYDKLLDEPDWDIYYWA 103

Query: 63  T 63
           T
Sbjct: 104 T 104


>gi|33151335|ref|NP_872688.1| hypothetical protein HD0065 [Haemophilus ducreyi 35000HP]
 gi|81175058|sp|Q7VPK3|Y065_HAEDU RecName: Full=UPF0350 protein HD_0065
 gi|33147555|gb|AAP95077.1| conserved hypothetical protein [Haemophilus ducreyi 35000HP]
          Length = 82

 Score = 37.4 bits (85), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 34/70 (48%), Gaps = 1/70 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          KI ++C RRG RE+D ++  F   +  +LS  E     +++   D  LF+W       P 
Sbjct: 8  KIEWQC-RRGMRELDKMIMPFYQQYFEQLSEAEQRTFVTMLSYTDPELFRWVMHQSPAPT 66

Query: 71 YLRTPIFKKI 80
             + + ++I
Sbjct: 67 VAISALIERI 76


>gi|260771931|ref|ZP_05880849.1| hypothetical protein VIB_000370 [Vibrio metschnikovii CIP 69.14]
 gi|260613223|gb|EEX38424.1| hypothetical protein VIB_000370 [Vibrio metschnikovii CIP 69.14]
          Length = 86

 Score = 37.4 bits (85), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 34/73 (46%), Gaps = 1/73 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          ++ + C RRG  E+D+++  F +     LS  E     S++E DD +LF W  G  +   
Sbjct: 9  RVKWAC-RRGMLELDVVVMPFFEECFEALSESEQQDFVSLLECDDPDLFTWIMGHGRSEN 67

Query: 71 YLRTPIFKKIYDY 83
               +  KI  Y
Sbjct: 68 LGHAAMVDKIVAY 80


>gi|256821969|ref|YP_003145932.1| hypothetical protein Kkor_0744 [Kangiella koreensis DSM 16069]
 gi|256795508|gb|ACV26164.1| protein of unknown function DUF339 [Kangiella koreensis DSM
          16069]
          Length = 84

 Score = 37.4 bits (85), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 30/55 (54%), Gaps = 1/55 (1%)

Query: 18 RRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKP-PEY 71
          RRG  E+D++L  +++    +    +     + +E+DD +L+ W  G E P PE+
Sbjct: 14 RRGMLELDVVLIPYLEEEACQFDDAKSAEYATFLEQDDPDLYAWIMGYETPKPEF 68


>gi|251791000|ref|YP_003005721.1| hypothetical protein Dd1591_3430 [Dickeya zeae Ech1591]
 gi|247539621|gb|ACT08242.1| protein of unknown function DUF339 [Dickeya zeae Ech1591]
          Length = 90

 Score = 37.4 bits (85), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 33/65 (50%)

Query: 4  NMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFT 63
          NM++  +  ++   RRG RE+D+ +  F +H    LS  +      +++ DD +LF W  
Sbjct: 2  NMDINNKARIHWACRRGMRELDISIMPFFEHDYDTLSDDDKQQFIRLLQCDDPDLFNWLM 61

Query: 64 GMEKP 68
             +P
Sbjct: 62 NHGEP 66


>gi|195024675|ref|XP_001985919.1| GH20828 [Drosophila grimshawi]
 gi|257096772|sp|B4J5U3|SDHF2_DROGR RecName: Full=Succinate dehydrogenase assembly factor 2,
           mitochondrial; Short=SDH assembly factor 2; AltName:
           Full=Succinate dehydrogenase subunit 5, mitochondrial;
           Flags: Precursor
 gi|193901919|gb|EDW00786.1| GH20828 [Drosophila grimshawi]
          Length = 147

 Score = 37.4 bits (85), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 17/70 (24%), Positives = 41/70 (58%), Gaps = 3/70 (4%)

Query: 5   MNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIE--EDDSNLFKWF 62
           + ++ ++++Y+  +RG  E DL+L +F   ++ +    E  + + +I    +D +++ W 
Sbjct: 48  LGMRKQRLLYQSRKRGMLENDLLLSTFAHKYLKDFDEDETAIYDELINGVSNDWDIYYWA 107

Query: 63  TGMEK-PPEY 71
           TG++  PP+Y
Sbjct: 108 TGVKPTPPQY 117


>gi|77359674|ref|YP_339249.1| hypothetical protein PSHAa0723 [Pseudoalteromonas haloplanktis
          TAC125]
 gi|76874585|emb|CAI85806.1| conserved protein of unknown function(ygfY) [Pseudoalteromonas
          haloplanktis TAC125]
          Length = 83

 Score = 37.0 bits (84), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 31/54 (57%), Gaps = 1/54 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTG 64
          +I + C RRG  E+D++   FV+     LS  +  + + ++ E+D +LF WF G
Sbjct: 9  RIRWAC-RRGMLELDVLFMPFVEDAFDSLSVEQQAIFQRLLTEEDPDLFAWFMG 61


>gi|225075120|ref|ZP_03718319.1| hypothetical protein NEIFLAOT_00119 [Neisseria flavescens
          NRL30031/H210]
 gi|241760393|ref|ZP_04758488.1| TPR repeat region family protein [Neisseria flavescens SK114]
 gi|261379701|ref|ZP_05984274.1| TPR repeat protein [Neisseria subflava NJ9703]
 gi|319637653|ref|ZP_07992419.1| hypothetical protein HMPREF0604_00042 [Neisseria mucosa C102]
 gi|224953604|gb|EEG34813.1| hypothetical protein NEIFLAOT_00119 [Neisseria flavescens
          NRL30031/H210]
 gi|241319271|gb|EER55749.1| TPR repeat region family protein [Neisseria flavescens SK114]
 gi|284797365|gb|EFC52712.1| TPR repeat protein [Neisseria subflava NJ9703]
 gi|317400808|gb|EFV81463.1| hypothetical protein HMPREF0604_00042 [Neisseria mucosa C102]
          Length = 82

 Score = 37.0 bits (84), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 36/75 (48%), Gaps = 1/75 (1%)

Query: 6  NLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGM 65
          ++  RKI ++  RRG  E+DLI G F++     LS  EL+    I+E  D  L     G 
Sbjct: 6  DIAKRKIRFQT-RRGLLELDLIFGRFMEKEFEHLSDQELSEFSEILEFQDQELLALINGH 64

Query: 66 EKPPEYLRTPIFKKI 80
              +    P+ +KI
Sbjct: 65 SATDKKHLIPMLEKI 79


>gi|320591871|gb|EFX04310.1| tpr repeat protein [Grosmannia clavigera kw1407]
          Length = 250

 Score = 37.0 bits (84), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 14/53 (26%), Positives = 33/53 (62%)

Query: 11  KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFT 63
           +++Y+  +RGT E DL+L +F    +  +++ +L   +  ++E+D +++ W T
Sbjct: 92  RLLYQSRKRGTLESDLLLSTFAAQHLGSMTAAQLDEYDRFLDENDWDIYYWVT 144


>gi|271499206|ref|YP_003332231.1| hypothetical protein Dd586_0633 [Dickeya dadantii Ech586]
 gi|270342761|gb|ACZ75526.1| protein of unknown function DUF339 [Dickeya dadantii Ech586]
          Length = 90

 Score = 37.0 bits (84), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 33/65 (50%)

Query: 4  NMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFT 63
          NM++  +  ++   RRG RE+D+ +  F +H    LS  +      +++ DD +LF W  
Sbjct: 2  NMDINNKARIHWACRRGMRELDISIMPFFEHEYDTLSDDDKQQFIRLLQCDDPDLFNWLM 61

Query: 64 GMEKP 68
             +P
Sbjct: 62 NHGEP 66


>gi|195475352|ref|XP_002089948.1| GE21507 [Drosophila yakuba]
 gi|257096766|sp|B4NXN5|SDF2B_DROYA RecName: Full=Succinate dehydrogenase assembly factor 2-B,
           mitochondrial; Short=SDH assembly factor 2-B; AltName:
           Full=Succinate dehydrogenase subunit 5-B, mitochondrial;
           Flags: Precursor
 gi|194176049|gb|EDW89660.1| GE21507 [Drosophila yakuba]
          Length = 156

 Score = 37.0 bits (84), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 22/91 (24%), Positives = 48/91 (52%), Gaps = 4/91 (4%)

Query: 1   MKKNMNLQCRK--IVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIE--EDDS 56
           ++ +  L+ RK  ++Y+  +RG  E DL+L +FV  ++ + S+ +    + +I    +D 
Sbjct: 55  VRPDEPLETRKQRLLYQSRKRGMLENDLLLSTFVAKYLKDFSAEQTAEYDQLINGVSNDW 114

Query: 57  NLFKWFTGMEKPPEYLRTPIFKKIYDYYSNN 87
           ++F W T  +  P    T I + + ++  N+
Sbjct: 115 DIFYWATDTKPTPPQFDTEIMRLLKEHVKNH 145


>gi|242011721|ref|XP_002426595.1| early meiotic induction protein 5, putative [Pediculus humanus
           corporis]
 gi|212510744|gb|EEB13857.1| early meiotic induction protein 5, putative [Pediculus humanus
           corporis]
          Length = 151

 Score = 37.0 bits (84), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 17/78 (21%), Positives = 42/78 (53%), Gaps = 2/78 (2%)

Query: 11  KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIE--EDDSNLFKWFTGMEKP 68
           +++Y+  +RG  E DL+L +F    + +++  +L++ + +I    +D +++ W TG +  
Sbjct: 58  RLMYQSRKRGMLENDLVLSTFAAEHLHKMTENQLSLYDRLINLPSNDWDIYYWATGGKPT 117

Query: 69  PEYLRTPIFKKIYDYYSN 86
           PE     +   + ++  N
Sbjct: 118 PEEFNNEVMNMLKEHIKN 135


>gi|15676845|ref|NP_273990.1| hypothetical protein NMB0952 [Neisseria meningitidis MC58]
 gi|121634754|ref|YP_974999.1| hypothetical protein NMC0929 [Neisseria meningitidis FAM18]
 gi|161869865|ref|YP_001599034.1| hypothetical protein NMCC_0896 [Neisseria meningitidis 053442]
 gi|218768036|ref|YP_002342548.1| hypothetical protein NMA1147 [Neisseria meningitidis Z2491]
 gi|254804835|ref|YP_003083056.1| hypothetical protein NMO_0849 [Neisseria meningitidis alpha14]
 gi|304387743|ref|ZP_07369923.1| TPR repeat protein [Neisseria meningitidis ATCC 13091]
 gi|50513319|pdb|1PUZ|A Chain A, Solution Nmr Structure Of Protein Nma1147 From Neisseria
          Meningitidis. Northeast Structural Genomics Consortium
          Target Mr19
 gi|7226191|gb|AAF41358.1| conserved hypothetical protein [Neisseria meningitidis MC58]
 gi|120866460|emb|CAM10206.1| hypothetical protein NMC0929 [Neisseria meningitidis FAM18]
 gi|121052044|emb|CAM08353.1| hypothetical protein NMA1147 [Neisseria meningitidis Z2491]
 gi|161595418|gb|ABX73078.1| conserved hypothetical protein [Neisseria meningitidis 053442]
 gi|254668377|emb|CBA05473.1| conserved hypothetical protein [Neisseria meningitidis alpha14]
 gi|254671325|emb|CBA08728.1| conserved hypothetical protein [Neisseria meningitidis alpha153]
 gi|254672876|emb|CBA07140.1| conserved hypothetical protein [Neisseria meningitidis alpha275]
 gi|261392700|emb|CAX50273.1| conserved hypothetical TPR-containing protein [Neisseria
          meningitidis 8013]
 gi|304338219|gb|EFM04349.1| TPR repeat protein [Neisseria meningitidis ATCC 13091]
 gi|308389609|gb|ADO31929.1| hypothetical protein NMBB_1677 [Neisseria meningitidis alpha710]
 gi|319410285|emb|CBY90627.1| conserved hypothetical TPR-containing protein [Neisseria
          meningitidis WUE 2594]
 gi|325128089|gb|EGC50984.1| TPR repeat protein [Neisseria meningitidis N1568]
 gi|325140158|gb|EGC62685.1| TPR repeat protein [Neisseria meningitidis CU385]
 gi|325144256|gb|EGC66561.1| TPR repeat protein [Neisseria meningitidis M01-240013]
 gi|325200363|gb|ADY95818.1| TPR repeat protein [Neisseria meningitidis H44/76]
          Length = 82

 Score = 37.0 bits (84), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 37/75 (49%), Gaps = 1/75 (1%)

Query: 6  NLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGM 65
          ++  RKI ++  RRG  E+DLI G F++     LS  EL+    I+E  D  L     G 
Sbjct: 6  DIAKRKIRFQT-RRGLLELDLIFGRFMEKEFEHLSDKELSEFSEILEFQDQELLALINGH 64

Query: 66 EKPPEYLRTPIFKKI 80
           +  +    P+ +KI
Sbjct: 65 SETDKGHLIPMLEKI 79


>gi|68465050|ref|XP_723224.1| hypothetical protein CaO19.12190 [Candida albicans SC5314]
 gi|46445250|gb|EAL04519.1| hypothetical protein CaO19.12190 [Candida albicans SC5314]
          Length = 155

 Score = 37.0 bits (84), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 21/88 (23%), Positives = 47/88 (53%), Gaps = 4/88 (4%)

Query: 4   NMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFT 63
            + ++  +++Y+  +RG  E DL+L  F D ++  ++  EL   + +++E D +++ W T
Sbjct: 49  TIEVKRARLLYQSRKRGILESDLLLSRFADKYLKTMTMEELDEYDKLLDEADWDIYYWAT 108

Query: 64  GMEK----PPEYLRTPIFKKIYDYYSNN 87
              K    P ++  + I K+I    +N+
Sbjct: 109 KNYKITPLPDKWKDSKILKEIQKIANND 136


>gi|316985355|gb|EFV64304.1| conserved hypothetical protein [Neisseria meningitidis H44/76]
 gi|325130097|gb|EGC52881.1| TPR repeat protein [Neisseria meningitidis OX99.30304]
 gi|325132165|gb|EGC54861.1| TPR repeat protein [Neisseria meningitidis M6190]
 gi|325134131|gb|EGC56783.1| TPR repeat protein [Neisseria meningitidis M13399]
 gi|325136112|gb|EGC58721.1| TPR repeat protein [Neisseria meningitidis M0579]
 gi|325138097|gb|EGC60670.1| TPR repeat protein [Neisseria meningitidis ES14902]
 gi|325142227|gb|EGC64645.1| TPR repeat protein [Neisseria meningitidis 961-5945]
 gi|325198185|gb|ADY93641.1| TPR repeat protein [Neisseria meningitidis G2136]
 gi|325202260|gb|ADY97714.1| TPR repeat protein [Neisseria meningitidis M01-240149]
 gi|325204024|gb|ADY99477.1| TPR repeat protein [Neisseria meningitidis M01-240355]
 gi|325206217|gb|ADZ01670.1| TPR repeat protein [Neisseria meningitidis M04-240196]
 gi|325207987|gb|ADZ03439.1| TPR repeat protein [Neisseria meningitidis NZ-05/33]
          Length = 81

 Score = 37.0 bits (84), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 37/75 (49%), Gaps = 1/75 (1%)

Query: 6  NLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGM 65
          ++  RKI ++  RRG  E+DLI G F++     LS  EL+    I+E  D  L     G 
Sbjct: 5  DIAKRKIRFQT-RRGLLELDLIFGRFMEKEFEHLSDKELSEFSEILEFQDQELLALINGH 63

Query: 66 EKPPEYLRTPIFKKI 80
           +  +    P+ +KI
Sbjct: 64 SETDKGHLIPMLEKI 78


>gi|146312955|ref|YP_001178029.1| hypothetical protein Ent638_3315 [Enterobacter sp. 638]
 gi|145319831|gb|ABP61978.1| protein of unknown function DUF339 [Enterobacter sp. 638]
          Length = 88

 Score = 37.0 bits (84), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 34/66 (51%)

Query: 5  MNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTG 64
          M++  +  ++   RRG RE+D+ +  F ++    LS  +  +   ++E DD +LF W   
Sbjct: 1  MDISNKARIHWACRRGMRELDISVMPFFEYEYDSLSDDDKRLFIRLLESDDPDLFNWLMN 60

Query: 65 MEKPPE 70
            KP +
Sbjct: 61 HGKPAD 66


>gi|29654197|ref|NP_819889.1| TPR repeat protein [Coxiella burnetii RSA 493]
 gi|153209216|ref|ZP_01947282.1| TPR repeat protein [Coxiella burnetii 'MSU Goat Q177']
 gi|154705902|ref|YP_001424315.1| tetratricopeptide repeat family protein [Coxiella burnetii Dugway
          5J108-111]
 gi|161830976|ref|YP_001596837.1| TPR repeat-containing protein [Coxiella burnetii RSA 331]
 gi|165918504|ref|ZP_02218590.1| TPR repeat protein [Coxiella burnetii RSA 334]
 gi|212212677|ref|YP_002303613.1| tetratricopeptide repeat family protein [Coxiella burnetii
          CbuG_Q212]
 gi|212218350|ref|YP_002305137.1| tetratricopeptide repeat family protein [Coxiella burnetii
          CbuK_Q154]
 gi|81175092|sp|Q83D70|Y870_COXBU RecName: Full=UPF0350 protein CBU_0870
 gi|29541463|gb|AAO90403.1| tetratricopeptide repeat family protein [Coxiella burnetii RSA
          493]
 gi|120575471|gb|EAX32095.1| TPR repeat protein [Coxiella burnetii 'MSU Goat Q177']
 gi|154355188|gb|ABS76650.1| tetratricopeptide repeat family protein [Coxiella burnetii Dugway
          5J108-111]
 gi|161762843|gb|ABX78485.1| TPR repeat protein [Coxiella burnetii RSA 331]
 gi|165917750|gb|EDR36354.1| TPR repeat protein [Coxiella burnetii RSA 334]
 gi|212011087|gb|ACJ18468.1| tetratricopeptide repeat family protein [Coxiella burnetii
          CbuG_Q212]
 gi|212012612|gb|ACJ19992.1| tetratricopeptide repeat family protein [Coxiella burnetii
          CbuK_Q154]
          Length = 82

 Score = 37.0 bits (84), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 38/82 (46%), Gaps = 1/82 (1%)

Query: 4  NMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFT 63
          N  L  +KI ++C RRG  E+D++L  F +     L+  E  +   ++++ D  L+ W  
Sbjct: 2  NEPLASKKIRWKC-RRGMLELDILLERFYEEKFRSLTKNEKEIFNQLLDQPDPLLYDWLL 60

Query: 64 GMEKPPEYLRTPIFKKIYDYYS 85
          G   P       I +KI    S
Sbjct: 61 GHVTPESSEFKKIIRKIQQLSS 82


>gi|68464673|ref|XP_723414.1| hypothetical protein CaO19.4727 [Candida albicans SC5314]
 gi|46445447|gb|EAL04715.1| hypothetical protein CaO19.4727 [Candida albicans SC5314]
 gi|238878710|gb|EEQ42348.1| conserved hypothetical protein [Candida albicans WO-1]
          Length = 155

 Score = 37.0 bits (84), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 21/89 (23%), Positives = 48/89 (53%), Gaps = 4/89 (4%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
           + + ++  +++Y+  +RG  E DL+L  F D ++  ++  EL   + +++E D +++ W 
Sbjct: 48  ETIEVKRARLLYQSRKRGILESDLLLSRFADKYLKTMTMEELDEYDKLLDEADWDIYYWA 107

Query: 63  TGMEK----PPEYLRTPIFKKIYDYYSNN 87
           T   K    P ++  + I K+I    +N+
Sbjct: 108 TKNYKITPLPDKWKDSKILKEIQKIANND 136


>gi|71066291|ref|YP_265018.1| hypothetical protein Psyc_1736 [Psychrobacter arcticus 273-4]
 gi|81175068|sp|Q4FQX4|Y1736_PSYA2 RecName: Full=UPF0350 protein Psyc_1736
 gi|71039276|gb|AAZ19584.1| conserved hypothetical protein [Psychrobacter arcticus 273-4]
          Length = 93

 Score = 37.0 bits (84), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 15/61 (24%), Positives = 30/61 (49%), Gaps = 1/61 (1%)

Query: 8  QCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEK 67
          + R+I+Y+  RRG +E+D     ++    L   + E      ++  +D +L  +FT   +
Sbjct: 12 EQRRIIYQA-RRGLKELDFYFEPYIKELYLTAEAAEQESFAQMLTHEDPDLLDYFTNQSR 70

Query: 68 P 68
          P
Sbjct: 71 P 71


>gi|255065297|ref|ZP_05317152.1| TPR repeat protein [Neisseria sicca ATCC 29256]
 gi|255050718|gb|EET46182.1| TPR repeat protein [Neisseria sicca ATCC 29256]
          Length = 82

 Score = 37.0 bits (84), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 36/75 (48%), Gaps = 1/75 (1%)

Query: 6  NLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGM 65
          ++  RKI ++  RRG  E+DLI G F++     LS  EL+    I+E  D  L     G 
Sbjct: 6  DIAKRKIRFQT-RRGLLELDLIFGRFMEKEFEHLSDKELSEFSEILEFQDQELLALINGH 64

Query: 66 EKPPEYLRTPIFKKI 80
              +    P+ +KI
Sbjct: 65 SATDKEHLIPMLEKI 79


>gi|261820172|ref|YP_003258278.1| hypothetical protein Pecwa_0852 [Pectobacterium wasabiae WPP163]
 gi|261604185|gb|ACX86671.1| protein of unknown function DUF339 [Pectobacterium wasabiae
          WPP163]
          Length = 88

 Score = 37.0 bits (84), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 16/64 (25%), Positives = 32/64 (50%)

Query: 5  MNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTG 64
          M +  +  ++   RRG RE+D+ +  F +H    L+ ++      +++ DD +LF W   
Sbjct: 1  MEIDNKSRIHWACRRGMRELDIAIMPFFEHDYDTLNDIDKRTFVRLLQSDDPDLFNWLMN 60

Query: 65 MEKP 68
            +P
Sbjct: 61 HGEP 64


>gi|260785960|ref|XP_002588027.1| hypothetical protein BRAFLDRAFT_83004 [Branchiostoma floridae]
 gi|229273184|gb|EEN44038.1| hypothetical protein BRAFLDRAFT_83004 [Branchiostoma floridae]
          Length = 150

 Score = 36.6 bits (83), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 19/73 (26%), Positives = 40/73 (54%), Gaps = 4/73 (5%)

Query: 2   KKNMNLQCRK--IVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEE--DDSN 57
           K+N   + R+  ++Y+  +RG  E  L+  +F D ++ +    +L + + +I E  +D  
Sbjct: 47  KQNEPFETRRARLLYQSRKRGMLENGLLFSTFADRYLNKFDEQQLKLYDRLINEPSNDWE 106

Query: 58  LFKWFTGMEKPPE 70
           ++ W TG++  PE
Sbjct: 107 IYYWVTGVKPTPE 119


>gi|195153451|ref|XP_002017639.1| GL17204 [Drosophila persimilis]
 gi|257096761|sp|B4GG58|SDF2B_DROPE RecName: Full=Succinate dehydrogenase assembly factor 2-B,
           mitochondrial; Short=SDH assembly factor 2-B; AltName:
           Full=Succinate dehydrogenase subunit 5-B, mitochondrial;
           Flags: Precursor
 gi|194113435|gb|EDW35478.1| GL17204 [Drosophila persimilis]
          Length = 157

 Score = 36.6 bits (83), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 42/76 (55%), Gaps = 5/76 (6%)

Query: 1   MKKNMNLQCRK--IVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIE--EDDS 56
           ++ +  L+ RK  ++Y+  +RG  E DL+L +FV   + + S+ +    + +I    +D 
Sbjct: 56  LRPDEPLETRKQRLLYQSRKRGMLENDLLLSTFVAKHLRDFSAAQTAQYDDLINGVSNDW 115

Query: 57  NLFKWFTGMEK-PPEY 71
           ++F W T  +  PP+Y
Sbjct: 116 DIFYWATETKPTPPQY 131


>gi|189188108|ref|XP_001930393.1| conserved hypothetical protein [Pyrenophora tritici-repentis
           Pt-1C-BFP]
 gi|187971999|gb|EDU39498.1| conserved hypothetical protein [Pyrenophora tritici-repentis
           Pt-1C-BFP]
          Length = 277

 Score = 36.6 bits (83), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 20/78 (25%), Positives = 40/78 (51%), Gaps = 7/78 (8%)

Query: 18  RRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPEYLRTPIF 77
           +RGT E DL+L +F D  +  +S   +   ++ ++E+D +++ W T  ++P     TP  
Sbjct: 120 KRGTLESDLLLSTFADAHLSTMSPSLMQQYDTFLDENDWDIYYWAT--QEP-----TPTS 172

Query: 78  KKIYDYYSNNLDRKNMLG 95
            +  +   + +  KN  G
Sbjct: 173 HETAEGAGSTMSTKNAQG 190


>gi|255712621|ref|XP_002552593.1| KLTH0C08514p [Lachancea thermotolerans]
 gi|238933972|emb|CAR22155.1| KLTH0C08514p [Lachancea thermotolerans]
          Length = 159

 Score = 36.6 bits (83), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 39/72 (54%), Gaps = 5/72 (6%)

Query: 11  KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
           ++VY+  +RG  E DL+L  F   ++  ++  EL   +++++E D +++ W T       
Sbjct: 66  RLVYQSRKRGILETDLLLSRFAAKYLSSMTPEELEEYDALLDELDWDIYYWATK-----N 120

Query: 71  YLRTPIFKKIYD 82
           Y  TP+ ++  D
Sbjct: 121 YAITPLPERFKD 132


>gi|260826512|ref|XP_002608209.1| hypothetical protein BRAFLDRAFT_90350 [Branchiostoma floridae]
 gi|229293560|gb|EEN64219.1| hypothetical protein BRAFLDRAFT_90350 [Branchiostoma floridae]
          Length = 150

 Score = 36.6 bits (83), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 19/73 (26%), Positives = 40/73 (54%), Gaps = 4/73 (5%)

Query: 2   KKNMNLQCRK--IVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEE--DDSN 57
           K+N   + R+  ++Y+  +RG  E  L+  +F D ++ +    +L + + +I E  +D  
Sbjct: 47  KQNEPFETRRARLLYQSRKRGMLENGLLFSTFADRYLNKFDEQQLKLYDRLINEPSNDWE 106

Query: 58  LFKWFTGMEKPPE 70
           ++ W TG++  PE
Sbjct: 107 IYYWVTGVKPTPE 119


>gi|93006842|ref|YP_581279.1| hypothetical protein Pcryo_2018 [Psychrobacter cryohalolentis K5]
 gi|92394520|gb|ABE75795.1| protein of unknown function DUF339 [Psychrobacter cryohalolentis
          K5]
          Length = 93

 Score = 36.6 bits (83), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 15/61 (24%), Positives = 30/61 (49%), Gaps = 1/61 (1%)

Query: 8  QCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEK 67
          + R+I+Y+  RRG +E+D     ++    L   + E      ++  +D +L  +FT   +
Sbjct: 12 EQRRIIYQA-RRGLKELDFYFEPYIKELYLTAEAAEQESFAQMLTHEDPDLLDYFTNQSR 70

Query: 68 P 68
          P
Sbjct: 71 P 71


>gi|198460563|ref|XP_002138856.1| GA25039 [Drosophila pseudoobscura pseudoobscura]
 gi|257096752|sp|B5E0U2|SDF2A_DROPS RecName: Full=Succinate dehydrogenase assembly factor 2-A,
           mitochondrial; Short=SDH assembly factor 2-A; AltName:
           Full=Succinate dehydrogenase subunit 5-A, mitochondrial;
           Flags: Precursor
 gi|198137059|gb|EDY69414.1| GA25039 [Drosophila pseudoobscura pseudoobscura]
          Length = 157

 Score = 36.6 bits (83), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 42/76 (55%), Gaps = 5/76 (6%)

Query: 1   MKKNMNLQCRK--IVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIE--EDDS 56
           ++ +  L+ RK  ++Y+  +RG  E DL+L +FV   + + S+ +    + +I    +D 
Sbjct: 56  LRPDEPLETRKQRLLYQSRKRGMLENDLLLSTFVAKHLRDFSAAQTAQYDELINGVSNDW 115

Query: 57  NLFKWFTGMEK-PPEY 71
           ++F W T  +  PP+Y
Sbjct: 116 DIFYWATETKPTPPQY 131


>gi|239996334|ref|ZP_04716858.1| TPR repeat protein [Alteromonas macleodii ATCC 27126]
          Length = 83

 Score = 36.6 bits (83), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 27/50 (54%)

Query: 18 RRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEK 67
          RRG  E+D++L  FV+     LS  +    E ++  DD +LF W  G +K
Sbjct: 15 RRGMLELDVLLLPFVEEAFDSLSYEDQETFERLLTSDDPDLFAWIMGHQK 64


>gi|123443582|ref|YP_001007555.1| hypothetical protein YE3386 [Yersinia enterocolitica subsp.
          enterocolitica 8081]
 gi|238763221|ref|ZP_04624186.1| hypothetical protein ykris0001_27970 [Yersinia kristensenii ATCC
          33638]
 gi|122090543|emb|CAL13412.1| conserved hypothetical protein [Yersinia enterocolitica subsp.
          enterocolitica 8081]
 gi|238698494|gb|EEP91246.1| hypothetical protein ykris0001_27970 [Yersinia kristensenii ATCC
          33638]
 gi|318607032|emb|CBY28530.1| ygfy COG2938 [Yersinia enterocolitica subsp. palearctica Y11]
          Length = 88

 Score = 36.6 bits (83), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 31/58 (53%), Gaps = 1/58 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKP 68
          +I + C RRG RE+D+ +  F +H    LS  E  +   ++E DD +LF W     +P
Sbjct: 8  RIHWAC-RRGMRELDISIMPFFEHEYDGLSDNEKQVFIRLLECDDPDLFNWLMNHGEP 64


>gi|332160500|ref|YP_004297077.1| hypothetical protein YE105_C0878 [Yersinia enterocolitica subsp.
          palearctica 105.5R(r)]
 gi|325664730|gb|ADZ41374.1| hypothetical protein YE105_C0878 [Yersinia enterocolitica subsp.
          palearctica 105.5R(r)]
 gi|330863455|emb|CBX73574.1| UPF0350 protein YPO0897/y3282/YP_3594 [Yersinia enterocolitica
          W22703]
          Length = 88

 Score = 36.6 bits (83), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 31/58 (53%), Gaps = 1/58 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKP 68
          +I + C RRG RE+D+ +  F +H    LS  E  +   ++E DD +LF W     +P
Sbjct: 8  RIHWAC-RRGMRELDISIMPFFEHEYDGLSDNEKQVFIRLLECDDPDLFNWLMNHGEP 64


>gi|298369266|ref|ZP_06980584.1| TPR repeat protein [Neisseria sp. oral taxon 014 str. F0314]
 gi|298283269|gb|EFI24756.1| TPR repeat protein [Neisseria sp. oral taxon 014 str. F0314]
          Length = 82

 Score = 36.6 bits (83), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 34/71 (47%), Gaps = 1/71 (1%)

Query: 10 RKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPP 69
          RKI ++  RRG  E+DLI G F++     LS  ELT L  I+   D  L     G     
Sbjct: 10 RKIRFQT-RRGLLELDLIFGRFMEKEFEHLSDDELTCLVEILAFQDQELLSLINGSRTTD 68

Query: 70 EYLRTPIFKKI 80
          +    P+ +KI
Sbjct: 69 KAHLVPMLEKI 79


>gi|260947060|ref|XP_002617827.1| hypothetical protein CLUG_01286 [Clavispora lusitaniae ATCC 42720]
 gi|238847699|gb|EEQ37163.1| hypothetical protein CLUG_01286 [Clavispora lusitaniae ATCC 42720]
          Length = 141

 Score = 36.6 bits (83), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 20/89 (22%), Positives = 45/89 (50%), Gaps = 4/89 (4%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
           + + ++  ++ Y+  +RG  E DL+L  F    +   +  +L   +S+++E D +++ W 
Sbjct: 42  ETLEIKRARLTYQSRKRGILESDLLLSRFAKKHLHTFNMEQLDEYDSLLDEADWDIYYWA 101

Query: 63  TG----MEKPPEYLRTPIFKKIYDYYSNN 87
           TG       P ++  + + KK+ +   NN
Sbjct: 102 TGNYDVTPIPEKWKNSEVMKKLQEDTQNN 130


>gi|253687039|ref|YP_003016229.1| hypothetical protein PC1_0638 [Pectobacterium carotovorum subsp.
          carotovorum PC1]
 gi|251753617|gb|ACT11693.1| protein of unknown function DUF339 [Pectobacterium carotovorum
          subsp. carotovorum PC1]
          Length = 88

 Score = 36.6 bits (83), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 17/64 (26%), Positives = 31/64 (48%)

Query: 5  MNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTG 64
          M +  +  ++   RRG RE+D+ +  F +H    LS  +      +++ DD +LF W   
Sbjct: 1  MEIDNKSRIHWACRRGMRELDIAIMPFFEHDYDTLSDSDKRTFVRLLQSDDPDLFNWLMN 60

Query: 65 MEKP 68
            +P
Sbjct: 61 HGEP 64


>gi|170071902|ref|XP_001870041.1| conserved hypothetical protein [Culex quinquefasciatus]
 gi|257096771|sp|B0XK69|SDHF2_CULQU RecName: Full=Succinate dehydrogenase assembly factor 2,
           mitochondrial; Short=SDH assembly factor 2; AltName:
           Full=Succinate dehydrogenase subunit 5, mitochondrial;
           Flags: Precursor
 gi|167867993|gb|EDS31376.1| conserved hypothetical protein [Culex quinquefasciatus]
          Length = 159

 Score = 36.6 bits (83), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 19/84 (22%), Positives = 44/84 (52%), Gaps = 2/84 (2%)

Query: 5   MNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESII--EEDDSNLFKWF 62
           + LQ  +++Y+  +RG  E  L+L +F   ++  L + +  + +++I    +D ++F W 
Sbjct: 63  LKLQKSRLLYQSRKRGMLENGLLLSTFAAKYLESLDARQTKLYDTLINMPTNDWDIFYWA 122

Query: 63  TGMEKPPEYLRTPIFKKIYDYYSN 86
           TG++  P+     I   + ++  N
Sbjct: 123 TGVKPTPQEYDNEIMNMLKEHVKN 146


>gi|238504186|ref|XP_002383325.1| TPR repeat protein [Aspergillus flavus NRRL3357]
 gi|317138204|ref|XP_003189025.1| succinate dehydrogenase assembly factor 2 [Aspergillus oryzae
           RIB40]
 gi|257096768|sp|B8NT06|SDHF2_ASPFN RecName: Full=Succinate dehydrogenase assembly factor 2,
           mitochondrial; Short=SDH assembly factor 2; AltName:
           Full=Early meiotic induction protein 5; AltName:
           Full=Succinate dehydrogenase subunit 5, mitochondrial;
           Flags: Precursor
 gi|220690796|gb|EED47145.1| TPR repeat protein [Aspergillus flavus NRRL3357]
          Length = 292

 Score = 36.6 bits (83), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 37/59 (62%), Gaps = 2/59 (3%)

Query: 11  KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPP 69
           +++Y+  +RG  E DL+L +F D ++ +++  +L   +  ++E+D +++ W T  + PP
Sbjct: 149 RLLYQSRKRGILESDLLLSTFADVYLSKMNKEQLQEYDRFLDENDWDIYYWAT--QDPP 205


>gi|59801315|ref|YP_208027.1| hypothetical protein NGO0919 [Neisseria gonorrhoeae FA 1090]
 gi|194098446|ref|YP_002001505.1| hypothetical protein NGK_0880 [Neisseria gonorrhoeae NCCP11945]
 gi|254493631|ref|ZP_05106802.1| conserved hypothetical protein [Neisseria gonorrhoeae 1291]
 gi|260440667|ref|ZP_05794483.1| hypothetical protein NgonDG_06210 [Neisseria gonorrhoeae DGI2]
 gi|268594688|ref|ZP_06128855.1| conserved hypothetical protein [Neisseria gonorrhoeae 35/02]
 gi|268596982|ref|ZP_06131149.1| conserved hypothetical protein [Neisseria gonorrhoeae FA19]
 gi|268598839|ref|ZP_06133006.1| conserved hypothetical protein [Neisseria gonorrhoeae MS11]
 gi|268601197|ref|ZP_06135364.1| conserved hypothetical protein [Neisseria gonorrhoeae PID18]
 gi|268603517|ref|ZP_06137684.1| conserved hypothetical protein [Neisseria gonorrhoeae PID1]
 gi|268681997|ref|ZP_06148859.1| conserved hypothetical protein [Neisseria gonorrhoeae PID332]
 gi|268684209|ref|ZP_06151071.1| conserved hypothetical protein [Neisseria gonorrhoeae SK-92-679]
 gi|268686465|ref|ZP_06153327.1| conserved hypothetical protein [Neisseria gonorrhoeae SK-93-1035]
 gi|291043976|ref|ZP_06569692.1| conserved hypothetical protein [Neisseria gonorrhoeae DGI2]
 gi|293399175|ref|ZP_06643340.1| conserved hypothetical protein [Neisseria gonorrhoeae F62]
 gi|59718210|gb|AAW89615.1| conserved hypothetical protein [Neisseria gonorrhoeae FA 1090]
 gi|193933736|gb|ACF29560.1| Conserved hypothetical protein [Neisseria gonorrhoeae NCCP11945]
 gi|226512671|gb|EEH62016.1| conserved hypothetical protein [Neisseria gonorrhoeae 1291]
 gi|268548077|gb|EEZ43495.1| conserved hypothetical protein [Neisseria gonorrhoeae 35/02]
 gi|268550770|gb|EEZ45789.1| conserved hypothetical protein [Neisseria gonorrhoeae FA19]
 gi|268582970|gb|EEZ47646.1| conserved hypothetical protein [Neisseria gonorrhoeae MS11]
 gi|268585328|gb|EEZ50004.1| conserved hypothetical protein [Neisseria gonorrhoeae PID18]
 gi|268587648|gb|EEZ52324.1| conserved hypothetical protein [Neisseria gonorrhoeae PID1]
 gi|268622281|gb|EEZ54681.1| conserved hypothetical protein [Neisseria gonorrhoeae PID332]
 gi|268624493|gb|EEZ56893.1| conserved hypothetical protein [Neisseria gonorrhoeae SK-92-679]
 gi|268626749|gb|EEZ59149.1| conserved hypothetical protein [Neisseria gonorrhoeae SK-93-1035]
 gi|291012439|gb|EFE04428.1| conserved hypothetical protein [Neisseria gonorrhoeae DGI2]
 gi|291610589|gb|EFF39699.1| conserved hypothetical protein [Neisseria gonorrhoeae F62]
 gi|317164132|gb|ADV07673.1| hypothetical protein NGTW08_0702 [Neisseria gonorrhoeae
          TCDC-NG08107]
          Length = 82

 Score = 36.6 bits (83), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 37/75 (49%), Gaps = 1/75 (1%)

Query: 6  NLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGM 65
          ++  RKI ++  RRG  E+DLI G F++     LS  EL+    I+E  D  L     G 
Sbjct: 6  DIAKRKIRFQT-RRGLLELDLIFGRFMEKEFEHLSDKELSEFSEILEFQDQELLALIHGH 64

Query: 66 EKPPEYLRTPIFKKI 80
           +  +    P+ +KI
Sbjct: 65 SETDKGHLIPMLEKI 79


>gi|241949487|ref|XP_002417466.1| meiotic induction transactivator, putative [Candida dubliniensis
           CD36]
 gi|257096770|sp|B9W8P6|SDHF2_CANDC RecName: Full=Succinate dehydrogenase assembly factor 2,
           mitochondrial; Short=SDH assembly factor 2; AltName:
           Full=Early meiotic induction protein 5; AltName:
           Full=Succinate dehydrogenase subunit 5, mitochondrial;
           Flags: Precursor
 gi|223640804|emb|CAX45119.1| meiotic induction transactivator, putative [Candida dubliniensis
           CD36]
          Length = 155

 Score = 36.6 bits (83), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 43/80 (53%), Gaps = 4/80 (5%)

Query: 11  KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEK--- 67
           +++Y+  +RG  E DL+L  F D ++  ++  EL   + +++E D +++ W T   K   
Sbjct: 56  RLLYQSRKRGILESDLLLSRFADKYLKTMTMEELDEYDKLLDEADWDIYYWATKNYKITP 115

Query: 68  -PPEYLRTPIFKKIYDYYSN 86
            P ++  + I K+I    +N
Sbjct: 116 LPDKWKDSKILKEIQKIANN 135


>gi|239611252|gb|EEQ88239.1| TPR repeat protein [Ajellomyces dermatitidis ER-3]
 gi|327348746|gb|EGE77603.1| TPR repeat protein [Ajellomyces dermatitidis ATCC 18188]
          Length = 317

 Score = 36.6 bits (83), Expect = 1.3,   Method: Composition-based stats.
 Identities = 14/59 (23%), Positives = 33/59 (55%)

Query: 11  KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPP 69
           +++Y+  +RG  E DL+L +F    +  ++  +L   +  ++E+D +++ W T   + P
Sbjct: 159 RLLYQSRKRGILESDLLLSTFASQHLPTMTERQLQEYDKFLDENDWDIYYWATQEAEDP 217


>gi|261205602|ref|XP_002627538.1| TPR repeat protein [Ajellomyces dermatitidis SLH14081]
 gi|239592597|gb|EEQ75178.1| TPR repeat protein [Ajellomyces dermatitidis SLH14081]
          Length = 317

 Score = 36.6 bits (83), Expect = 1.3,   Method: Composition-based stats.
 Identities = 14/59 (23%), Positives = 33/59 (55%)

Query: 11  KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPP 69
           +++Y+  +RG  E DL+L +F    +  ++  +L   +  ++E+D +++ W T   + P
Sbjct: 159 RLLYQSRKRGILESDLLLSTFASQHLPTMTERQLQEYDKFLDENDWDIYYWATQEAEDP 217


>gi|238795221|ref|ZP_04638806.1| hypothetical protein yinte0001_4630 [Yersinia intermedia ATCC
          29909]
 gi|238725441|gb|EEQ17010.1| hypothetical protein yinte0001_4630 [Yersinia intermedia ATCC
          29909]
          Length = 88

 Score = 36.2 bits (82), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 30/58 (51%), Gaps = 1/58 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKP 68
          +I + C RRG RE+D+ +  F +H    LS  E      ++E DD +LF W     +P
Sbjct: 8  RIHWAC-RRGMRELDISIMPFFEHEYDGLSDNEKQAFIRLLECDDPDLFNWLMNHGEP 64


>gi|239998845|ref|ZP_04718769.1| hypothetical protein Ngon3_05096 [Neisseria gonorrhoeae 35/02]
 gi|240014240|ref|ZP_04721153.1| hypothetical protein NgonD_06282 [Neisseria gonorrhoeae DGI18]
 gi|240016676|ref|ZP_04723216.1| hypothetical protein NgonFA_05848 [Neisseria gonorrhoeae FA6140]
 gi|240080865|ref|ZP_04725408.1| hypothetical protein NgonF_06081 [Neisseria gonorrhoeae FA19]
 gi|240112771|ref|ZP_04727261.1| hypothetical protein NgonM_04167 [Neisseria gonorrhoeae MS11]
 gi|240115522|ref|ZP_04729584.1| hypothetical protein NgonPID1_04615 [Neisseria gonorrhoeae PID18]
 gi|240117817|ref|ZP_04731879.1| hypothetical protein NgonPID_05022 [Neisseria gonorrhoeae PID1]
 gi|240121803|ref|ZP_04734765.1| hypothetical protein NgonPI_08587 [Neisseria gonorrhoeae PID24-1]
 gi|240123372|ref|ZP_04736328.1| hypothetical protein NgonP_05425 [Neisseria gonorrhoeae PID332]
 gi|240125620|ref|ZP_04738506.1| hypothetical protein NgonSK_05273 [Neisseria gonorrhoeae
          SK-92-679]
 gi|240128076|ref|ZP_04740737.1| hypothetical protein NgonS_05442 [Neisseria gonorrhoeae
          SK-93-1035]
          Length = 81

 Score = 36.2 bits (82), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 37/75 (49%), Gaps = 1/75 (1%)

Query: 6  NLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGM 65
          ++  RKI ++  RRG  E+DLI G F++     LS  EL+    I+E  D  L     G 
Sbjct: 5  DIAKRKIRFQT-RRGLLELDLIFGRFMEKEFEHLSDKELSEFSEILEFQDQELLALIHGH 63

Query: 66 EKPPEYLRTPIFKKI 80
           +  +    P+ +KI
Sbjct: 64 SETDKGHLIPMLEKI 78


>gi|120555179|ref|YP_959530.1| hypothetical protein Maqu_2265 [Marinobacter aquaeolei VT8]
 gi|120325028|gb|ABM19343.1| protein of unknown function DUF339 [Marinobacter aquaeolei VT8]
          Length = 90

 Score = 36.2 bits (82), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 40/78 (51%), Gaps = 7/78 (8%)

Query: 14 YRCW---RRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          +R W   RRG  E+D++L  F++    +LS+ +      ++  +D+++F+WF    KP +
Sbjct: 14 HRLWWHSRRGMLELDVLLLPFLEEVYRDLSAEDQARYRKLLSCEDTDMFEWFMQRSKPED 73

Query: 71 YLRTPIFKKIYDYYSNNL 88
              P  + I D   N +
Sbjct: 74 ----PDLRHIVDMILNRV 87


>gi|195120854|ref|XP_002004936.1| GI20197 [Drosophila mojavensis]
 gi|257096750|sp|B4KN44|SDF2A_DROMO RecName: Full=Succinate dehydrogenase assembly factor 2-A,
           mitochondrial; Short=SDH assembly factor 2-A; AltName:
           Full=Succinate dehydrogenase subunit 5-A, mitochondrial;
           Flags: Precursor
 gi|193910004|gb|EDW08871.1| GI20197 [Drosophila mojavensis]
          Length = 157

 Score = 36.2 bits (82), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 42/76 (55%), Gaps = 5/76 (6%)

Query: 1   MKKNMNLQCRK--IVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIE--EDDS 56
           ++ +  L+ RK  ++Y+  +RG  E DL+L +FV  ++ +  + E    + +I    +D 
Sbjct: 56  IRPDEPLETRKQRLLYQSRKRGMLENDLLLSTFVAKYLKDFDAEETAQYDQLINGVSNDW 115

Query: 57  NLFKWFTGMEK-PPEY 71
           +++ W T  +  PPEY
Sbjct: 116 DIYYWATNTKPTPPEY 131


>gi|119174260|ref|XP_001239491.1| hypothetical protein CIMG_09112 [Coccidioides immitis RS]
 gi|303314149|ref|XP_003067083.1| hypothetical protein CPC735_015360 [Coccidioides posadasii C735
           delta SOWgp]
 gi|240106751|gb|EER24938.1| hypothetical protein CPC735_015360 [Coccidioides posadasii C735
           delta SOWgp]
          Length = 251

 Score = 36.2 bits (82), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 36/59 (61%), Gaps = 2/59 (3%)

Query: 11  KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPP 69
           +++Y+  +RGT E DL+L +F    +  +S  +L   +  ++E+D +++ W T  ++PP
Sbjct: 104 RLLYQSRKRGTLESDLLLSTFAATNLSTMSKSQLEEYDRFLDENDWDIYYWAT--QEPP 160


>gi|320167736|gb|EFW44635.1| DUF339 family protein [Capsaspora owczarzaki ATCC 30864]
          Length = 216

 Score = 36.2 bits (82), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 17/67 (25%), Positives = 36/67 (53%), Gaps = 1/67 (1%)

Query: 6   NLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGM 65
            ++  +++Y+  +RG  E DL+L +F       LS  +L   + ++++ D +++ W T  
Sbjct: 119 QVKIARLLYQTRKRGILENDLLLSTFFAEHANALSDAQLQTFDKLLDQIDWDIYYWITKA 178

Query: 66  EK-PPEY 71
              PPE+
Sbjct: 179 RPVPPEF 185


>gi|219871472|ref|YP_002475847.1| hypothetical protein HAPS_1307 [Haemophilus parasuis SH0165]
 gi|219691676|gb|ACL32899.1| conserved hypothetical protein [Haemophilus parasuis SH0165]
          Length = 79

 Score = 36.2 bits (82), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 34/60 (56%), Gaps = 3/60 (5%)

Query: 11 KIVYRCWRRGTREMD-LILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPP 69
          +I + C RRG RE+D +I+  + +HF    +  + T +E ++   D  LF+WF   + PP
Sbjct: 5  RIEWEC-RRGMRELDKMIMPFYQEHFDSLTAEQQYTFVE-MLRYTDPELFRWFMNQDTPP 62


>gi|17537623|ref|NP_496607.1| hypothetical protein Y57A10A.29 [Caenorhabditis elegans]
 gi|75023741|sp|Q9NA72|SDHF2_CAEEL RecName: Full=Succinate dehydrogenase assembly factor 2,
           mitochondrial; Short=SDH assembly factor 2; AltName:
           Full=Succinate dehydrogenase subunit 5, mitochondrial;
           Flags: Precursor
 gi|5832946|emb|CAB55034.1| C. elegans protein Y57A10A.29, confirmed by transcript evidence
           [Caenorhabditis elegans]
          Length = 119

 Score = 36.2 bits (82), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 19/73 (26%), Positives = 43/73 (58%), Gaps = 3/73 (4%)

Query: 11  KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESII--EEDDSNLFKWFTGMEKP 68
           +++Y+  +RG  E D++LG F +  + ++S  EL   + +I  E  + +LF + +  + P
Sbjct: 35  RLLYQSKKRGILENDILLGDFAEQNLKKMSEPELKAYDKLINGEHMEWDLFYYLSNKKSP 94

Query: 69  PEYLRT-PIFKKI 80
           PE + +  +++K+
Sbjct: 95  PEDVESCQVYQKV 107


>gi|261377707|ref|ZP_05982280.1| TPR repeat protein [Neisseria cinerea ATCC 14685]
 gi|269145980|gb|EEZ72398.1| TPR repeat protein [Neisseria cinerea ATCC 14685]
          Length = 82

 Score = 36.2 bits (82), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 36/75 (48%), Gaps = 1/75 (1%)

Query: 6  NLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGM 65
          ++  RKI ++  RRG  E+DLI G F++     LS  EL+    I+E  D  L     G 
Sbjct: 6  DIAKRKIRFQT-RRGLLELDLIFGRFMEKEFEHLSDQELSEFSEILEFQDQELLALINGH 64

Query: 66 EKPPEYLRTPIFKKI 80
              +    P+ +KI
Sbjct: 65 SVTDKKHLIPMLEKI 79


>gi|307610277|emb|CBW99841.1| hypothetical protein LPW_16021 [Legionella pneumophila 130b]
          Length = 63

 Score = 36.2 bits (82), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 30/50 (60%)

Query: 23 EMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPEYL 72
          E+DL+L  F+ + I  L+  +L   ++++  +D NL+ W  G E+P + L
Sbjct: 3  ELDLVLQKFIANEIDRLTENQLKAFDNLLTHNDPNLYAWLMGHEEPEKEL 52


>gi|221135434|ref|ZP_03561737.1| hypothetical protein GHTCC_10948 [Glaciecola sp. HTCC2999]
          Length = 86

 Score = 36.2 bits (82), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 27/50 (54%)

Query: 18 RRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEK 67
          RRG  E+D++   FV+    EL   +    E ++  DD +LF WF G ++
Sbjct: 15 RRGMLELDVLFLPFVEAAFDELDDGQKLTFERLLTCDDPDLFAWFMGHQQ 64


>gi|330932883|ref|XP_003303954.1| hypothetical protein PTT_16356 [Pyrenophora teres f. teres 0-1]
 gi|311319754|gb|EFQ87973.1| hypothetical protein PTT_16356 [Pyrenophora teres f. teres 0-1]
          Length = 582

 Score = 36.2 bits (82), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 34/56 (60%), Gaps = 4/56 (7%)

Query: 24  MDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPEYLRTPIFKK 79
           +++ILG F  H++L+L + +L   ESI   D +N F+ F G+     YL+ P+ ++
Sbjct: 454 INMILGVFDSHYLLQLPATDLA--ESITIGDAANFFRDFDGLFS--TYLQRPVLQQ 505


>gi|226289895|gb|EEH45379.1| TPR repeat protein [Paracoccidioides brasiliensis Pb18]
          Length = 294

 Score = 35.8 bits (81), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 14/53 (26%), Positives = 33/53 (62%)

Query: 11  KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFT 63
           +++Y+  +RGT E DL+L +F    +  +++ +L   +  ++E+D +++ W T
Sbjct: 139 RLLYQSRKRGTLESDLLLSTFASKNLPTMTAQQLEEFDKFLDENDWDIYYWAT 191


>gi|330936381|ref|XP_003305369.1| hypothetical protein PTT_18184 [Pyrenophora teres f. teres 0-1]
 gi|311317668|gb|EFQ86555.1| hypothetical protein PTT_18184 [Pyrenophora teres f. teres 0-1]
          Length = 312

 Score = 35.8 bits (81), Expect = 1.8,   Method: Composition-based stats.
 Identities = 15/54 (27%), Positives = 30/54 (55%)

Query: 18  RRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPEY 71
           +RGT E DL+L +F D  +  +S   +   ++ ++E+D +++ W T    P  +
Sbjct: 155 KRGTLESDLLLSTFADAHLNTMSPSLMQQYDTFLDENDWDIYYWATQEPTPTSH 208


>gi|320037327|gb|EFW19264.1| TPR repeat protein [Coccidioides posadasii str. Silveira]
          Length = 201

 Score = 35.8 bits (81), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 36/59 (61%), Gaps = 2/59 (3%)

Query: 11  KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPP 69
           +++Y+  +RGT E DL+L +F    +  +S  +L   +  ++E+D +++ W T  ++PP
Sbjct: 54  RLLYQSRKRGTLESDLLLSTFAATNLSTMSKSQLEEYDRFLDENDWDIYYWAT--QEPP 110


>gi|156383928|ref|XP_001633084.1| predicted protein [Nematostella vectensis]
 gi|156220149|gb|EDO41021.1| predicted protein [Nematostella vectensis]
          Length = 124

 Score = 35.8 bits (81), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 20/78 (25%), Positives = 39/78 (50%), Gaps = 2/78 (2%)

Query: 11  KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEE--DDSNLFKWFTGMEKP 68
           +++Y+  +RG  E  L+L +F D  + E     L   + +I +  +D +L+ W T  +  
Sbjct: 25  RLLYQSRKRGMLENGLLLSTFADRHLDEFDDDLLQQYDYLINQPTNDWDLYYWITENKPT 84

Query: 69  PEYLRTPIFKKIYDYYSN 86
           P+   +P+   I D+  N
Sbjct: 85  PDEYNSPVMDMIKDFAKN 102


>gi|194857859|ref|XP_001969049.1| GG25208 [Drosophila erecta]
 gi|257096758|sp|B3N6D9|SDF2B_DROER RecName: Full=Succinate dehydrogenase assembly factor 2-B,
           mitochondrial; Short=SDH assembly factor 2-B; AltName:
           Full=Succinate dehydrogenase subunit 5-B, mitochondrial;
           Flags: Precursor
 gi|190660916|gb|EDV58108.1| GG25208 [Drosophila erecta]
          Length = 156

 Score = 35.8 bits (81), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 22/91 (24%), Positives = 47/91 (51%), Gaps = 4/91 (4%)

Query: 1   MKKNMNLQCRK--IVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIE--EDDS 56
           ++ +  LQ RK  ++Y+  +RG  E DL+L +FV   + + ++ +    + +I    +D 
Sbjct: 55  VRPDEPLQTRKQRLLYQSRKRGMLENDLLLSTFVAKHLKDFNAEQTAEYDQLINGVSNDW 114

Query: 57  NLFKWFTGMEKPPEYLRTPIFKKIYDYYSNN 87
           ++F W T  +  P    T I + + ++  N+
Sbjct: 115 DIFYWATDTKPTPPQFDTEIMRLLKEHVKNH 145


>gi|311278183|ref|YP_003940414.1| hypothetical protein Entcl_0856 [Enterobacter cloacae SCF1]
 gi|308747378|gb|ADO47130.1| protein of unknown function DUF339 [Enterobacter cloacae SCF1]
          Length = 88

 Score = 35.8 bits (81), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 34/66 (51%)

Query: 5  MNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTG 64
          M++  +  ++   RRG RE+D+ +  F ++    LS  +  +   ++E DD +LF W   
Sbjct: 1  MDITNKARIHWACRRGMRELDISIMPFFEYEYDTLSDSDKQLFIRLLECDDPDLFNWLMN 60

Query: 65 MEKPPE 70
            KP +
Sbjct: 61 HGKPAD 66


>gi|304310533|ref|YP_003810131.1| hypothetical protein HDN1F_08910 [gamma proteobacterium HdN1]
 gi|301796266|emb|CBL44474.1| conserved hypothetical protein [gamma proteobacterium HdN1]
          Length = 86

 Score = 35.8 bits (81), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 42/77 (54%), Gaps = 1/77 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          +I + C RRG +E + +L  F D +  +L+  +      +++E D +LF+WFT   +P +
Sbjct: 10 RIRWDC-RRGIKEAEYLLLPFFDRYFADLTLEQKRAFVLLLKEQDVDLFEWFTLRSEPED 68

Query: 71 YLRTPIFKKIYDYYSNN 87
           +   + + I D  +++
Sbjct: 69 EVLRNMVRLIMDRCASS 85


>gi|257096802|sp|A5DJ67|SDHF2_PICGU RecName: Full=Succinate dehydrogenase assembly factor 2,
          mitochondrial; Short=SDH assembly factor 2; AltName:
          Full=Early meiotic induction protein 5; AltName:
          Full=Succinate dehydrogenase subunit 5, mitochondrial;
          Flags: Precursor
 gi|190347014|gb|EDK39220.2| hypothetical protein PGUG_03318 [Meyerozyma guilliermondii ATCC
          6260]
          Length = 135

 Score = 35.8 bits (81), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 30/53 (56%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFT 63
          ++VY+  +RG  E DL+L  F    +  LS  +L   + +++E D +++ W T
Sbjct: 45 RLVYQSRKRGILESDLLLSRFAKKHLDSLSDSQLDEYDQLLDEPDWDIYYWAT 97


>gi|254568218|ref|XP_002491219.1| Essential Hsp90p co-chaperone [Pichia pastoris GS115]
 gi|257096794|sp|C4R0B5|SDHF2_PICPG RecName: Full=Succinate dehydrogenase assembly factor 2,
           mitochondrial; Short=SDH assembly factor 2; AltName:
           Full=Early meiotic induction protein 5; AltName:
           Full=Succinate dehydrogenase subunit 5, mitochondrial;
           Flags: Precursor
 gi|238031016|emb|CAY68939.1| Essential Hsp90p co-chaperone [Pichia pastoris GS115]
 gi|328352260|emb|CCA38659.1| Uncharacterized protein C12B10.06c [Pichia pastoris CBS 7435]
          Length = 190

 Score = 35.8 bits (81), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 20/86 (23%), Positives = 45/86 (52%), Gaps = 4/86 (4%)

Query: 6   NLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW---- 61
           +++ R++VY+  +RG  E DL+L  F   ++  +S  E+   + ++ E D +++ W    
Sbjct: 91  DVKRRRLVYQSRKRGILETDLLLSRFAKRYLPTMSVEEMEEYDDLLNELDWDIYYWAVKN 150

Query: 62  FTGMEKPPEYLRTPIFKKIYDYYSNN 87
           +     P ++  + I  K+ +  +NN
Sbjct: 151 YEVTPLPEKWKDSKILAKLQEMSANN 176


>gi|146415935|ref|XP_001483937.1| hypothetical protein PGUG_03318 [Meyerozyma guilliermondii ATCC
          6260]
          Length = 135

 Score = 35.8 bits (81), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 30/53 (56%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFT 63
          ++VY+  +RG  E DL+L  F    +  LS  +L   + +++E D +++ W T
Sbjct: 45 RLVYQSRKRGILESDLLLSRFAKKHLDSLSDSQLDEYDQLLDEPDWDIYYWAT 97


>gi|227112626|ref|ZP_03826282.1| hypothetical protein PcarbP_06667 [Pectobacterium carotovorum
          subsp. brasiliensis PBR1692]
          Length = 88

 Score = 35.8 bits (81), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 16/64 (25%), Positives = 31/64 (48%)

Query: 5  MNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTG 64
          M +  +  ++   RRG RE+D+ +  F +H    L+  +      +++ DD +LF W   
Sbjct: 1  MEIDNKSRIHWACRRGMRELDIAIMPFFEHDYDTLNDTDKRTFVRLLQSDDPDLFNWLMN 60

Query: 65 MEKP 68
            +P
Sbjct: 61 HGEP 64


>gi|227328390|ref|ZP_03832414.1| hypothetical protein PcarcW_14082 [Pectobacterium carotovorum
          subsp. carotovorum WPP14]
          Length = 88

 Score = 35.8 bits (81), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 16/64 (25%), Positives = 31/64 (48%)

Query: 5  MNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTG 64
          M +  +  ++   RRG RE+D+ +  F +H    L+  +      +++ DD +LF W   
Sbjct: 1  MEIDNKSRIHWACRRGMRELDIAIMPFFEHDYDTLNDTDKRTFVRLLQSDDPDLFNWLMN 60

Query: 65 MEKP 68
            +P
Sbjct: 61 HGEP 64


>gi|167854874|ref|ZP_02477651.1| hypothetical protein HPS_03506 [Haemophilus parasuis 29755]
 gi|167854053|gb|EDS25290.1| hypothetical protein HPS_03506 [Haemophilus parasuis 29755]
          Length = 79

 Score = 35.8 bits (81), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 29/59 (49%), Gaps = 1/59 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPP 69
          +I + C RRG RE+D ++  F       L++ +      ++   D  LF+WF   + PP
Sbjct: 5  RIEWEC-RRGMRELDKMIMPFYQEHFDSLTAEQQRTFVEMLRYTDPELFRWFMNQDTPP 62


>gi|268533196|ref|XP_002631726.1| Hypothetical protein CBG20928 [Caenorhabditis briggsae]
 gi|257096769|sp|A8XYZ2|SDHF2_CAEBR RecName: Full=Succinate dehydrogenase assembly factor 2,
           mitochondrial; Short=SDH assembly factor 2; AltName:
           Full=Succinate dehydrogenase subunit 5, mitochondrial;
           Flags: Precursor
 gi|187023179|emb|CAP37859.1| hypothetical protein CBG_20928 [Caenorhabditis briggsae AF16]
          Length = 122

 Score = 35.8 bits (81), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 19/76 (25%), Positives = 45/76 (59%), Gaps = 3/76 (3%)

Query: 11  KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESII--EEDDSNLFKWFTGMEKP 68
           +++Y+  +RG  E D++LG+F +  + ++S  EL   + +I  E  + +LF + +  + P
Sbjct: 38  RLLYQSKKRGILENDILLGNFAEENLKKMSEPELKAYDKLINGEHMEWDLFYYLSNKKTP 97

Query: 69  PEYL-RTPIFKKIYDY 83
           PE + +  +++K+  +
Sbjct: 98  PEDVEKCSVYQKVKKF 113


>gi|328703515|ref|XP_001950307.2| PREDICTED: succinate dehydrogenase assembly factor 2-A,
           mitochondrial-like [Acyrthosiphon pisum]
 gi|239789442|dbj|BAH71346.1| ACYPI004221 [Acyrthosiphon pisum]
          Length = 134

 Score = 35.8 bits (81), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 19/76 (25%), Positives = 38/76 (50%), Gaps = 2/76 (2%)

Query: 5   MNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEE--DDSNLFKWF 62
           ++L   +++Y+  +RG  E  +I  SF D ++   +  EL   +++I    D+ +L+ W 
Sbjct: 49  LDLMRSRLIYQSRKRGILENCIIFTSFADKYLKTFNCEELQKYDALINSKFDEWDLYAWS 108

Query: 63  TGMEKPPEYLRTPIFK 78
            G +  P+     I K
Sbjct: 109 IGSKPAPQEFDNDILK 124


>gi|114564102|ref|YP_751616.1| hypothetical protein Sfri_2938 [Shewanella frigidimarina NCIMB
          400]
 gi|114335395|gb|ABI72777.1| protein of unknown function DUF339 [Shewanella frigidimarina
          NCIMB 400]
          Length = 83

 Score = 35.8 bits (81), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 36/70 (51%), Gaps = 1/70 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          ++ + C RRG  E+D++   FV+     ++  +      ++E +D  LF WF G E+ P+
Sbjct: 9  RVRWAC-RRGMLELDVLFQPFVETQYEAMTDNDKNTFIRLLECEDPELFAWFMGHEQCPD 67

Query: 71 YLRTPIFKKI 80
           L   +  K+
Sbjct: 68 PLFANMIVKV 77


>gi|117925049|ref|YP_865666.1| hypothetical protein Mmc1_1752 [Magnetococcus sp. MC-1]
 gi|117608805|gb|ABK44260.1| hypothetical protein Mmc1_1752 [Magnetococcus sp. MC-1]
          Length = 99

 Score = 35.8 bits (81), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 19/80 (23%), Positives = 42/80 (52%), Gaps = 6/80 (7%)

Query: 10 RKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLES---IIEEDDSNLFKWFTGME 66
          R++ Y   RR   E +L+   F+D    E+S  + T+ E+   ++   D++L  W  G++
Sbjct: 17 RRVTYEVTRRSMFEAELLFQRFLD---AEISKFDETLCEAFLNLLVYPDADLLDWMAGIK 73

Query: 67 KPPEYLRTPIFKKIYDYYSN 86
          +PP  +   + ++I  ++ +
Sbjct: 74 EPPVGVDLQLLQRINHHWPH 93


>gi|166712283|ref|ZP_02243490.1| hypothetical protein Xoryp_12720 [Xanthomonas oryzae pv.
          oryzicola BLS256]
          Length = 65

 Score = 35.8 bits (81), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 14/59 (23%), Positives = 28/59 (47%)

Query: 22 REMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPEYLRTPIFKKI 80
          RE+D + G ++D    +    E  +   +++ +D  L++WF G E  P+     +   I
Sbjct: 2  RELDQLFGRYLDQRWAQAPDAERAVFLQLLDCEDDKLWRWFMGYEACPDVANAALIADI 60


>gi|260771284|ref|ZP_05880211.1| hypothetical protein VFA_004349 [Vibrio furnissii CIP 102972]
 gi|260613881|gb|EEX39073.1| hypothetical protein VFA_004349 [Vibrio furnissii CIP 102972]
 gi|315179109|gb|ADT86023.1| hypothetical protein vfu_A00827 [Vibrio furnissii NCTC 11218]
          Length = 86

 Score = 35.4 bits (80), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 34/73 (46%), Gaps = 1/73 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          +I + C RRG  E+D+++  F +     LS  E     S++E DD +LF W  G  +   
Sbjct: 9  RIKWAC-RRGMLELDVVIMPFFEECFDTLSESEQQDFVSLLECDDPDLFTWVMGHGRSEN 67

Query: 71 YLRTPIFKKIYDY 83
               +  KI  +
Sbjct: 68 LGHAAMVDKIVAH 80


>gi|157960856|ref|YP_001500890.1| hypothetical protein Spea_1028 [Shewanella pealeana ATCC 700345]
 gi|157845856|gb|ABV86355.1| protein of unknown function DUF339 [Shewanella pealeana ATCC
          700345]
          Length = 79

 Score = 35.4 bits (80), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 31/59 (52%), Gaps = 1/59 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPP 69
          ++ + C RRG  E+D++   FV+     +S  +      ++E +D  LF WF G E+ P
Sbjct: 5  RVKWAC-RRGMLELDVLFQPFVEQQYEAMSIKDKDTFVRLLECEDPELFAWFMGHEQCP 62


>gi|309380085|emb|CBX21496.1| unnamed protein product [Neisseria lactamica Y92-1009]
          Length = 81

 Score = 35.4 bits (80), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 36/75 (48%), Gaps = 1/75 (1%)

Query: 6  NLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGM 65
          ++  RKI ++  RRG  E+DLI G F++     LS  EL+    I+E  D  L     G 
Sbjct: 5  DIAKRKIRFQT-RRGLLELDLIFGRFMEKEFEHLSDKELSEFSEILEFQDQELLALINGH 63

Query: 66 EKPPEYLRTPIFKKI 80
              +    P+ +KI
Sbjct: 64 SVTDKGHLIPMLEKI 78


>gi|261401139|ref|ZP_05987264.1| TPR repeat protein [Neisseria lactamica ATCC 23970]
 gi|296314768|ref|ZP_06864709.1| TPR repeat protein [Neisseria polysaccharea ATCC 43768]
 gi|313668605|ref|YP_004048889.1| hypothetical protein NLA_13080 [Neisseria lactamica ST-640]
 gi|269208917|gb|EEZ75372.1| TPR repeat protein [Neisseria lactamica ATCC 23970]
 gi|296838412|gb|EFH22350.1| TPR repeat protein [Neisseria polysaccharea ATCC 43768]
 gi|313006067|emb|CBN87528.1| conserved hypothetical protein [Neisseria lactamica 020-06]
          Length = 82

 Score = 35.4 bits (80), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 36/75 (48%), Gaps = 1/75 (1%)

Query: 6  NLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGM 65
          ++  RKI ++  RRG  E+DLI G F++     LS  EL+    I+E  D  L     G 
Sbjct: 6  DIAKRKIRFQT-RRGLLELDLIFGRFMEKEFEHLSDKELSEFSEILEFQDQELLALINGH 64

Query: 66 EKPPEYLRTPIFKKI 80
              +    P+ +KI
Sbjct: 65 SVTDKGHLIPMLEKI 79


>gi|32034926|ref|ZP_00135017.1| COG2938: Uncharacterized conserved protein [Actinobacillus
          pleuropneumoniae serovar 1 str. 4074]
 gi|126208985|ref|YP_001054210.1| hypothetical protein APL_1521 [Actinobacillus pleuropneumoniae
          L20]
 gi|126097777|gb|ABN74605.1| hypothetical protein APL_1521 [Actinobacillus pleuropneumoniae
          serovar 5b str. L20]
          Length = 82

 Score = 35.4 bits (80), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 29/59 (49%), Gaps = 1/59 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPP 69
          +I + C RRG RE+D ++  F      ELS  +     ++++  D  LF+WF      P
Sbjct: 8  RIEWEC-RRGMRELDKMIMPFYKAHFDELSEAQQQTFVAMLKYTDPELFRWFMHQAPAP 65


>gi|50119704|ref|YP_048871.1| hypothetical protein ECA0759 [Pectobacterium atrosepticum
          SCRI1043]
 gi|81175089|sp|Q6D960|Y759_ERWCT RecName: Full=UPF0350 protein ECA0759
 gi|49610230|emb|CAG73673.1| conserved hypothetical protein [Pectobacterium atrosepticum
          SCRI1043]
          Length = 88

 Score = 35.4 bits (80), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 16/66 (24%), Positives = 32/66 (48%)

Query: 5  MNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTG 64
          M +  +  ++   RRG RE+D+ +  F +H    L+  +      +++ DD +LF W   
Sbjct: 1  MEIDNKSRIHWACRRGMRELDIAIMPFFEHDYDTLNDSDKRAFVRLLQSDDPDLFNWLMN 60

Query: 65 MEKPPE 70
            +P +
Sbjct: 61 HGEPKD 66


>gi|262404783|ref|ZP_06081338.1| hypothetical protein VOA_002782 [Vibrio sp. RC586]
 gi|262349815|gb|EEY98953.1| hypothetical protein VOA_002782 [Vibrio sp. RC586]
          Length = 86

 Score = 35.4 bits (80), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 30/57 (52%), Gaps = 1/57 (1%)

Query: 8  QCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTG 64
          Q  +I + C RRG  E+D+++  F +     LS  E     +++E DD +LF W  G
Sbjct: 6  QKARIKWAC-RRGMLELDVVIMPFFEECFDSLSESEQDDFVALLESDDPDLFAWVMG 61


>gi|50309089|ref|XP_454550.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
 gi|74605800|sp|Q6CND9|SDHF2_KLULA RecName: Full=Succinate dehydrogenase assembly factor 2,
           mitochondrial; Short=SDH assembly factor 2; AltName:
           Full=Early meiotic induction protein 5; AltName:
           Full=Succinate dehydrogenase subunit 5, mitochondrial;
           Flags: Precursor
 gi|49643685|emb|CAG99637.1| KLLA0E13333p [Kluyveromyces lactis]
          Length = 163

 Score = 35.4 bits (80), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 21/85 (24%), Positives = 45/85 (52%), Gaps = 5/85 (5%)

Query: 11  KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTG----ME 66
           +++Y+  +RG  E DL+L  F   ++ E++  +L   + ++ E D +++ W T       
Sbjct: 70  RLIYQSRKRGILETDLLLSRFAAKYLKEMTPEQLEEYDQLLNELDWDIYYWATENYSITP 129

Query: 67  KPPEYLRTPIFKKIYDYYSNNLDRK 91
            P  +  + I K++ + +S N DR+
Sbjct: 130 LPDRWKNSNILKQLQE-FSKNKDRE 153


>gi|149910164|ref|ZP_01898810.1| TPR repeat protein [Moritella sp. PE36]
 gi|149806750|gb|EDM66714.1| TPR repeat protein [Moritella sp. PE36]
          Length = 83

 Score = 35.4 bits (80), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 28/50 (56%)

Query: 18 RRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEK 67
          RRG  E+D++   FVD    +LS  +  + + ++E +D  LF W  G +K
Sbjct: 15 RRGMLELDVLFRPFVDEAYDDLSDEDKFIFQRLLEGEDPELFAWAMGHKK 64


>gi|289741397|gb|ADD19446.1| uncharacterized conserved protein [Glossina morsitans morsitans]
          Length = 167

 Score = 35.4 bits (80), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 18/70 (25%), Positives = 42/70 (60%), Gaps = 3/70 (4%)

Query: 5   MNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIE--EDDSNLFKWF 62
           ++++ ++++Y+  +RG  E DL+L +F   ++ +LS       +S+I    +D +++ W 
Sbjct: 71  LDIKKQRLLYQSRKRGMLENDLLLSTFAAKYLKDLSGELTEQYDSLINGVTNDWDIYYWA 130

Query: 63  TGMEK-PPEY 71
           T ++  PPE+
Sbjct: 131 TNVKPTPPEH 140


>gi|323307074|gb|EGA60357.1| Emi5p [Saccharomyces cerevisiae FostersO]
          Length = 129

 Score = 35.4 bits (80), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 15/53 (28%), Positives = 32/53 (60%)

Query: 11  KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFT 63
           +++Y+  +RG  E DL+L  F   ++ +++  EL   +S++ E D +++ W T
Sbjct: 68  RLIYQSRKRGILETDLLLSGFAAKYLKKMNEEELEEYDSLLNELDWDIYYWAT 120


>gi|90412076|ref|ZP_01220083.1| hypothetical protein P3TCK_24861 [Photobacterium profundum 3TCK]
 gi|90327054|gb|EAS43433.1| hypothetical protein P3TCK_24861 [Photobacterium profundum 3TCK]
          Length = 86

 Score = 35.4 bits (80), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 20/78 (25%), Positives = 37/78 (47%), Gaps = 1/78 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          ++ + C RRG  E+D+I+  F +  + +L   E     S++  DD +LF W  G  +   
Sbjct: 9  RLKWAC-RRGMLELDVIIMPFFEECLDDLPDQEQRDFVSLLTSDDPDLFTWMMGHGRSEN 67

Query: 71 YLRTPIFKKIYDYYSNNL 88
               +  KI  + ++ L
Sbjct: 68 PAHAAMVDKIVAHNNSKL 85


>gi|149374720|ref|ZP_01892494.1| hypothetical protein MDG893_11746 [Marinobacter algicola DG893]
 gi|149361423|gb|EDM49873.1| hypothetical protein MDG893_11746 [Marinobacter algicola DG893]
          Length = 84

 Score = 35.4 bits (80), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 18/71 (25%), Positives = 39/71 (54%), Gaps = 4/71 (5%)

Query: 18 RRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPEYLRTPIF 77
          RRG  E+D++L  F+++   +L + +    + +I  +D+++F+WF    +P +    P  
Sbjct: 15 RRGMLELDVLLIPFLENAYRDLPAEDQARYQKLINCEDTDMFEWFMQRSRPED----PDL 70

Query: 78 KKIYDYYSNNL 88
          ++I D   N +
Sbjct: 71 QRIVDLILNRV 81


>gi|258622354|ref|ZP_05717379.1| conserved hypothetical protein [Vibrio mimicus VM573]
 gi|258626738|ref|ZP_05721560.1| conserved hypothetical protein [Vibrio mimicus VM603]
 gi|262166510|ref|ZP_06034247.1| hypothetical protein VMA_002969 [Vibrio mimicus VM223]
 gi|262170582|ref|ZP_06038260.1| hypothetical protein VII_001393 [Vibrio mimicus MB-451]
 gi|258580994|gb|EEW05921.1| conserved hypothetical protein [Vibrio mimicus VM603]
 gi|258585370|gb|EEW10094.1| conserved hypothetical protein [Vibrio mimicus VM573]
 gi|261891658|gb|EEY37644.1| hypothetical protein VII_001393 [Vibrio mimicus MB-451]
 gi|262026226|gb|EEY44894.1| hypothetical protein VMA_002969 [Vibrio mimicus VM223]
          Length = 86

 Score = 35.4 bits (80), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 31/57 (54%), Gaps = 1/57 (1%)

Query: 8  QCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTG 64
          Q  +I + C RRG  E+D+++  F +     L+  E +   +++E DD +LF W  G
Sbjct: 6  QKARIKWAC-RRGMLELDVVIMPFFEECFDSLTESEQSDFVALLESDDPDLFAWVMG 61


>gi|323352324|gb|EGA84859.1| Emi5p [Saccharomyces cerevisiae VL3]
          Length = 126

 Score = 35.4 bits (80), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 15/53 (28%), Positives = 32/53 (60%)

Query: 11  KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFT 63
           +++Y+  +RG  E DL+L  F   ++ +++  EL   +S++ E D +++ W T
Sbjct: 65  RLIYQSRKRGILETDLLLSGFAAKYLKKMNEEELEEYDSLLNELDWDIYYWAT 117


>gi|117621545|ref|YP_855334.1| TPR repeat-containing protein [Aeromonas hydrophila subsp.
          hydrophila ATCC 7966]
 gi|117562952|gb|ABK39900.1| TPR repeat protein [Aeromonas hydrophila subsp. hydrophila ATCC
          7966]
          Length = 89

 Score = 35.4 bits (80), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 36/81 (44%), Gaps = 1/81 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          ++ + C RRG  E+D+I   F +H    LS  E      ++E +D  LF+W  G   P +
Sbjct: 9  RLKWAC-RRGMLELDVIFMPFFEHEFDGLSEAEQQTFIRLLECEDPELFRWSMGHGVPED 67

Query: 71 YLRTPIFKKIYDYYSNNLDRK 91
               +   I +      DR+
Sbjct: 68 PAFAAMIPLILERNQARHDRQ 88


>gi|260775216|ref|ZP_05884114.1| hypothetical protein VIC_000587 [Vibrio coralliilyticus ATCC
          BAA-450]
 gi|260608917|gb|EEX35079.1| hypothetical protein VIC_000587 [Vibrio coralliilyticus ATCC
          BAA-450]
          Length = 86

 Score = 35.4 bits (80), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 34/73 (46%), Gaps = 1/73 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          +I + C RRG  E+D+++  F +    EL   E     S++E DD +LF W  G  +   
Sbjct: 9  RIKWAC-RRGMLELDVVIMPFFEECFEELKDNEQRDFVSLLECDDPDLFTWIMGHGRSEN 67

Query: 71 YLRTPIFKKIYDY 83
               +  KI  +
Sbjct: 68 LGHASMVDKIVAH 80


>gi|54310197|ref|YP_131217.1| hypothetical protein PBPRA3099 [Photobacterium profundum SS9]
 gi|81175079|sp|Q6LMR2|Y3099_PHOPR RecName: Full=UPF0350 protein PBPRA3099
 gi|46914638|emb|CAG21415.1| conserved hypothetical protein [Photobacterium profundum SS9]
          Length = 88

 Score = 35.4 bits (80), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 20/78 (25%), Positives = 37/78 (47%), Gaps = 1/78 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          ++ + C RRG  E+D+I+  F +  + +L   E     S++  DD +LF W  G  +   
Sbjct: 11 RLKWAC-RRGMLELDVIIMPFFEECLDDLPDQEQRDFVSLLTSDDPDLFTWMMGHGRSEN 69

Query: 71 YLRTPIFKKIYDYYSNNL 88
               +  KI  + ++ L
Sbjct: 70 PAHAAMVDKIVAHNNSKL 87


>gi|194863553|ref|XP_001970497.1| GG10665 [Drosophila erecta]
 gi|257096749|sp|B3N8S9|SDF2A_DROER RecName: Full=Succinate dehydrogenase assembly factor 2-A,
           mitochondrial; Short=SDH assembly factor 2-A; AltName:
           Full=Succinate dehydrogenase subunit 5-A, mitochondrial;
           Flags: Precursor
 gi|190662364|gb|EDV59556.1| GG10665 [Drosophila erecta]
          Length = 162

 Score = 35.4 bits (80), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 22/90 (24%), Positives = 45/90 (50%), Gaps = 4/90 (4%)

Query: 1   MKKNMNLQCRK--IVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIE--EDDS 56
           ++ N  LQ RK  ++Y+  +RG  E DL+L +F    +   S+ +    + +I    +D 
Sbjct: 59  LRPNEPLQTRKQRLLYQSRKRGMLENDLLLSTFAAKHLQSFSAEQTAQYDQLINGVSNDW 118

Query: 57  NLFKWFTGMEKPPEYLRTPIFKKIYDYYSN 86
           +++ W T ++  P+   T I   + ++  N
Sbjct: 119 DIYYWATDVKPTPKEYDTEIMGLLKEHVKN 148


>gi|291614296|ref|YP_003524453.1| hypothetical protein Slit_1837 [Sideroxydans lithotrophicus ES-1]
 gi|291584408|gb|ADE12066.1| protein of unknown function DUF339 [Sideroxydans lithotrophicus
          ES-1]
          Length = 107

 Score = 35.4 bits (80), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 15/55 (27%), Positives = 33/55 (60%), Gaps = 1/55 (1%)

Query: 10 RKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTG 64
          R++++RC RRG  E+D++LG F++ +   +   +    + +++  D+ L+   TG
Sbjct: 35 RRLLWRC-RRGLLELDIVLGRFIERYYPTMDDGQRVAFDELLDLPDTELWDLITG 88


>gi|320540114|ref|ZP_08039769.1| putative conserved protein [Serratia symbiotica str. Tucson]
 gi|320029780|gb|EFW11804.1| putative conserved protein [Serratia symbiotica str. Tucson]
          Length = 88

 Score = 35.0 bits (79), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 16/64 (25%), Positives = 33/64 (51%)

Query: 5  MNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTG 64
          M++  +  ++   RRG RE+D+ +  F ++   +L+  +  +   ++E DD +LF W   
Sbjct: 1  MDINNKARIHWACRRGMRELDISIMPFFEYEYDQLNDTDKALFIRLLECDDPDLFNWLMN 60

Query: 65 MEKP 68
             P
Sbjct: 61 HGAP 64


>gi|188534911|ref|YP_001908708.1| hypothetical protein ETA_27910 [Erwinia tasmaniensis Et1/99]
 gi|188029953|emb|CAO97837.1| UPF0350 protein YgfY [Erwinia tasmaniensis Et1/99]
          Length = 88

 Score = 35.0 bits (79), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 16/66 (24%), Positives = 34/66 (51%)

Query: 5  MNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTG 64
          M++  +  ++   RRG RE+D+ +  F ++    L+  +  +   ++E DD +LF W   
Sbjct: 1  MDITNKSRIHWACRRGMRELDISIMPFFEYEFDSLNDGDKRLFVRLLESDDPDLFNWLMN 60

Query: 65 MEKPPE 70
            +P +
Sbjct: 61 HGEPAD 66


>gi|27364926|ref|NP_760454.1| hypothetical protein VV1_1557 [Vibrio vulnificus CMCP6]
 gi|320155311|ref|YP_004187690.1| YgfY [Vibrio vulnificus MO6-24/O]
 gi|81175067|sp|Q8DC84|Y1557_VIBVU RecName: Full=UPF0350 protein VV1_1557
 gi|27361072|gb|AAO09981.1| Uncharacterized conserved protein [Vibrio vulnificus CMCP6]
 gi|319930623|gb|ADV85487.1| ygfY [Vibrio vulnificus MO6-24/O]
          Length = 86

 Score = 35.0 bits (79), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 35/73 (47%), Gaps = 1/73 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          +I + C RRG  E+D+++  F +    +LS  E     S++E DD +LF W  G  +   
Sbjct: 9  RIRWAC-RRGMLELDVVVMPFFEECFEKLSEQEQRDFVSLLECDDPDLFTWVMGHGRSEN 67

Query: 71 YLRTPIFKKIYDY 83
               +  KI  +
Sbjct: 68 LGHASMVDKIVAH 80


>gi|262393262|ref|YP_003285116.1| hypothetical protein VEA_002489 [Vibrio sp. Ex25]
 gi|262336856|gb|ACY50651.1| hypothetical protein VEA_002489 [Vibrio sp. Ex25]
          Length = 86

 Score = 35.0 bits (79), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 34/73 (46%), Gaps = 1/73 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          +I + C RRG  E+D+++  F +     LS  E     S++E DD +LF W  G  +   
Sbjct: 9  RIKWAC-RRGMLELDVVIMPFFEECFDTLSEQEQRDFVSLLECDDPDLFTWIMGHGRSEN 67

Query: 71 YLRTPIFKKIYDY 83
               +  KI  +
Sbjct: 68 LGHAAMVDKIVAH 80


>gi|85059974|ref|YP_455676.1| hypothetical protein SG1996 [Sodalis glossinidius str.
          'morsitans']
 gi|84780494|dbj|BAE75271.1| conserved hypothetical protein [Sodalis glossinidius str.
          'morsitans']
          Length = 88

 Score = 35.0 bits (79), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 17/64 (26%), Positives = 31/64 (48%)

Query: 5  MNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTG 64
          M++  +  ++   RRG RE+D+ +  F +H    L   +      ++E DD +LF W   
Sbjct: 1  MDITNKARIHWACRRGMRELDIAIMPFFEHDFDALDDQDKQRFVRLLECDDPDLFYWLMN 60

Query: 65 MEKP 68
            +P
Sbjct: 61 HGQP 64


>gi|90408991|ref|ZP_01217122.1| hypothetical protein PCNPT3_01463 [Psychromonas sp. CNPT3]
 gi|90309905|gb|EAS38059.1| hypothetical protein PCNPT3_01463 [Psychromonas sp. CNPT3]
          Length = 83

 Score = 35.0 bits (79), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 31/57 (54%), Gaps = 1/57 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEK 67
          ++++ C RRG  E+D++   FV     +L   +    + ++  +D +LF WF G +K
Sbjct: 9  RLLWAC-RRGMLELDVLFMPFVKEAFDDLKYSQQLTFQRLLTHEDPDLFAWFMGHDK 64


>gi|322831503|ref|YP_004211530.1| hypothetical protein Rahaq_0776 [Rahnella sp. Y9602]
 gi|321166704|gb|ADW72403.1| protein of unknown function DUF339 [Rahnella sp. Y9602]
          Length = 94

 Score = 35.0 bits (79), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 33/67 (49%)

Query: 2  KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
          K  +++  R  V+   RRG RE+D+ +  F ++    LS  +  +   ++  DD +LF W
Sbjct: 4  KNQLDINNRSRVHWACRRGMRELDISIMPFFEYEYDSLSETDKEVFVRLLTCDDPDLFNW 63

Query: 62 FTGMEKP 68
               +P
Sbjct: 64 LMNHGEP 70


>gi|37681025|ref|NP_935634.1| hypothetical protein VV2841 [Vibrio vulnificus YJ016]
 gi|81175078|sp|Q7MHM8|Y2841_VIBVY RecName: Full=UPF0350 protein VV2841
 gi|37199775|dbj|BAC95605.1| conserved hypothetical protein [Vibrio vulnificus YJ016]
          Length = 86

 Score = 35.0 bits (79), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 35/73 (47%), Gaps = 1/73 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          +I + C RRG  E+D+++  F +    +LS  E     S++E DD +LF W  G  +   
Sbjct: 9  RIRWAC-RRGMLELDVVVMPFFEECFDKLSEQEQRDFVSLLECDDPDLFTWVMGHGRSEN 67

Query: 71 YLRTPIFKKIYDY 83
               +  KI  +
Sbjct: 68 LGHASMVDKIVAH 80


>gi|323495996|ref|ZP_08101060.1| hypothetical protein VISI1226_03104 [Vibrio sinaloensis DSM
          21326]
 gi|323318958|gb|EGA71905.1| hypothetical protein VISI1226_03104 [Vibrio sinaloensis DSM
          21326]
          Length = 86

 Score = 35.0 bits (79), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 34/73 (46%), Gaps = 1/73 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          +I + C RRG  E+D+++  F +     LS  E     S++E DD +LF W  G  +   
Sbjct: 9  RIKWGC-RRGMLELDVVIMPFFEECFESLSDNEQRDFVSLLECDDPDLFTWIMGHGRSEN 67

Query: 71 YLRTPIFKKIYDY 83
               +  KI  +
Sbjct: 68 LGHASMVDKIVAH 80


>gi|91227862|ref|ZP_01262035.1| hypothetical protein V12G01_13859 [Vibrio alginolyticus 12G01]
 gi|269965776|ref|ZP_06179873.1| conserved hypothetical protein [Vibrio alginolyticus 40B]
 gi|91188372|gb|EAS74668.1| hypothetical protein V12G01_13859 [Vibrio alginolyticus 12G01]
 gi|269829644|gb|EEZ83881.1| conserved hypothetical protein [Vibrio alginolyticus 40B]
          Length = 86

 Score = 35.0 bits (79), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 34/73 (46%), Gaps = 1/73 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          +I + C RRG  E+D+++  F +     LS  E     S++E DD +LF W  G  +   
Sbjct: 9  RIKWAC-RRGMLELDVVIMPFFEECFDTLSEQEQRDFVSLLECDDPDLFTWVMGHGRSEN 67

Query: 71 YLRTPIFKKIYDY 83
               +  KI  +
Sbjct: 68 LGHAAMVDKIVAH 80


>gi|261211565|ref|ZP_05925853.1| hypothetical protein VCJ_001829 [Vibrio sp. RC341]
 gi|260839520|gb|EEX66146.1| hypothetical protein VCJ_001829 [Vibrio sp. RC341]
          Length = 86

 Score = 35.0 bits (79), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 30/57 (52%), Gaps = 1/57 (1%)

Query: 8  QCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTG 64
          Q  +I + C RRG  E+D+++  F +     L+  E     +++E DD +LF W  G
Sbjct: 6  QKARIKWAC-RRGMLELDVVIMPFFEECFDSLTESEQNDFVALLESDDPDLFSWIMG 61


>gi|254507503|ref|ZP_05119637.1| conserved hypothetical protein [Vibrio parahaemolyticus 16]
 gi|219549573|gb|EED26564.1| conserved hypothetical protein [Vibrio parahaemolyticus 16]
          Length = 86

 Score = 35.0 bits (79), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 34/73 (46%), Gaps = 1/73 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          +I + C RRG  E+D+++  F +     LS  E     S++E DD +LF W  G  +   
Sbjct: 9  RIKWGC-RRGMLELDVVIMPFFEECFESLSENEQRDFVSLLECDDPDLFTWIMGHGRSEN 67

Query: 71 YLRTPIFKKIYDY 83
               +  KI  +
Sbjct: 68 LGHASMVDKIVAH 80


>gi|307129425|ref|YP_003881441.1| hypothetical protein Dda3937_02301 [Dickeya dadantii 3937]
 gi|306526954|gb|ADM96884.1| conserved protein [Dickeya dadantii 3937]
          Length = 88

 Score = 35.0 bits (79), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 17/64 (26%), Positives = 32/64 (50%)

Query: 5  MNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTG 64
          M++  +  ++   RRG RE+D+ +  F +H    LS  +      +++ DD +LF W   
Sbjct: 1  MDINNKSRIHWACRRGMRELDISIMPFFEHEYDTLSDDDKQQFIRLLQCDDPDLFNWLMN 60

Query: 65 MEKP 68
            +P
Sbjct: 61 HGEP 64


>gi|194757578|ref|XP_001961041.1| GF11203 [Drosophila ananassae]
 gi|257096757|sp|B3MGU5|SDF2B_DROAN RecName: Full=Succinate dehydrogenase assembly factor 2-B,
           mitochondrial; Short=SDH assembly factor 2-B; AltName:
           Full=Succinate dehydrogenase subunit 5-B, mitochondrial;
           Flags: Precursor
 gi|190622339|gb|EDV37863.1| GF11203 [Drosophila ananassae]
          Length = 163

 Score = 35.0 bits (79), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 17/84 (20%), Positives = 46/84 (54%), Gaps = 2/84 (2%)

Query: 5   MNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIE--EDDSNLFKWF 62
           ++++ ++++Y+  +RG  E DL+L +F   ++   ++ +    + +I    +D +++ W 
Sbjct: 63  LDIRKQRLLYQSRKRGMLENDLLLSTFAAKYLDNFNAEQTAQYDQLINGVSNDWDIYYWA 122

Query: 63  TGMEKPPEYLRTPIFKKIYDYYSN 86
           T ++  P+   T I + + D+  N
Sbjct: 123 TDVKPTPKEYDTEIMRLLKDHVKN 146


>gi|292487136|ref|YP_003530006.1| hypothetical protein EAMY_0648 [Erwinia amylovora CFBP1430]
 gi|292900482|ref|YP_003539851.1| hypothetical protein EAM_2784 [Erwinia amylovora ATCC 49946]
 gi|291200330|emb|CBJ47458.1| conserved hypothetical protein [Erwinia amylovora ATCC 49946]
 gi|291552553|emb|CBA19598.1| UPF0350 protein plu3555 [Erwinia amylovora CFBP1430]
 gi|312171241|emb|CBX79500.1| UPF0350 protein plu3555 [Erwinia amylovora ATCC BAA-2158]
          Length = 88

 Score = 35.0 bits (79), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 16/66 (24%), Positives = 33/66 (50%)

Query: 5  MNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTG 64
          M++  +  ++   RRG RE+D+ +  F  +    L+  +  +   ++E DD +LF W   
Sbjct: 1  MDITNKSRIHWACRRGMRELDISIMPFFQYEFDSLNDSDKRLFVRLLESDDPDLFNWLMN 60

Query: 65 MEKPPE 70
            +P +
Sbjct: 61 HGEPAD 66


>gi|195383658|ref|XP_002050543.1| GJ20144 [Drosophila virilis]
 gi|257096773|sp|B4LKE5|SDHF2_DROVI RecName: Full=Succinate dehydrogenase assembly factor 2,
           mitochondrial; Short=SDH assembly factor 2; AltName:
           Full=Succinate dehydrogenase subunit 5, mitochondrial;
           Flags: Precursor
 gi|194145340|gb|EDW61736.1| GJ20144 [Drosophila virilis]
          Length = 158

 Score = 34.7 bits (78), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 37/65 (56%), Gaps = 3/65 (4%)

Query: 10  RKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIE--EDDSNLFKWFTGMEK 67
           ++++Y+  +RG  E DL+L +FV  ++ +    E  + + +I    +D +++ W T  + 
Sbjct: 68  QRLLYQSRKRGMLENDLLLSTFVAKYLKDFDEDETALYDKLINGVSNDWDIYYWATETKP 127

Query: 68  -PPEY 71
            PPEY
Sbjct: 128 TPPEY 132


>gi|53804160|ref|YP_113996.1| hypothetical protein MCA1541 [Methylococcus capsulatus str. Bath]
 gi|81175066|sp|Q608F1|Y1541_METCA RecName: Full=UPF0350 protein MCA1541
 gi|53757921|gb|AAU92212.1| conserved domain protein [Methylococcus capsulatus str. Bath]
          Length = 83

 Score = 34.7 bits (78), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 16/58 (27%), Positives = 32/58 (55%), Gaps = 1/58 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKP 68
          ++++ C RRG  E+D +L  +V     E    E    E +++  D++L++  TG+ +P
Sbjct: 6  RLLWSC-RRGMAELDRVLALYVHGAYQEADVSERQAFERLLDLQDADLWRCLTGLARP 62


>gi|293394598|ref|ZP_06638892.1| TPR repeat protein [Serratia odorifera DSM 4582]
 gi|291422907|gb|EFE96142.1| TPR repeat protein [Serratia odorifera DSM 4582]
          Length = 88

 Score = 34.7 bits (78), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 17/66 (25%), Positives = 33/66 (50%)

Query: 5  MNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTG 64
          M++  +  ++   RRG RE+D+ +  F ++    LS  +  +   ++E DD +LF W   
Sbjct: 1  MDINNKARIHWACRRGMRELDISIMPFFEYEYDSLSDKDKALFIRLLECDDPDLFNWLMN 60

Query: 65 MEKPPE 70
             P +
Sbjct: 61 HGAPQD 66


>gi|148652349|ref|YP_001279442.1| hypothetical protein PsycPRwf_0537 [Psychrobacter sp. PRwf-1]
 gi|148571433|gb|ABQ93492.1| protein of unknown function DUF339 [Psychrobacter sp. PRwf-1]
          Length = 90

 Score = 34.7 bits (78), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 14/61 (22%), Positives = 30/61 (49%), Gaps = 1/61 (1%)

Query: 8  QCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEK 67
          + R+++Y+  RRG +E+D  +  +V  + L     E      ++  +D +L  +F   + 
Sbjct: 10 EQRRVIYQA-RRGLKELDFYIDPYVKQYYLTADEDEQATFAKLLTYEDPDLLNYFMNQDT 68

Query: 68 P 68
          P
Sbjct: 69 P 69


>gi|262273720|ref|ZP_06051533.1| DUF339 domain-containing protein [Grimontia hollisae CIP 101886]
 gi|262222135|gb|EEY73447.1| DUF339 domain-containing protein [Grimontia hollisae CIP 101886]
          Length = 86

 Score = 34.7 bits (78), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 36/78 (46%), Gaps = 1/78 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          +I + C RRG  E+D+I+  F +     LS  E     +++E DD +LF W  G  +   
Sbjct: 9  RIKWAC-RRGMLELDVIIMPFFEECFDTLSEDEKQDFVALLECDDPDLFTWLMGHGRSEN 67

Query: 71 YLRTPIFKKIYDYYSNNL 88
               +  KI ++    L
Sbjct: 68 PALAAMTDKIVEHNRRKL 85


>gi|195582194|ref|XP_002080913.1| GD25982 [Drosophila simulans]
 gi|257096764|sp|B4QID8|SDF2B_DROSI RecName: Full=Succinate dehydrogenase assembly factor 2-B,
           mitochondrial; Short=SDH assembly factor 2-B; AltName:
           Full=Succinate dehydrogenase subunit 5-B, mitochondrial;
           Flags: Precursor
 gi|194192922|gb|EDX06498.1| GD25982 [Drosophila simulans]
          Length = 156

 Score = 34.7 bits (78), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 18/85 (21%), Positives = 45/85 (52%), Gaps = 2/85 (2%)

Query: 5   MNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIE--EDDSNLFKWF 62
           + ++ ++++Y+  +RG  E DL+L +FV   + + ++ +    + +I    +D ++F W 
Sbjct: 61  LEIRKQRLLYQSRKRGMLENDLLLSTFVAKHLKDFNAEQTAEYDQLINGVSNDWDIFYWA 120

Query: 63  TGMEKPPEYLRTPIFKKIYDYYSNN 87
           T  +  P    T I + + ++  N+
Sbjct: 121 TDTKPTPPQFDTEIMRLLKEHVKNH 145


>gi|157372132|ref|YP_001480121.1| hypothetical protein Spro_3898 [Serratia proteamaculans 568]
 gi|157323896|gb|ABV42993.1| protein of unknown function DUF339 [Serratia proteamaculans 568]
          Length = 88

 Score = 34.7 bits (78), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 16/66 (24%), Positives = 33/66 (50%)

Query: 5  MNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTG 64
          M++  +  ++   RRG RE+D+ +  F ++    L+  +  +   ++E DD +LF W   
Sbjct: 1  MDINNKARIHWACRRGMRELDISIMPFFEYEYDLLNDTDKALFIRLLESDDPDLFNWLMN 60

Query: 65 MEKPPE 70
             P +
Sbjct: 61 HGAPQD 66


>gi|195431339|ref|XP_002063700.1| GK15773 [Drosophila willistoni]
 gi|257096755|sp|B4MRE7|SDF2A_DROWI RecName: Full=Succinate dehydrogenase assembly factor 2-A,
           mitochondrial; Short=SDH assembly factor 2-A; AltName:
           Full=Succinate dehydrogenase subunit 5-A, mitochondrial;
           Flags: Precursor
 gi|194159785|gb|EDW74686.1| GK15773 [Drosophila willistoni]
          Length = 157

 Score = 34.7 bits (78), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 21/89 (23%), Positives = 45/89 (50%), Gaps = 4/89 (4%)

Query: 2   KKNMNLQCRK--IVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIE--EDDSN 57
           + N  L+ RK  +VY+  +RG  E DL+L +F   ++   +  +  + + +I    +D +
Sbjct: 56  RPNEPLEIRKQRLVYQSRKRGMLENDLLLSTFAAKYLKNFNEEQTAIYDQLINGVSNDWD 115

Query: 58  LFKWFTGMEKPPEYLRTPIFKKIYDYYSN 86
           ++ W T ++  P    T I + + ++  N
Sbjct: 116 IYYWATDVKTTPAEYNTEIMQLLKEHVKN 144


>gi|302878561|ref|YP_003847125.1| hypothetical protein Galf_1335 [Gallionella capsiferriformans ES-2]
 gi|302581350|gb|ADL55361.1| protein of unknown function DUF339 [Gallionella capsiferriformans
           ES-2]
          Length = 110

 Score = 34.7 bits (78), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 18/71 (25%), Positives = 38/71 (53%), Gaps = 1/71 (1%)

Query: 10  RKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPP 69
           +++ +RC RRG  E+D++ G FVD     L++ E    + +++  D+ L+   +G ++  
Sbjct: 38  QRVRWRC-RRGLLELDIVFGRFVDTHYSGLTASERQTFDELLDMPDNPLWDMISGRKETE 96

Query: 70  EYLRTPIFKKI 80
              +  +  KI
Sbjct: 97  TESQAALLAKI 107


>gi|259909559|ref|YP_002649915.1| hypothetical protein EpC_29340 [Erwinia pyrifoliae Ep1/96]
 gi|224965181|emb|CAX56713.1| conserved uncharacterized protein [Erwinia pyrifoliae Ep1/96]
          Length = 88

 Score = 34.7 bits (78), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 16/66 (24%), Positives = 33/66 (50%)

Query: 5  MNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTG 64
          M++  +  ++   RRG RE+D+ +  F  +    L+  +  +   ++E DD +LF W   
Sbjct: 1  MDITNKSRIHWACRRGMRELDISIMPFFQYEFDSLNDGDKRLFVRLLESDDPDLFNWLMN 60

Query: 65 MEKPPE 70
            +P +
Sbjct: 61 HGEPAD 66


>gi|22127158|ref|NP_670581.1| hypothetical protein y3282 [Yersinia pestis KIM 10]
 gi|45443329|ref|NP_994868.1| hypothetical protein YP_3594 [Yersinia pestis biovar Microtus
          str. 91001]
 gi|51597484|ref|YP_071675.1| hypothetical protein YPTB3173 [Yersinia pseudotuberculosis IP
          32953]
 gi|108806368|ref|YP_650284.1| hypothetical protein YPA_0371 [Yersinia pestis Antiqua]
 gi|108813257|ref|YP_649024.1| hypothetical protein YPN_3097 [Yersinia pestis Nepal516]
 gi|145597924|ref|YP_001162000.1| hypothetical protein YPDSF_0618 [Yersinia pestis Pestoides F]
 gi|150260091|ref|ZP_01916819.1| hypothetical protein YPE_2369 [Yersinia pestis CA88-4125]
 gi|153947508|ref|YP_001399857.1| hypothetical protein YpsIP31758_0873 [Yersinia pseudotuberculosis
          IP 31758]
 gi|162418750|ref|YP_001608148.1| hypothetical protein YpAngola_A3841 [Yersinia pestis Angola]
 gi|165924892|ref|ZP_02220724.1| conserved hypothetical protein [Yersinia pestis biovar Orientalis
          str. F1991016]
 gi|165937211|ref|ZP_02225775.1| conserved hypothetical protein [Yersinia pestis biovar Orientalis
          str. IP275]
 gi|166010357|ref|ZP_02231255.1| conserved hypothetical protein [Yersinia pestis biovar Antiqua
          str. E1979001]
 gi|166212757|ref|ZP_02238792.1| conserved hypothetical protein [Yersinia pestis biovar Antiqua
          str. B42003004]
 gi|167400077|ref|ZP_02305595.1| conserved hypothetical protein [Yersinia pestis biovar Antiqua
          str. UG05-0454]
 gi|167418999|ref|ZP_02310752.1| conserved hypothetical protein [Yersinia pestis biovar Orientalis
          str. MG05-1020]
 gi|167425228|ref|ZP_02316981.1| conserved hypothetical protein [Yersinia pestis biovar
          Mediaevalis str. K1973002]
 gi|167467687|ref|ZP_02332391.1| hypothetical protein YpesF_07269 [Yersinia pestis FV-1]
 gi|170023125|ref|YP_001719630.1| hypothetical protein YPK_0876 [Yersinia pseudotuberculosis YPIII]
 gi|186896604|ref|YP_001873716.1| hypothetical protein YPTS_3304 [Yersinia pseudotuberculosis
          PB1/+]
 gi|218928071|ref|YP_002345946.1| hypothetical protein YPO0897 [Yersinia pestis CO92]
 gi|229837584|ref|ZP_04457746.1| conserved protein [Yersinia pestis Pestoides A]
 gi|229840807|ref|ZP_04460966.1| conserved protein [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|229842634|ref|ZP_04462789.1| conserved protein [Yersinia pestis biovar Orientalis str. India
          195]
 gi|229903713|ref|ZP_04518826.1| conserved protein [Yersinia pestis Nepal516]
 gi|270487492|ref|ZP_06204566.1| TPR repeat region-containing protein [Yersinia pestis KIM D27]
 gi|81175080|sp|Q666S3|Y3173_YERPS RecName: Full=UPF0350 protein YPTB3173
 gi|81175093|sp|Q8ZHJ5|Y897_YERPE RecName: Full=UPF0350 protein YPO0897/y3282/YP_3594
 gi|21960220|gb|AAM86832.1|AE013929_5 hypothetical protein y3282 [Yersinia pestis KIM 10]
 gi|45438198|gb|AAS63745.1| conserved hypothetical protein [Yersinia pestis biovar Microtus
          str. 91001]
 gi|51590766|emb|CAH22411.1| Conserved hypothetical protein [Yersinia pseudotuberculosis IP
          32953]
 gi|108776905|gb|ABG19424.1| hypothetical protein YPN_3097 [Yersinia pestis Nepal516]
 gi|108778281|gb|ABG12339.1| hypothetical protein YPA_0371 [Yersinia pestis Antiqua]
 gi|115346682|emb|CAL19565.1| conserved hypothetical protein [Yersinia pestis CO92]
 gi|145209620|gb|ABP39027.1| hypothetical protein YPDSF_0618 [Yersinia pestis Pestoides F]
 gi|149289499|gb|EDM39576.1| hypothetical protein YPE_2369 [Yersinia pestis CA88-4125]
 gi|152959003|gb|ABS46464.1| conserved hypothetical protein [Yersinia pseudotuberculosis IP
          31758]
 gi|162351565|gb|ABX85513.1| conserved hypothetical protein [Yersinia pestis Angola]
 gi|165914685|gb|EDR33298.1| conserved hypothetical protein [Yersinia pestis biovar Orientalis
          str. IP275]
 gi|165923092|gb|EDR40243.1| conserved hypothetical protein [Yersinia pestis biovar Orientalis
          str. F1991016]
 gi|165990843|gb|EDR43144.1| conserved hypothetical protein [Yersinia pestis biovar Antiqua
          str. E1979001]
 gi|166206049|gb|EDR50529.1| conserved hypothetical protein [Yersinia pestis biovar Antiqua
          str. B42003004]
 gi|166962993|gb|EDR59014.1| conserved hypothetical protein [Yersinia pestis biovar Orientalis
          str. MG05-1020]
 gi|167050785|gb|EDR62193.1| conserved hypothetical protein [Yersinia pestis biovar Antiqua
          str. UG05-0454]
 gi|167055628|gb|EDR65412.1| conserved hypothetical protein [Yersinia pestis biovar
          Mediaevalis str. K1973002]
 gi|169749659|gb|ACA67177.1| protein of unknown function DUF339 [Yersinia pseudotuberculosis
          YPIII]
 gi|186699630|gb|ACC90259.1| protein of unknown function DUF339 [Yersinia pseudotuberculosis
          PB1/+]
 gi|229679483|gb|EEO75586.1| conserved protein [Yersinia pestis Nepal516]
 gi|229690944|gb|EEO82998.1| conserved protein [Yersinia pestis biovar Orientalis str. India
          195]
 gi|229697173|gb|EEO87220.1| conserved protein [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|229704272|gb|EEO91283.1| conserved protein [Yersinia pestis Pestoides A]
 gi|270335996|gb|EFA46773.1| TPR repeat region-containing protein [Yersinia pestis KIM D27]
 gi|320014026|gb|ADV97597.1| conserved protein [Yersinia pestis biovar Medievalis str. Harbin
          35]
          Length = 88

 Score = 34.7 bits (78), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 30/58 (51%), Gaps = 1/58 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKP 68
          +I + C RRG RE+D+ +  F ++    LS  E      ++E DD +LF W     +P
Sbjct: 8  RIHWAC-RRGMRELDISIMPFFEYEYDSLSDNEKQAFIRLLECDDPDLFNWLMNHGEP 64


>gi|15642467|ref|NP_232100.1| hypothetical protein VC2471 [Vibrio cholerae O1 biovar El Tor
          str. N16961]
 gi|121590988|ref|ZP_01678307.1| conserved hypothetical protein [Vibrio cholerae 2740-80]
 gi|121729906|ref|ZP_01682331.1| conserved hypothetical protein [Vibrio cholerae V52]
 gi|147673136|ref|YP_001217972.1| hypothetical protein VC0395_A2048 [Vibrio cholerae O395]
 gi|153214520|ref|ZP_01949429.1| conserved hypothetical protein [Vibrio cholerae 1587]
 gi|153820556|ref|ZP_01973223.1| conserved hypothetical protein [Vibrio cholerae NCTC 8457]
 gi|153824241|ref|ZP_01976908.1| conserved hypothetical protein [Vibrio cholerae B33]
 gi|153826903|ref|ZP_01979570.1| conserved hypothetical protein [Vibrio cholerae MZO-2]
 gi|153831097|ref|ZP_01983764.1| conserved hypothetical protein [Vibrio cholerae 623-39]
 gi|183179721|ref|ZP_02957932.1| conserved hypothetical protein [Vibrio cholerae MZO-3]
 gi|227082592|ref|YP_002811143.1| hypothetical protein VCM66_2394 [Vibrio cholerae M66-2]
 gi|229507470|ref|ZP_04396975.1| hypothetical protein VCF_002699 [Vibrio cholerae BX 330286]
 gi|229512335|ref|ZP_04401814.1| hypothetical protein VCE_003747 [Vibrio cholerae B33]
 gi|229514096|ref|ZP_04403558.1| hypothetical protein VCB_001743 [Vibrio cholerae TMA 21]
 gi|229519471|ref|ZP_04408914.1| hypothetical protein VCC_003501 [Vibrio cholerae RC9]
 gi|229521297|ref|ZP_04410717.1| hypothetical protein VIF_001827 [Vibrio cholerae TM 11079-80]
 gi|229524457|ref|ZP_04413862.1| hypothetical protein VCA_002051 [Vibrio cholerae bv. albensis
          VL426]
 gi|229527078|ref|ZP_04416473.1| hypothetical protein VCG_000144 [Vibrio cholerae 12129(1)]
 gi|229606975|ref|YP_002877623.1| hypothetical protein VCD_001884 [Vibrio cholerae MJ-1236]
 gi|254291671|ref|ZP_04962459.1| conserved hypothetical protein [Vibrio cholerae AM-19226]
 gi|254849596|ref|ZP_05238946.1| conserved hypothetical protein [Vibrio cholerae MO10]
 gi|255746859|ref|ZP_05420804.1| hypothetical protein VCH_003256 [Vibrio cholera CIRS 101]
 gi|262162024|ref|ZP_06031040.1| hypothetical protein VIG_003200 [Vibrio cholerae INDRE 91/1]
 gi|262167301|ref|ZP_06035011.1| hypothetical protein VIJ_000462 [Vibrio cholerae RC27]
 gi|262190700|ref|ZP_06048931.1| hypothetical protein VIH_001061 [Vibrio cholerae CT 5369-93]
 gi|297581094|ref|ZP_06943019.1| conserved hypothetical protein [Vibrio cholerae RC385]
 gi|298500173|ref|ZP_07009978.1| conserved hypothetical protein [Vibrio cholerae MAK 757]
 gi|81175076|sp|Q9KPA2|Y2471_VIBCH RecName: Full=UPF0350 protein VC_2471
 gi|9657049|gb|AAF95613.1| conserved hypothetical protein [Vibrio cholerae O1 biovar El Tor
          str. N16961]
 gi|121547165|gb|EAX57294.1| conserved hypothetical protein [Vibrio cholerae 2740-80]
 gi|121628349|gb|EAX60853.1| conserved hypothetical protein [Vibrio cholerae V52]
 gi|124115322|gb|EAY34142.1| conserved hypothetical protein [Vibrio cholerae 1587]
 gi|126508900|gb|EAZ71494.1| conserved hypothetical protein [Vibrio cholerae NCTC 8457]
 gi|126518238|gb|EAZ75463.1| conserved hypothetical protein [Vibrio cholerae B33]
 gi|146315019|gb|ABQ19558.1| conserved hypothetical protein [Vibrio cholerae O395]
 gi|148873418|gb|EDL71553.1| conserved hypothetical protein [Vibrio cholerae 623-39]
 gi|149739266|gb|EDM53528.1| conserved hypothetical protein [Vibrio cholerae MZO-2]
 gi|150422443|gb|EDN14402.1| conserved hypothetical protein [Vibrio cholerae AM-19226]
 gi|183013132|gb|EDT88432.1| conserved hypothetical protein [Vibrio cholerae MZO-3]
 gi|227010480|gb|ACP06692.1| conserved hypothetical protein [Vibrio cholerae M66-2]
 gi|227014363|gb|ACP10573.1| conserved hypothetical protein [Vibrio cholerae O395]
 gi|229335475|gb|EEO00957.1| hypothetical protein VCG_000144 [Vibrio cholerae 12129(1)]
 gi|229338038|gb|EEO03055.1| hypothetical protein VCA_002051 [Vibrio cholerae bv. albensis
          VL426]
 gi|229341829|gb|EEO06831.1| hypothetical protein VIF_001827 [Vibrio cholerae TM 11079-80]
 gi|229344160|gb|EEO09135.1| hypothetical protein VCC_003501 [Vibrio cholerae RC9]
 gi|229349277|gb|EEO14234.1| hypothetical protein VCB_001743 [Vibrio cholerae TMA 21]
 gi|229352300|gb|EEO17241.1| hypothetical protein VCE_003747 [Vibrio cholerae B33]
 gi|229354975|gb|EEO19896.1| hypothetical protein VCF_002699 [Vibrio cholerae BX 330286]
 gi|229369630|gb|ACQ60053.1| hypothetical protein VCD_001884 [Vibrio cholerae MJ-1236]
 gi|254845301|gb|EET23715.1| conserved hypothetical protein [Vibrio cholerae MO10]
 gi|255735261|gb|EET90661.1| hypothetical protein VCH_003256 [Vibrio cholera CIRS 101]
 gi|262024276|gb|EEY42967.1| hypothetical protein VIJ_000462 [Vibrio cholerae RC27]
 gi|262028273|gb|EEY46930.1| hypothetical protein VIG_003200 [Vibrio cholerae INDRE 91/1]
 gi|262033412|gb|EEY51919.1| hypothetical protein VIH_001061 [Vibrio cholerae CT 5369-93]
 gi|297534920|gb|EFH73756.1| conserved hypothetical protein [Vibrio cholerae RC385]
 gi|297540866|gb|EFH76920.1| conserved hypothetical protein [Vibrio cholerae MAK 757]
 gi|327484962|gb|AEA79369.1| conserved hypothetical protein [Vibrio cholerae LMA3894-4]
          Length = 86

 Score = 34.7 bits (78), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 30/57 (52%), Gaps = 1/57 (1%)

Query: 8  QCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTG 64
          Q  +I + C RRG  E+D+++  F +     L+  E     +++E DD +LF W  G
Sbjct: 6  QKARIKWAC-RRGMLELDVVIMPFFEECFDSLTESEQDDFVALLESDDPDLFAWVMG 61


>gi|308495654|ref|XP_003110015.1| hypothetical protein CRE_06477 [Caenorhabditis remanei]
 gi|308244852|gb|EFO88804.1| hypothetical protein CRE_06477 [Caenorhabditis remanei]
          Length = 123

 Score = 34.3 bits (77), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 18/76 (23%), Positives = 44/76 (57%), Gaps = 3/76 (3%)

Query: 11  KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESII--EEDDSNLFKWFTGMEKP 68
           +++Y+  +RG  E D++LG F +  + +++  EL   + +I  E  + +LF + +  + P
Sbjct: 38  RLLYQSKKRGILENDILLGDFAEGNLKKMNETELKAYDKLINGEHMEWDLFYYLSNKKTP 97

Query: 69  PEYLRT-PIFKKIYDY 83
           PE + +  +++K+  +
Sbjct: 98  PEDVESCQVYQKVKKF 113


>gi|310766533|gb|ADP11483.1| hypothetical protein EJP617_18020 [Erwinia sp. Ejp617]
          Length = 88

 Score = 34.3 bits (77), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 16/66 (24%), Positives = 33/66 (50%)

Query: 5  MNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTG 64
          M++  +  ++   RRG RE+D+ +  F  +    L+  +  +   ++E DD +LF W   
Sbjct: 1  MDITNKSRIHWACRRGMRELDISIMPFFQYEFDSLNDDDKRLFVRLLESDDPDLFNWLMN 60

Query: 65 MEKPPE 70
            +P +
Sbjct: 61 HGEPAD 66


>gi|91794126|ref|YP_563777.1| hypothetical protein Sden_2775 [Shewanella denitrificans OS217]
 gi|91716128|gb|ABE56054.1| protein of unknown function DUF339 [Shewanella denitrificans
          OS217]
          Length = 82

 Score = 34.3 bits (77), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 32/60 (53%), Gaps = 1/60 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          ++ + C RRG  E+D++   FV+    +LS  +      ++  +D  LF WF G E+ P+
Sbjct: 8  RVRWAC-RRGMLELDVLFQPFVEAQYQDLSDQDKLDFIRLLTCEDPELFAWFMGHEQCPD 66


>gi|45550404|ref|NP_610586.3| CG12895 [Drosophila melanogaster]
 gi|257096759|sp|A1Z897|SDF2B_DROME RecName: Full=Succinate dehydrogenase assembly factor 2-B,
           mitochondrial; Short=SDH assembly factor 2-B; AltName:
           Full=Succinate dehydrogenase subunit 5-B, mitochondrial;
           Flags: Precursor
 gi|45445590|gb|AAF58794.2| CG12895 [Drosophila melanogaster]
          Length = 156

 Score = 34.3 bits (77), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 21/91 (23%), Positives = 47/91 (51%), Gaps = 4/91 (4%)

Query: 1   MKKNMNLQCRK--IVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIE--EDDS 56
           ++ +  L+ RK  ++Y+  +RG  E DL+L +FV   + + ++ +    + +I    +D 
Sbjct: 55  VRPDEPLETRKQRLLYQSRKRGMLENDLLLSTFVAKHLKDFNAEQTAEYDQLINGVSNDW 114

Query: 57  NLFKWFTGMEKPPEYLRTPIFKKIYDYYSNN 87
           ++F W T  +  P    T I + + ++  N+
Sbjct: 115 DIFYWATDTKPTPPQFDTEIMRLLKEHVKNH 145


>gi|119713594|gb|ABL97645.1| hypothetical protein MBMO_EB0-39H12.0021 [uncultured marine
          bacterium EB0_39H12]
          Length = 87

 Score = 34.3 bits (77), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 42/84 (50%), Gaps = 1/84 (1%)

Query: 5  MNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTG 64
          MN   +KI+++C RRG  E+D I   FV++   ELS+ E+     ++  +D ++F     
Sbjct: 1  MNELEKKILWQC-RRGLWELDAIFIPFVENNFAELSNEEIDSFRELLSFEDIDIFDILVN 59

Query: 65 MEKPPEYLRTPIFKKIYDYYSNNL 88
           +   +     I  KI  Y+ + +
Sbjct: 60 KKPFEDTTLKGIVHKIISYHESRI 83


>gi|149926161|ref|ZP_01914423.1| hypothetical protein LMED105_01473 [Limnobacter sp. MED105]
 gi|149824979|gb|EDM84191.1| hypothetical protein LMED105_01473 [Limnobacter sp. MED105]
          Length = 90

 Score = 34.3 bits (77), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 32/58 (55%)

Query: 23 EMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPEYLRTPIFKKI 80
          E DLI+  F D   +EL++ ++  L  + EE D+ L   F G ++P   L TP  +K+
Sbjct: 26 ENDLIIERFFDKHEMELTNDDVQALTVLFEEVDNVLLDLFLGRKEPEGDLDTPDVRKV 83


>gi|225380645|gb|AAL48877.2| RE29446p [Drosophila melanogaster]
          Length = 163

 Score = 34.3 bits (77), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 21/91 (23%), Positives = 47/91 (51%), Gaps = 4/91 (4%)

Query: 1   MKKNMNLQCRK--IVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIE--EDDS 56
           ++ +  L+ RK  ++Y+  +RG  E DL+L +FV   + + ++ +    + +I    +D 
Sbjct: 62  VRPDEPLETRKQRLLYQSRKRGMLENDLLLSTFVAKHLKDFNAEQTAEYDQLINGVSNDW 121

Query: 57  NLFKWFTGMEKPPEYLRTPIFKKIYDYYSNN 87
           ++F W T  +  P    T I + + ++  N+
Sbjct: 122 DIFYWATDTKPTPPQFDTEIMRLLKEHVKNH 152


>gi|223998156|ref|XP_002288751.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gi|220975859|gb|EED94187.1| predicted protein [Thalassiosira pseudonana CCMP1335]
          Length = 90

 Score = 34.3 bits (77), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 17/76 (22%), Positives = 42/76 (55%)

Query: 2  KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
          ++ ++++ +++VYR  +RG  E+DL+LG++    +  LS  EL   E  +  +  +++  
Sbjct: 15 ERELDVRKKRLVYRSKQRGWLEVDLLLGTWASENVASLSVDELNDFEQFVNLETIDIYNV 74

Query: 62 FTGMEKPPEYLRTPIF 77
           T     P+ +++ + 
Sbjct: 75 LTLRVDVPKEMQSTVV 90


>gi|157835280|pdb|2JR5|A Chain A, Solution Structure Of Upf0350 Protein Vc_2471. Northeast
          Structural Genomics Target Vcr36
          Length = 94

 Score = 34.3 bits (77), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 30/57 (52%), Gaps = 1/57 (1%)

Query: 8  QCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTG 64
          Q  +I + C RRG  E+D+++  F +     L+  E     +++E DD +LF W  G
Sbjct: 6  QKARIKWAC-RRGMLELDVVIMPFFEECFDSLTESEQDDFVALLESDDPDLFAWVMG 61


>gi|195333141|ref|XP_002033250.1| GM20523 [Drosophila sechellia]
 gi|257096763|sp|B4HMQ1|SDF2B_DROSE RecName: Full=Succinate dehydrogenase assembly factor 2-B,
           mitochondrial; Short=SDH assembly factor 2-B; AltName:
           Full=Succinate dehydrogenase subunit 5-B, mitochondrial;
           Flags: Precursor
 gi|194125220|gb|EDW47263.1| GM20523 [Drosophila sechellia]
          Length = 156

 Score = 34.3 bits (77), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 21/91 (23%), Positives = 47/91 (51%), Gaps = 4/91 (4%)

Query: 1   MKKNMNLQCRK--IVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIE--EDDS 56
           ++ +  L+ RK  ++Y+  +RG  E DL+L +FV   + + ++ +    + +I    +D 
Sbjct: 55  VRPDEPLETRKQRLLYQSRKRGMLENDLLLSTFVAKHLKDFNAEQTAEYDQLINGVSNDW 114

Query: 57  NLFKWFTGMEKPPEYLRTPIFKKIYDYYSNN 87
           ++F W T  +  P    T I + + ++  N+
Sbjct: 115 DIFYWATDTKPTPPQFDTEIMRLLKEHVKNH 145


>gi|163752425|ref|ZP_02159617.1| hypothetical protein KT99_03484 [Shewanella benthica KT99]
 gi|161327684|gb|EDP98876.1| hypothetical protein KT99_03484 [Shewanella benthica KT99]
          Length = 66

 Score = 34.3 bits (77), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 27/48 (56%)

Query: 23 EMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          E+D+I   FV+ +  +LS     +   ++E +D  LF WF G E+ P+
Sbjct: 3  ELDVIFQPFVERYYEQLSVKNKEVFVRLLEGEDPELFAWFMGHEQCPD 50


>gi|160872824|ref|ZP_02062956.1| conserved domain protein [Rickettsiella grylli]
 gi|159121623|gb|EDP46961.1| conserved domain protein [Rickettsiella grylli]
          Length = 85

 Score = 34.3 bits (77), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 17/71 (23%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 10 RKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPP 69
          +++ ++C RRG  E+DL+L +F+D+  L L+     + E ++   DS L+ +    +   
Sbjct: 9  QRLRWQC-RRGMLELDLLLKAFLDNRYLSLTPSNQVLFEQLLTYSDSALYAYLIQRKPVS 67

Query: 70 EYLRTPIFKKI 80
          + L   + +++
Sbjct: 68 DSLMQALIEQV 78


>gi|157169420|ref|XP_001651508.1| hypothetical protein AaeL_AAEL005866 [Aedes aegypti]
 gi|122117908|sp|Q178L7|SDHF2_AEDAE RecName: Full=Succinate dehydrogenase assembly factor 2,
           mitochondrial; Short=SDH assembly factor 2; AltName:
           Full=Succinate dehydrogenase subunit 5, mitochondrial;
           Flags: Precursor
 gi|108878400|gb|EAT42625.1| conserved hypothetical protein [Aedes aegypti]
          Length = 161

 Score = 34.3 bits (77), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 43/89 (48%), Gaps = 4/89 (4%)

Query: 2   KKNMNLQCRK--IVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESII--EEDDSN 57
           KKN  LQ +K  ++Y+  +RG  E  L+L +F    +  +   +  + + +I    +D +
Sbjct: 60  KKNEPLQLQKSRLLYQSRKRGMLENGLLLSTFAAKHLESMDVKQTKLYDQLINMPTNDWD 119

Query: 58  LFKWFTGMEKPPEYLRTPIFKKIYDYYSN 86
           +F W TG++  P      I   + D+  N
Sbjct: 120 IFYWATGVKPTPAEYDNEIMALLKDHVKN 148


>gi|261253909|ref|ZP_05946482.1| hypothetical protein VIA_003936 [Vibrio orientalis CIP 102891]
 gi|260937300|gb|EEX93289.1| hypothetical protein VIA_003936 [Vibrio orientalis CIP 102891]
          Length = 86

 Score = 34.3 bits (77), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 34/76 (44%), Gaps = 1/76 (1%)

Query: 8  QCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEK 67
          Q  +I + C RRG  E+D+++  F +     L   E     S++E DD +LF W  G  +
Sbjct: 6  QKARIKWAC-RRGMLELDVVIMPFFEECFESLKENEQQDFVSLLECDDPDLFTWIMGHGR 64

Query: 68 PPEYLRTPIFKKIYDY 83
                  +  KI  +
Sbjct: 65 SENLGHASMVDKIVAH 80


>gi|238796536|ref|ZP_04640043.1| hypothetical protein ymoll0001_30010 [Yersinia mollaretii ATCC
          43969]
 gi|238719514|gb|EEQ11323.1| hypothetical protein ymoll0001_30010 [Yersinia mollaretii ATCC
          43969]
          Length = 88

 Score = 34.3 bits (77), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 31/58 (53%), Gaps = 1/58 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKP 68
          +I + C RRG RE+D+ +  F ++    LS  E  +   ++E DD +LF W     +P
Sbjct: 8  RIHWAC-RRGMRELDISIMPFFEYEYDGLSDHEKQVFIRLLECDDPDLFNWLMNHGEP 64


>gi|19115550|ref|NP_594638.1| DUF339 family protein [Schizosaccharomyces pombe 972h-]
 gi|1723550|sp|Q10440|SDHF2_SCHPO RecName: Full=Succinate dehydrogenase assembly factor 2,
           mitochondrial; Short=SDH assembly factor 2; AltName:
           Full=Early meiotic induction protein 5; AltName:
           Full=Succinate dehydrogenase subunit 5, mitochondrial;
           Flags: Precursor
 gi|1262419|emb|CAA94696.1| DUF339 family protein [Schizosaccharomyces pombe]
          Length = 139

 Score = 34.3 bits (77), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 39/74 (52%), Gaps = 1/74 (1%)

Query: 11  KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
           ++ Y+  +RG  E DL+L +F    I +     L   + +++E D ++  W +G  + PE
Sbjct: 51  RLKYQSRKRGILETDLLLSNFAKDQIDKYPVSLLREYDQLLDEPDWDILYWCSGEREAPE 110

Query: 71  -YLRTPIFKKIYDY 83
            +  + +FK++  Y
Sbjct: 111 KWKSSQVFKELSKY 124


>gi|194757950|ref|XP_001961225.1| GF11110 [Drosophila ananassae]
 gi|257096748|sp|B3MI37|SDF2A_DROAN RecName: Full=Succinate dehydrogenase assembly factor 2-A,
           mitochondrial; Short=SDH assembly factor 2-A; AltName:
           Full=Succinate dehydrogenase subunit 5-A, mitochondrial;
           Flags: Precursor
 gi|190622523|gb|EDV38047.1| GF11110 [Drosophila ananassae]
          Length = 156

 Score = 34.3 bits (77), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 21/89 (23%), Positives = 45/89 (50%), Gaps = 4/89 (4%)

Query: 2   KKNMNLQCRK--IVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIE--EDDSN 57
           + +  L+ RK  ++Y+  +RG  E DL+L +FV  ++   ++ +    + +I    +D +
Sbjct: 56  RPDEPLETRKQRLLYQSRKRGMLENDLLLSTFVAKYLKSFTADQTAQYDDLINGVSNDWD 115

Query: 58  LFKWFTGMEKPPEYLRTPIFKKIYDYYSN 86
           +F W T  +  P    T I + + ++  N
Sbjct: 116 IFYWATETKPTPPEFDTEIMRLLKEHVKN 144


>gi|238786190|ref|ZP_04630140.1| hypothetical protein yberc0001_38460 [Yersinia bercovieri ATCC
          43970]
 gi|238787326|ref|ZP_04631125.1| hypothetical protein yfred0001_33140 [Yersinia frederiksenii ATCC
          33641]
 gi|238712907|gb|EEQ04969.1| hypothetical protein yberc0001_38460 [Yersinia bercovieri ATCC
          43970]
 gi|238724588|gb|EEQ16229.1| hypothetical protein yfred0001_33140 [Yersinia frederiksenii ATCC
          33641]
          Length = 88

 Score = 34.3 bits (77), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 31/58 (53%), Gaps = 1/58 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKP 68
          +I + C RRG RE+D+ +  F ++    LS  E  +   ++E DD +LF W     +P
Sbjct: 8  RIHWAC-RRGMRELDISIMPFFEYEYDGLSDNEKQVFIRLLECDDPDLFNWLMNHGEP 64


>gi|313231888|emb|CBY09000.1| unnamed protein product [Oikopleura dioica]
          Length = 156

 Score = 33.9 bits (76), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 19/78 (24%), Positives = 40/78 (51%), Gaps = 7/78 (8%)

Query: 2   KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEE-------D 54
           ++N  L+ +++ ++  +RG  E DL+LG+F D ++ + +  ++   + II          
Sbjct: 32  EENEELKRKRLFWQSRKRGITENDLLLGTFADQYLKDFTMEQMLAYDRIINSTVYDPTVT 91

Query: 55  DSNLFKWFTGMEKPPEYL 72
           + +L+ WF      PE L
Sbjct: 92  EWDLYYWFVEERPYPEDL 109


>gi|308457857|ref|XP_003091290.1| hypothetical protein CRE_02694 [Caenorhabditis remanei]
 gi|308257404|gb|EFP01357.1| hypothetical protein CRE_02694 [Caenorhabditis remanei]
          Length = 2081

 Score = 33.9 bits (76), Expect = 7.1,   Method: Composition-based stats.
 Identities = 19/49 (38%), Positives = 27/49 (55%), Gaps = 3/49 (6%)

Query: 26  LILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPEYLRT 74
           L+  + VDH  L+LS    T++ S+IEE D N F  F     PP ++ T
Sbjct: 489 LVPATVVDHSSLKLSH---TVVTSVIEEYDINRFVQFVSRTSPPHHITT 534


>gi|308460117|ref|XP_003092366.1| hypothetical protein CRE_06158 [Caenorhabditis remanei]
 gi|308253521|gb|EFO97473.1| hypothetical protein CRE_06158 [Caenorhabditis remanei]
          Length = 1491

 Score = 33.9 bits (76), Expect = 7.1,   Method: Composition-based stats.
 Identities = 19/49 (38%), Positives = 27/49 (55%), Gaps = 3/49 (6%)

Query: 26  LILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPEYLRT 74
           L+  + VDH  L+LS    T++ S+IEE D N F  F     PP ++ T
Sbjct: 867 LVPATVVDHSSLKLSH---TVVTSVIEEYDINRFVQFVSRTSPPHHITT 912


>gi|28899356|ref|NP_798961.1| hypothetical protein VP2582 [Vibrio parahaemolyticus RIMD
          2210633]
 gi|153840081|ref|ZP_01992748.1| protein YgfY [Vibrio parahaemolyticus AQ3810]
 gi|260362197|ref|ZP_05775184.1| conserved hypothetical protein [Vibrio parahaemolyticus K5030]
 gi|260878955|ref|ZP_05891310.1| conserved hypothetical protein [Vibrio parahaemolyticus AN-5034]
 gi|260897480|ref|ZP_05905976.1| conserved hypothetical protein [Vibrio parahaemolyticus Peru-466]
 gi|260899630|ref|ZP_05908025.1| conserved hypothetical protein [Vibrio parahaemolyticus AQ4037]
 gi|81175077|sp|Q87LM9|Y2582_VIBPA RecName: Full=UPF0350 protein VP2582
 gi|28807592|dbj|BAC60845.1| conserved hypothetical protein [Vibrio parahaemolyticus RIMD
          2210633]
 gi|149746327|gb|EDM57386.1| protein YgfY [Vibrio parahaemolyticus AQ3810]
 gi|308088018|gb|EFO37713.1| conserved hypothetical protein [Vibrio parahaemolyticus Peru-466]
 gi|308090454|gb|EFO40149.1| conserved hypothetical protein [Vibrio parahaemolyticus AN-5034]
 gi|308108235|gb|EFO45775.1| conserved hypothetical protein [Vibrio parahaemolyticus AQ4037]
 gi|308113965|gb|EFO51505.1| conserved hypothetical protein [Vibrio parahaemolyticus K5030]
 gi|328474113|gb|EGF44918.1| hypothetical protein VP10329_15435 [Vibrio parahaemolyticus
          10329]
          Length = 86

 Score = 33.9 bits (76), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 34/73 (46%), Gaps = 1/73 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          +I + C RRG  E+D+++  F +     L+  E     S++E DD +LF W  G  +   
Sbjct: 9  RIKWAC-RRGMLELDVVIMPFFEECFDALNEQEQRDFVSLLECDDPDLFTWVMGHGRSEN 67

Query: 71 YLRTPIFKKIYDY 83
               +  KI  +
Sbjct: 68 LGHAAMVDKIVAH 80


>gi|323335642|gb|EGA76925.1| Emi5p [Saccharomyces cerevisiae Vin13]
          Length = 126

 Score = 33.9 bits (76), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 14/51 (27%), Positives = 31/51 (60%)

Query: 11  KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
           +++Y+  +RG  E DL+L  F   ++ +++  EL   +S++ E D +++ W
Sbjct: 65  RLIYQSRKRGILETDLLLSGFAAKYLKKMNEEELEEYDSLLNELDWDIYYW 115


>gi|149192319|ref|ZP_01870527.1| hypothetical protein VSAK1_07924 [Vibrio shilonii AK1]
 gi|148833852|gb|EDL50881.1| hypothetical protein VSAK1_07924 [Vibrio shilonii AK1]
          Length = 86

 Score = 33.9 bits (76), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 34/73 (46%), Gaps = 1/73 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          +I + C RRG  E+D+++  F +     L+  E     S++E DD +LF W  G  +   
Sbjct: 9  RIKWAC-RRGMLELDVVIMPFFEECFDTLNDQEQKDFVSLLECDDPDLFTWVMGHGRSEN 67

Query: 71 YLRTPIFKKIYDY 83
               +  KI  +
Sbjct: 68 LGHASMVDKIVAH 80


>gi|84390095|ref|ZP_00991357.1| hypothetical protein V12B01_07920 [Vibrio splendidus 12B01]
 gi|86146367|ref|ZP_01064691.1| hypothetical protein MED222_22341 [Vibrio sp. MED222]
 gi|148981089|ref|ZP_01816282.1| hypothetical protein VSWAT3_20910 [Vibrionales bacterium SWAT-3]
 gi|218710579|ref|YP_002418200.1| hypothetical protein VS_2629 [Vibrio splendidus LGP32]
 gi|84376749|gb|EAP93624.1| hypothetical protein V12B01_07920 [Vibrio splendidus 12B01]
 gi|85835846|gb|EAQ53980.1| hypothetical protein MED222_22341 [Vibrio sp. MED222]
 gi|145960992|gb|EDK26316.1| hypothetical protein VSWAT3_20910 [Vibrionales bacterium SWAT-3]
 gi|218323598|emb|CAV19848.1| Hypothetical protein VS_2629 [Vibrio splendidus LGP32]
          Length = 86

 Score = 33.9 bits (76), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 34/76 (44%), Gaps = 1/76 (1%)

Query: 8  QCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEK 67
          Q  +I + C RRG  E+D+++  F +     L   E     S++E DD +LF W  G  +
Sbjct: 6  QKARIKWGC-RRGMLELDVVIMPFFEECFDSLQEQEQREFVSLLECDDPDLFTWVMGHGR 64

Query: 68 PPEYLRTPIFKKIYDY 83
                  +  KI  +
Sbjct: 65 SENLGHASMVDKIVAH 80


>gi|153835741|ref|ZP_01988408.1| protein YgfY [Vibrio harveyi HY01]
 gi|156975801|ref|YP_001446708.1| hypothetical protein VIBHAR_03545 [Vibrio harveyi ATCC BAA-1116]
 gi|269960414|ref|ZP_06174787.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
 gi|148867600|gb|EDL66904.1| protein YgfY [Vibrio harveyi HY01]
 gi|156527395|gb|ABU72481.1| hypothetical protein VIBHAR_03545 [Vibrio harveyi ATCC BAA-1116]
 gi|269834841|gb|EEZ88927.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
          Length = 86

 Score = 33.9 bits (76), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 34/73 (46%), Gaps = 1/73 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          +I + C RRG  E+D+++  F +     L+  E     S++E DD +LF W  G  +   
Sbjct: 9  RIKWAC-RRGMLELDVVIMPFFEECFDALNEQEQRDFVSLLECDDPDLFTWVMGHGRSEN 67

Query: 71 YLRTPIFKKIYDY 83
               +  KI  +
Sbjct: 68 LGHASMVDKIVAH 80


>gi|312881727|ref|ZP_07741504.1| hypothetical protein VIBC2010_00610 [Vibrio caribbenthicus ATCC
          BAA-2122]
 gi|309370617|gb|EFP98092.1| hypothetical protein VIBC2010_00610 [Vibrio caribbenthicus ATCC
          BAA-2122]
          Length = 86

 Score = 33.9 bits (76), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 19/73 (26%), Positives = 34/73 (46%), Gaps = 1/73 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          +I + C RRG  E+D+++  F +     LS  E     +++E DD +LF W  G  +   
Sbjct: 9  RIKWAC-RRGMLELDVVIMPFFEECFEGLSDDEQQDFVALLECDDPDLFTWIMGHGRSEN 67

Query: 71 YLRTPIFKKIYDY 83
               +  K+  +
Sbjct: 68 LKHASMIDKVVAH 80


>gi|238752997|ref|ZP_04614456.1| hypothetical protein yrohd0001_18630 [Yersinia rohdei ATCC 43380]
 gi|238708785|gb|EEQ01044.1| hypothetical protein yrohd0001_18630 [Yersinia rohdei ATCC 43380]
          Length = 88

 Score = 33.9 bits (76), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 30/58 (51%), Gaps = 1/58 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKP 68
          +I + C RRG RE+D+ +  F ++    LS  E      ++E DD +LF W     +P
Sbjct: 8  RIHWAC-RRGMRELDISIMPFFEYEYDGLSESEKQTFIRLLECDDPDLFNWLMNHGEP 64


>gi|238759288|ref|ZP_04620454.1| hypothetical protein yaldo0001_5150 [Yersinia aldovae ATCC 35236]
 gi|238702449|gb|EEP95000.1| hypothetical protein yaldo0001_5150 [Yersinia aldovae ATCC 35236]
          Length = 88

 Score = 33.9 bits (76), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 31/58 (53%), Gaps = 1/58 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKP 68
          +I + C RRG RE+D+ +  F ++    LS  E  +   ++E DD +LF W     +P
Sbjct: 8  RIHWAC-RRGMRELDISIMPFFEYEYDGLSDHEKYVFIRLLECDDPDLFNWLMNHGEP 64


>gi|332970367|gb|EGK09359.1| TPR repeat protein [Kingella kingae ATCC 23330]
          Length = 82

 Score = 33.9 bits (76), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 36/71 (50%), Gaps = 1/71 (1%)

Query: 10 RKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPP 69
          R+I ++  RRG  E+D++L  F +     LS  EL++L  I+  +D +   +    + P 
Sbjct: 10 RRIRFQ-MRRGLLELDIVLKRFAEKEFSTLSDEELSVLVDILALEDQDFLAFINQYDTPE 68

Query: 70 EYLRTPIFKKI 80
               PI +KI
Sbjct: 69 RQDFLPILEKI 79


>gi|257093963|ref|YP_003167604.1| hypothetical protein CAP2UW1_2386 [Candidatus Accumulibacter
          phosphatis clade IIA str. UW-1]
 gi|257046487|gb|ACV35675.1| protein of unknown function DUF339 [Candidatus Accumulibacter
          phosphatis clade IIA str. UW-1]
          Length = 84

 Score = 33.5 bits (75), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 17/72 (23%), Positives = 34/72 (47%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          ++ +RC RR   EMDL+LG F+D     L+  +      + + +D  L+    G  +  +
Sbjct: 9  RLRWRCTRRAMLEMDLLLGEFLDRLYPSLTPPQADAFVILADMEDLELWPLVNGSRESSD 68

Query: 71 YLRTPIFKKIYD 82
           ++  +   + D
Sbjct: 69 PVQAEVLALLRD 80


Searching..................................................done


Results from round 2




>gi|254780946|ref|YP_003065359.1| hypothetical protein CLIBASIA_04225 [Candidatus Liberibacter
          asiaticus str. psy62]
 gi|254040623|gb|ACT57419.1| hypothetical protein CLIBASIA_04225 [Candidatus Liberibacter
          asiaticus str. psy62]
          Length = 98

 Score =  139 bits (352), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 98/98 (100%), Positives = 98/98 (100%)

Query: 1  MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
          MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK
Sbjct: 1  MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60

Query: 61 WFTGMEKPPEYLRTPIFKKIYDYYSNNLDRKNMLGSLQ 98
          WFTGMEKPPEYLRTPIFKKIYDYYSNNLDRKNMLGSLQ
Sbjct: 61 WFTGMEKPPEYLRTPIFKKIYDYYSNNLDRKNMLGSLQ 98


>gi|190891738|ref|YP_001978280.1| hypothetical protein RHECIAT_CH0002144 [Rhizobium etli CIAT 652]
 gi|190697017|gb|ACE91102.1| hypothetical conserved protein [Rhizobium etli CIAT 652]
          Length = 127

 Score =  133 bits (335), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 32/85 (37%), Positives = 51/85 (60%)

Query: 2   KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
              ++ + R+I++RCW RG REMDL+ G F +  I  LS  EL   E+I+ E+D++L +W
Sbjct: 34  SAGLDPRRRRILFRCWHRGIREMDLVFGQFAEAEIATLSDAELDEFETIMAEEDNDLVRW 93

Query: 62  FTGMEKPPEYLRTPIFKKIYDYYSN 86
             G    PE  +TP+F ++  Y  +
Sbjct: 94  IMGTWPVPERFQTPMFARLAAYTPD 118


>gi|86357713|ref|YP_469605.1| hypothetical protein RHE_CH02094 [Rhizobium etli CFN 42]
 gi|86281815|gb|ABC90878.1| hypothetical conserved protein [Rhizobium etli CFN 42]
          Length = 127

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 32/85 (37%), Positives = 51/85 (60%)

Query: 2   KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
              ++ + R+I++RCW RG REMDL+ G F +  I  LS  EL   E+I+ E+D++L +W
Sbjct: 34  SAGLDPRRRRILFRCWHRGIREMDLVFGQFAEAEIATLSDAELDEFETIMAEEDNDLVRW 93

Query: 62  FTGMEKPPEYLRTPIFKKIYDYYSN 86
             G    PE  +TP+F ++  Y  +
Sbjct: 94  IMGTWPVPERFQTPMFARLAAYKPD 118


>gi|218462027|ref|ZP_03502118.1| hypothetical protein RetlK5_22233 [Rhizobium etli Kim 5]
          Length = 101

 Score =  130 bits (329), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 32/85 (37%), Positives = 51/85 (60%)

Query: 2  KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
             ++ + R+I++RCW RG REMDL+ G F +  I  LS  EL   E+I+ E+D++L +W
Sbjct: 8  SAGLDPRRRRILFRCWHRGIREMDLVFGQFAEAEIATLSDAELDEFETIMAEEDNDLLRW 67

Query: 62 FTGMEKPPEYLRTPIFKKIYDYYSN 86
            G    PE  +TP+F ++  Y  +
Sbjct: 68 IMGTWPVPERFQTPMFARLAAYTPD 92


>gi|209549325|ref|YP_002281242.1| hypothetical protein Rleg2_1729 [Rhizobium leguminosarum bv.
          trifolii WSM2304]
 gi|209535081|gb|ACI55016.1| protein of unknown function DUF339 [Rhizobium leguminosarum bv.
          trifolii WSM2304]
          Length = 101

 Score =  130 bits (329), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 32/85 (37%), Positives = 51/85 (60%)

Query: 2  KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
             ++ + R+I++RCW RG REMDL+ G F +  I  LS  EL   E+I+ E+D++L +W
Sbjct: 8  SAGLDPRRRRILFRCWHRGIREMDLVFGQFAEAEIATLSEAELDEFETIMAEEDNDLVRW 67

Query: 62 FTGMEKPPEYLRTPIFKKIYDYYSN 86
            G    PE  +TP+F ++  Y  +
Sbjct: 68 IMGTWPVPERFQTPMFARLAAYTPD 92


>gi|218514910|ref|ZP_03511750.1| hypothetical protein Retl8_15022 [Rhizobium etli 8C-3]
 gi|327188303|gb|EGE55522.1| hypothetical protein RHECNPAF_92009 [Rhizobium etli CNPAF512]
          Length = 101

 Score =  130 bits (329), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 32/85 (37%), Positives = 51/85 (60%)

Query: 2  KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
             ++ + R+I++RCW RG REMDL+ G F +  I  LS  EL   E+I+ E+D++L +W
Sbjct: 8  SAGLDPRRRRILFRCWHRGIREMDLVFGQFAEAEIATLSDAELDEFETIMAEEDNDLVRW 67

Query: 62 FTGMEKPPEYLRTPIFKKIYDYYSN 86
            G    PE  +TP+F ++  Y  +
Sbjct: 68 IMGTWPVPERFQTPMFARLAAYTPD 92


>gi|37728038|gb|AAO43499.1| unknown [Rhizobium etli]
          Length = 101

 Score =  130 bits (327), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 32/85 (37%), Positives = 51/85 (60%)

Query: 2  KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
             ++ + R+I++RCW RG REMDL+ G F +  I  LS  EL   E+I+ E+D++L +W
Sbjct: 8  SAGLDPRRRRILFRCWHRGIREMDLVFGQFAEAEIATLSDAELDEFETIMAEEDNDLVRW 67

Query: 62 FTGMEKPPEYLRTPIFKKIYDYYSN 86
            G    PE  +TP+F ++  Y  +
Sbjct: 68 IMGTWPVPERFQTPMFARLAAYKPD 92


>gi|218670942|ref|ZP_03520613.1| hypothetical protein RetlG_04428 [Rhizobium etli GR56]
          Length = 92

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 32/85 (37%), Positives = 51/85 (60%)

Query: 2  KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
             ++ + R+I++RCW RG REMDL+ G F +  I  LS  EL   E+I+ E+D++L +W
Sbjct: 8  SAGLDPRRRRILFRCWHRGIREMDLVFGQFAEAEIATLSETELDEFETIMAEEDNDLVRW 67

Query: 62 FTGMEKPPEYLRTPIFKKIYDYYSN 86
            G    PE  +TP+F ++  Y  +
Sbjct: 68 IMGTWPVPERFQTPMFARLAAYTPD 92


>gi|239833943|ref|ZP_04682271.1| Hypothetical protein, conserved [Ochrobactrum intermedium LMG 3301]
 gi|239822006|gb|EEQ93575.1| Hypothetical protein, conserved [Ochrobactrum intermedium LMG 3301]
          Length = 178

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 32/82 (39%), Positives = 50/82 (60%)

Query: 2   KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
            +N++++ RK+++R W RG REMDLILG + D +I+  +  +L   E I+E  D +L KW
Sbjct: 91  TENLDVRRRKLLFRAWHRGMREMDLILGQYADAYIVGFTDPQLDEFEHILEVLDRDLLKW 150

Query: 62  FTGMEKPPEYLRTPIFKKIYDY 83
            TG    P    TP+F+ I  +
Sbjct: 151 VTGESPIPADYDTPLFRDIVAF 172


>gi|241204638|ref|YP_002975734.1| hypothetical protein Rleg_1913 [Rhizobium leguminosarum bv.
          trifolii WSM1325]
 gi|240858528|gb|ACS56195.1| protein of unknown function DUF339 [Rhizobium leguminosarum bv.
          trifolii WSM1325]
          Length = 101

 Score =  129 bits (325), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 32/85 (37%), Positives = 51/85 (60%)

Query: 2  KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
             ++ + R+I++RCW RG REMDL+ G F +  +  LS  EL   E+I+ E+D++L +W
Sbjct: 8  SAGLDPRRRRILFRCWHRGIREMDLVFGQFAEAEVARLSEAELDEFETIMAEEDNDLVRW 67

Query: 62 FTGMEKPPEYLRTPIFKKIYDYYSN 86
            G    PE  +TP+F +I  Y  +
Sbjct: 68 IMGTWPVPERFQTPMFARIAAYKPD 92


>gi|222085972|ref|YP_002544504.1| hypothetical protein Arad_2362 [Agrobacterium radiobacter K84]
 gi|221723420|gb|ACM26576.1| conserved hypothetical protein [Agrobacterium radiobacter K84]
          Length = 104

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 35/94 (37%), Positives = 59/94 (62%)

Query: 2   KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
             +++ + R+I++RCW RG REMDL+ G F D+ +  LS  +L   E I++E+D++L +W
Sbjct: 8   SADLDPRRRRILFRCWHRGLREMDLVFGQFADNELPGLSETDLDEFERIMDEEDNDLVRW 67

Query: 62  FTGMEKPPEYLRTPIFKKIYDYYSNNLDRKNMLG 95
             G    PE+L+TP+FK++  Y  +  +    LG
Sbjct: 68  ILGTLPVPEHLQTPLFKRVAAYKPDFEEVAERLG 101


>gi|116252137|ref|YP_767975.1| hypothetical protein RL2385 [Rhizobium leguminosarum bv. viciae
          3841]
 gi|115256785|emb|CAK07875.1| conserved hypothetical protein [Rhizobium leguminosarum bv.
          viciae 3841]
          Length = 101

 Score =  127 bits (319), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 33/85 (38%), Positives = 50/85 (58%)

Query: 2  KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
             ++ + R+I++RCW RG REMDL+ G F +  I  LS  EL   E+I+ E+D++L +W
Sbjct: 8  SAGLDPRRRRILFRCWHRGLREMDLVFGQFAEAEIAMLSEAELDEFETIMAEEDNDLVRW 67

Query: 62 FTGMEKPPEYLRTPIFKKIYDYYSN 86
            G    PE   TP+F +I  Y  +
Sbjct: 68 IMGTWPVPERFHTPMFARIAAYKPD 92


>gi|220926925|ref|YP_002502227.1| hypothetical protein Mnod_7184 [Methylobacterium nodulans ORS
          2060]
 gi|219951532|gb|ACL61924.1| protein of unknown function DUF339 [Methylobacterium nodulans ORS
          2060]
          Length = 98

 Score =  127 bits (319), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 31/85 (36%), Positives = 51/85 (60%)

Query: 2  KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
            +++ + R+ ++R W RG REMDLI+G F D  I  L+  EL   E +IE  D +LF+W
Sbjct: 8  SADLDPRRRRTLFRSWHRGIREMDLIMGRFADAEIGTLTDAELDEFERLIEVPDRDLFRW 67

Query: 62 FTGMEKPPEYLRTPIFKKIYDYYSN 86
            G E+ P    TP+F+++  ++ +
Sbjct: 68 ICGEEEAPANYDTPVFRRLKGFHQH 92


>gi|158422844|ref|YP_001524136.1| hypothetical protein AZC_1220 [Azorhizobium caulinodans ORS 571]
 gi|158329733|dbj|BAF87218.1| uncharacterized conserved protein [Azorhizobium caulinodans ORS
          571]
          Length = 98

 Score =  126 bits (318), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 34/83 (40%), Positives = 52/83 (62%)

Query: 2  KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
             ++++ R+I+YR W RGTREMDLI+G F D  I  L+  E+ + E ++E +D +LF W
Sbjct: 8  SAGLDVRRRRIIYRAWHRGTREMDLIMGRFADANIETLTEAEVDIFEHLLEIEDPDLFSW 67

Query: 62 FTGMEKPPEYLRTPIFKKIYDYY 84
           +G    P  L TP F+KI  ++
Sbjct: 68 LSGSLPVPAELDTPFFRKIQTWH 90


>gi|170744354|ref|YP_001773009.1| hypothetical protein M446_6309 [Methylobacterium sp. 4-46]
 gi|168198628|gb|ACA20575.1| protein of unknown function DUF339 [Methylobacterium sp. 4-46]
          Length = 98

 Score =  125 bits (316), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 31/85 (36%), Positives = 52/85 (61%)

Query: 2  KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
            +++ + R+ ++R W RG REMDLI+G F D  I  L+  EL   E +IE  D +LF+W
Sbjct: 8  SADLDPRRRRTLFRSWHRGIREMDLIMGRFADAEIGTLTEEELDNFERLIEVPDRDLFRW 67

Query: 62 FTGMEKPPEYLRTPIFKKIYDYYSN 86
           +G E+ P    TP+F+++  ++ +
Sbjct: 68 ISGEEEAPSNYDTPVFRRLKGFHQH 92


>gi|114704428|ref|ZP_01437336.1| hypothetical protein FP2506_05826 [Fulvimarina pelagi HTCC2506]
 gi|114539213|gb|EAU42333.1| hypothetical protein FP2506_05826 [Fulvimarina pelagi HTCC2506]
          Length = 148

 Score =  125 bits (314), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 29/84 (34%), Positives = 52/84 (61%)

Query: 2   KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
            ++++ + +K ++R W RGTREMDL+ G F D  I  LS  ++   E+++   D  +FKW
Sbjct: 51  SEDLDTRRKKALFRSWHRGTREMDLVFGRFADAEIATLSDEDMDHYEALMLAPDPEIFKW 110

Query: 62  FTGMEKPPEYLRTPIFKKIYDYYS 85
            +G +  P    TP+F++I ++Y+
Sbjct: 111 VSGEKAVPGNYDTPVFRRIKEFYT 134


>gi|170748063|ref|YP_001754323.1| hypothetical protein Mrad2831_1645 [Methylobacterium
          radiotolerans JCM 2831]
 gi|170654585|gb|ACB23640.1| protein of unknown function DUF339 [Methylobacterium
          radiotolerans JCM 2831]
          Length = 98

 Score =  125 bits (314), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 32/86 (37%), Positives = 54/86 (62%)

Query: 2  KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
            +++ + R+++YR W RG REMDLI+G F D  I +LS  EL   E++IE  D +LFKW
Sbjct: 8  SADLDPRRRRLLYRAWHRGIREMDLIMGRFADAEIGDLSEAELDQFEALIEVPDRDLFKW 67

Query: 62 FTGMEKPPEYLRTPIFKKIYDYYSNN 87
           TG  + P    T +++++  ++ ++
Sbjct: 68 LTGEVETPSNYDTSVWQRVRAFHRHD 93


>gi|188583861|ref|YP_001927306.1| hypothetical protein Mpop_4675 [Methylobacterium populi BJ001]
 gi|179347359|gb|ACB82771.1| protein of unknown function DUF339 [Methylobacterium populi
          BJ001]
          Length = 98

 Score =  122 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 32/86 (37%), Positives = 55/86 (63%)

Query: 2  KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
            +++ + R+ ++R W RG REMDLI+G F D  I +LS  EL   E++IE  D +LF+W
Sbjct: 8  SADLDPRRRRTLFRAWHRGIREMDLIMGRFADAEIGDLSEEELAQFEALIEVPDRDLFRW 67

Query: 62 FTGMEKPPEYLRTPIFKKIYDYYSNN 87
           TG +  PE   TP+++++  ++ ++
Sbjct: 68 LTGEDATPENYDTPVYRRLQAFHRHD 93


>gi|159184914|ref|NP_354764.2| hypothetical protein Atu1779 [Agrobacterium tumefaciens str. C58]
 gi|159140193|gb|AAK87549.2| conserved hypothetical protein [Agrobacterium tumefaciens str.
          C58]
          Length = 103

 Score =  122 bits (307), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 36/85 (42%), Positives = 55/85 (64%)

Query: 2  KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
            +++ + R+I+YRCW RG REMDL+LG F +  I  LS  +L  LE I+ E+D++L + 
Sbjct: 8  SADLDPRRRRILYRCWHRGIREMDLVLGQFAEDNIAGLSDEQLDELEIIMAEEDNDLVQM 67

Query: 62 FTGMEKPPEYLRTPIFKKIYDYYSN 86
           TG +  PE  +TP+F+KI  Y  +
Sbjct: 68 VTGAQPVPEKFQTPLFEKIASYRPD 92


>gi|218532419|ref|YP_002423235.1| hypothetical protein Mchl_4531 [Methylobacterium chloromethanicum
          CM4]
 gi|218524722|gb|ACK85307.1| protein of unknown function DUF339 [Methylobacterium
          chloromethanicum CM4]
          Length = 98

 Score =  121 bits (304), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 32/86 (37%), Positives = 55/86 (63%)

Query: 2  KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
            +++ + R+ ++R W RG REMDLI+G F D  I  LS  ELT  E++IE  D +LF+W
Sbjct: 8  SADLDPRRRRTLFRAWHRGIREMDLIMGRFADAEIGALSEEELTQFEALIEVPDRDLFRW 67

Query: 62 FTGMEKPPEYLRTPIFKKIYDYYSNN 87
           TG ++ PE   T +++++  ++ ++
Sbjct: 68 LTGEDETPENYDTAVYRRLKAFHRHD 93


>gi|240140978|ref|YP_002965458.1| hypothetical protein MexAM1_META1p4551 [Methylobacterium
          extorquens AM1]
 gi|240010955|gb|ACS42181.1| conserved hypothetical protein [Methylobacterium extorquens AM1]
          Length = 98

 Score =  121 bits (304), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 32/86 (37%), Positives = 54/86 (62%)

Query: 2  KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
            +++ + R+ ++R W RG REMDLI+G F D  I  LS  ELT  E++IE  D +LF+W
Sbjct: 8  SADLDPRRRRTLFRAWHRGIREMDLIMGRFADAEIGALSEEELTQFEALIEVPDRDLFRW 67

Query: 62 FTGMEKPPEYLRTPIFKKIYDYYSNN 87
           TG +  PE   T +++++  ++ ++
Sbjct: 68 LTGEDATPENYDTAVYRRLKAFHRHD 93


>gi|197105083|ref|YP_002130460.1| hypothetical protein PHZ_c1620 [Phenylobacterium zucineum HLK1]
 gi|196478503|gb|ACG78031.1| conserved hypothetical protein [Phenylobacterium zucineum HLK1]
          Length = 95

 Score =  120 bits (303), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 29/96 (30%), Positives = 48/96 (50%), Gaps = 2/96 (2%)

Query: 1  MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
          M ++ + + +K+  R WRRG RE DLILG F D  +   S  EL   E ++E+ D +L+ 
Sbjct: 1  MTED-DPRQKKLKLRAWRRGFREADLILGPFADKHVSTFSPEELDWFERLLEQPDQDLYA 59

Query: 61 WFTGMEKPPEYLRTPIFKKIYDYYSNNLDRKNMLGS 96
          W    E  P      + +++  +  + +  K M G 
Sbjct: 60 WIVDREPVPAAFDGELMRRLKTF-RDEVYAKGMTGG 94


>gi|46204975|ref|ZP_00049218.2| COG2938: Uncharacterized conserved protein [Magnetospirillum
          magnetotacticum MS-1]
          Length = 98

 Score =  120 bits (303), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 32/86 (37%), Positives = 55/86 (63%)

Query: 2  KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
            +++ + R+ ++R W RG REMDLI+G F D  I +LS  ELT  E++IE  D +LF+W
Sbjct: 8  SADLDPRRRRTLFRAWHRGIREMDLIMGRFADSEIGDLSEEELTEFEALIEVPDRDLFRW 67

Query: 62 FTGMEKPPEYLRTPIFKKIYDYYSNN 87
           TG  + PE   T +++++  ++ ++
Sbjct: 68 LTGEAETPENYDTAVYRRLKAFHKHD 93


>gi|294853623|ref|ZP_06794295.1| hypothetical protein BAZG_02599 [Brucella sp. NVSL 07-0026]
 gi|294819278|gb|EFG36278.1| hypothetical protein BAZG_02599 [Brucella sp. NVSL 07-0026]
          Length = 110

 Score =  120 bits (302), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 32/82 (39%), Positives = 50/82 (60%)

Query: 2   KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
            +N++++ RK+++R W RG REMDLILG + D +I+  +  +L   E I+E  D +L KW
Sbjct: 23  TENLDVRRRKLLFRAWHRGMREMDLILGQYADKYIVSFNDDQLNEFEHILEVLDRDLLKW 82

Query: 62  FTGMEKPPEYLRTPIFKKIYDY 83
            TG    P    TP+F+ I  +
Sbjct: 83  VTGESPIPAEYDTPLFRDIVAF 104


>gi|325293165|ref|YP_004279029.1| hypothetical protein AGROH133_06781 [Agrobacterium sp. H13-3]
 gi|325061018|gb|ADY64709.1| hypothetical protein AGROH133_06781 [Agrobacterium sp. H13-3]
          Length = 103

 Score =  120 bits (302), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 37/85 (43%), Positives = 54/85 (63%)

Query: 2  KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
            +++ + R+I+YRCW RG REMDL+LG F +  I  LS  +L  LE I+ E+D++L K 
Sbjct: 8  SADLDPRRRRILYRCWHRGIREMDLVLGQFAEDNIAGLSDDQLDELEIIMAEEDNDLVKM 67

Query: 62 FTGMEKPPEYLRTPIFKKIYDYYSN 86
           TG    PE  +TP+F+KI  Y  +
Sbjct: 68 VTGALPVPEKFQTPLFEKIASYRPD 92


>gi|240850602|ref|YP_002972002.1| hypothetical protein Bgr_10510 [Bartonella grahamii as4aup]
 gi|240267725|gb|ACS51313.1| hypothetical protein Bgr_10510 [Bartonella grahamii as4aup]
          Length = 95

 Score =  120 bits (302), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 32/84 (38%), Positives = 52/84 (61%)

Query: 2  KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
          K  ++++ R++++R W RG REMDLI G +VD  I  ++   L+ LE I+  DD +L  W
Sbjct: 8  KNQLDVRRRRLIFRAWHRGIREMDLIFGHYVDAHITGMNDKTLSELEYIMSFDDRDLLTW 67

Query: 62 FTGMEKPPEYLRTPIFKKIYDYYS 85
           TG   PP  + +P+F+ I +Y +
Sbjct: 68 ITGEVSPPSEVDSPLFRDIANYRT 91


>gi|49475639|ref|YP_033680.1| hypothetical protein BH08760 [Bartonella henselae str. Houston-1]
 gi|49238446|emb|CAF27674.1| hypothetical protein BH08760 [Bartonella henselae str. Houston-1]
          Length = 96

 Score =  120 bits (301), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 33/83 (39%), Positives = 53/83 (63%)

Query: 2  KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
          +  ++L+ R++++R W RG REMDLILG +VD  I  +S  +++ LE I+  DD +L  W
Sbjct: 8  ENQLDLRRRRLIFRAWHRGIREMDLILGRYVDAHISGMSVKKISELEYIMSFDDRDLLTW 67

Query: 62 FTGMEKPPEYLRTPIFKKIYDYY 84
           TG   PP  +  P+F+ I +Y+
Sbjct: 68 ITGEISPPSEVDGPLFRDIINYH 90


>gi|163853559|ref|YP_001641602.1| hypothetical protein Mext_4162 [Methylobacterium extorquens PA1]
 gi|254563489|ref|YP_003070584.1| hypothetical protein METDI5158 [Methylobacterium extorquens DM4]
 gi|163665164|gb|ABY32531.1| protein of unknown function DUF339 [Methylobacterium extorquens
          PA1]
 gi|254270767|emb|CAX26772.1| conserved hypothetical protein [Methylobacterium extorquens DM4]
          Length = 98

 Score =  120 bits (301), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 32/86 (37%), Positives = 54/86 (62%)

Query: 2  KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
            +++ + R+ ++R W RG REMDLI+G F D  I  LS  ELT  E++IE  D +LF+W
Sbjct: 8  SADLDPRRRRTLFRAWHRGIREMDLIMGRFADSEIGALSEEELTQFEALIEVPDRDLFRW 67

Query: 62 FTGMEKPPEYLRTPIFKKIYDYYSNN 87
           TG +  PE   T +++++  ++ ++
Sbjct: 68 LTGEDATPENYDTAVYRRLKAFHRHD 93


>gi|150396614|ref|YP_001327081.1| hypothetical protein Smed_1400 [Sinorhizobium medicae WSM419]
 gi|150028129|gb|ABR60246.1| protein of unknown function DUF339 [Sinorhizobium medicae WSM419]
          Length = 103

 Score =  120 bits (301), Expect = 9e-26,   Method: Composition-based stats.
 Identities = 34/85 (40%), Positives = 53/85 (62%)

Query: 2  KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
            +++ + R+I++R W RG REMDLILG F +  +  LS  EL  LE+I+ E+D++L +W
Sbjct: 8  SADLDPRRRRILFRAWHRGIREMDLILGQFAEAELATLSEAELDELEAIMGEEDNDLVRW 67

Query: 62 FTGMEKPPEYLRTPIFKKIYDYYSN 86
           TG +  PE   T +F +I  Y  +
Sbjct: 68 ITGEKPLPERYATELFLRIAAYRPD 92


>gi|153010962|ref|YP_001372176.1| hypothetical protein Oant_3641 [Ochrobactrum anthropi ATCC 49188]
 gi|151562850|gb|ABS16347.1| protein of unknown function DUF339 [Ochrobactrum anthropi ATCC
          49188]
          Length = 95

 Score =  120 bits (301), Expect = 9e-26,   Method: Composition-based stats.
 Identities = 32/82 (39%), Positives = 50/82 (60%)

Query: 2  KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
           +N++++ RK+++R W RG REMDLILG + D +I+  +  +L   E I+E  D +L KW
Sbjct: 8  TENLDVRRRKLLFRAWHRGMREMDLILGQYADEYIVGFTDPQLNEFEHILEVLDRDLLKW 67

Query: 62 FTGMEKPPEYLRTPIFKKIYDY 83
           TG    P    TP+F+ I  +
Sbjct: 68 VTGESPIPADYDTPLFRDIVAF 89


>gi|225629076|ref|ZP_03787109.1| Hypothetical protein, conserved [Brucella ceti str. Cudo]
 gi|237817110|ref|ZP_04596102.1| Hypothetical protein, conserved [Brucella abortus str. 2308 A]
 gi|225615572|gb|EEH12621.1| Hypothetical protein, conserved [Brucella ceti str. Cudo]
 gi|237787923|gb|EEP62139.1| Hypothetical protein, conserved [Brucella abortus str. 2308 A]
          Length = 110

 Score =  120 bits (301), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 32/82 (39%), Positives = 50/82 (60%)

Query: 2   KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
            +N++++ RK+++R W RG REMDLILG + D +I+  +  +L   E I+E  D +L KW
Sbjct: 23  TENLDVRRRKLLFRAWHRGMREMDLILGQYADKYIVSFNDDQLNEFEHILEVLDRDLLKW 82

Query: 62  FTGMEKPPEYLRTPIFKKIYDY 83
            TG    P    TP+F+ I  +
Sbjct: 83  VTGESPIPAEYDTPLFRDIVAF 104


>gi|23500324|ref|NP_699764.1| hypothetical protein BRA0580 [Brucella suis 1330]
 gi|62317563|ref|YP_223416.1| hypothetical protein BruAb2_0644 [Brucella abortus bv. 1 str.
          9-941]
 gi|83269544|ref|YP_418835.1| hypothetical protein BAB2_0660 [Brucella melitensis biovar
          Abortus 2308]
 gi|148558220|ref|YP_001257568.1| hypothetical protein BOV_A0545 [Brucella ovis ATCC 25840]
 gi|161620642|ref|YP_001594528.1| hypothetical protein BCAN_B0580 [Brucella canis ATCC 23365]
 gi|163844732|ref|YP_001622387.1| hypothetical protein BSUIS_B0576 [Brucella suis ATCC 23445]
 gi|189022817|ref|YP_001932558.1| Protein of unknown function DUF339 [Brucella abortus S19]
 gi|225686366|ref|YP_002734338.1| hypothetical protein BMEA_B0554 [Brucella melitensis ATCC 23457]
 gi|254691060|ref|ZP_05154314.1| hypothetical protein Babob68_13104 [Brucella abortus bv. 6 str.
          870]
 gi|254695634|ref|ZP_05157462.1| hypothetical protein Babob3T_13532 [Brucella abortus bv. 3 str.
          Tulya]
 gi|254698845|ref|ZP_05160673.1| hypothetical protein Babob28_14417 [Brucella abortus bv. 2 str.
          86/8/59]
 gi|254699817|ref|ZP_05161645.1| hypothetical protein Bsuib55_03001 [Brucella suis bv. 5 str. 513]
 gi|254702955|ref|ZP_05164783.1| hypothetical protein Bsuib36_03259 [Brucella suis bv. 3 str. 686]
 gi|254705927|ref|ZP_05167755.1| hypothetical protein BpinM_02696 [Brucella pinnipedialis
          M163/99/10]
 gi|254711151|ref|ZP_05172962.1| hypothetical protein BpinB_12992 [Brucella pinnipedialis B2/94]
 gi|254712391|ref|ZP_05174202.1| hypothetical protein BcetM6_03231 [Brucella ceti M644/93/1]
 gi|254715463|ref|ZP_05177274.1| hypothetical protein BcetM_03251 [Brucella ceti M13/05/1]
 gi|254720433|ref|ZP_05182244.1| hypothetical protein Bru83_13077 [Brucella sp. 83/13]
 gi|254732292|ref|ZP_05190870.1| hypothetical protein Babob42_14205 [Brucella abortus bv. 4 str.
          292]
 gi|256015356|ref|YP_003105365.1| hypothetical protein BMI_II574 [Brucella microti CCM 4915]
 gi|256029532|ref|ZP_05443146.1| hypothetical protein BpinM2_02555 [Brucella pinnipedialis
          M292/94/1]
 gi|256059227|ref|ZP_05449433.1| hypothetical protein Bneo5_02547 [Brucella neotomae 5K33]
 gi|256111503|ref|ZP_05452517.1| hypothetical protein Bmelb3E_02664 [Brucella melitensis bv. 3
          str. Ether]
 gi|256157727|ref|ZP_05455645.1| hypothetical protein BcetM4_02580 [Brucella ceti M490/95/1]
 gi|256253302|ref|ZP_05458838.1| hypothetical protein BcetB_03181 [Brucella ceti B1/94]
 gi|256256245|ref|ZP_05461781.1| hypothetical protein Babob9C_02540 [Brucella abortus bv. 9 str.
          C68]
 gi|256262493|ref|ZP_05465025.1| conserved hypothetical protein [Brucella melitensis bv. 2 str.
          63/9]
 gi|260167378|ref|ZP_05754189.1| hypothetical protein BruF5_03139 [Brucella sp. F5/99]
 gi|260544800|ref|ZP_05820621.1| conserved hypothetical protein [Brucella abortus NCTC 8038]
 gi|260568133|ref|ZP_05838602.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40]
 gi|260756657|ref|ZP_05869005.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870]
 gi|260760088|ref|ZP_05872436.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292]
 gi|260763326|ref|ZP_05875658.1| conserved hypothetical protein [Brucella abortus bv. 2 str.
          86/8/59]
 gi|260882474|ref|ZP_05894088.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68]
 gi|261216032|ref|ZP_05930313.1| conserved hypothetical protein [Brucella abortus bv. 3 str.
          Tulya]
 gi|261217196|ref|ZP_05931477.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261220416|ref|ZP_05934697.1| conserved hypothetical protein [Brucella ceti B1/94]
 gi|261313355|ref|ZP_05952552.1| conserved hypothetical protein [Brucella pinnipedialis
          M163/99/10]
 gi|261318743|ref|ZP_05957940.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261320067|ref|ZP_05959264.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|261323177|ref|ZP_05962374.1| conserved hypothetical protein [Brucella neotomae 5K33]
 gi|261750289|ref|ZP_05993998.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513]
 gi|261753562|ref|ZP_05997271.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686]
 gi|261756786|ref|ZP_06000495.1| conserved hypothetical protein [Brucella sp. F5/99]
 gi|265985453|ref|ZP_06098188.1| conserved hypothetical protein [Brucella sp. 83/13]
 gi|265986541|ref|ZP_06099098.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1]
 gi|265993001|ref|ZP_06105558.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
          Ether]
 gi|265996233|ref|ZP_06108790.1| conserved hypothetical protein [Brucella ceti M490/95/1]
 gi|297249603|ref|ZP_06933304.1| hypothetical protein BAYG_02362 [Brucella abortus bv. 5 str.
          B3196]
 gi|306838990|ref|ZP_07471811.1| protein of unknown function DUF339 [Brucella sp. NF 2653]
 gi|306841772|ref|ZP_07474458.1| protein of unknown function DUF339 [Brucella sp. BO2]
 gi|306845911|ref|ZP_07478479.1| protein of unknown function DUF339 [Brucella sp. BO1]
 gi|23463937|gb|AAN33769.1| conserved hypothetical protein [Brucella suis 1330]
 gi|62197756|gb|AAX76055.1| conserved hypothetical protein [Brucella abortus bv. 1 str.
          9-941]
 gi|82939818|emb|CAJ12826.1| Protein of unknown function DUF339 [Brucella melitensis biovar
          Abortus 2308]
 gi|148369505|gb|ABQ62377.1| conserved hypothetical protein [Brucella ovis ATCC 25840]
 gi|161337453|gb|ABX63757.1| protein of unknown function DUF339 [Brucella canis ATCC 23365]
 gi|163675455|gb|ABY39565.1| Hypothetical protein, conserved [Brucella suis ATCC 23445]
 gi|189021391|gb|ACD74112.1| Protein of unknown function DUF339 [Brucella abortus S19]
 gi|225642471|gb|ACO02384.1| protein of unknown function DUF339 [Brucella melitensis ATCC
          23457]
 gi|255998016|gb|ACU49703.1| hypothetical protein BMI_II574 [Brucella microti CCM 4915]
 gi|260098071|gb|EEW81945.1| conserved hypothetical protein [Brucella abortus NCTC 8038]
 gi|260154798|gb|EEW89879.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40]
 gi|260670406|gb|EEX57346.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292]
 gi|260673747|gb|EEX60568.1| conserved hypothetical protein [Brucella abortus bv. 2 str.
          86/8/59]
 gi|260676765|gb|EEX63586.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870]
 gi|260872002|gb|EEX79071.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68]
 gi|260917639|gb|EEX84500.1| conserved hypothetical protein [Brucella abortus bv. 3 str.
          Tulya]
 gi|260919000|gb|EEX85653.1| conserved hypothetical protein [Brucella ceti B1/94]
 gi|260922285|gb|EEX88853.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261292757|gb|EEX96253.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|261297966|gb|EEY01463.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261299157|gb|EEY02654.1| conserved hypothetical protein [Brucella neotomae 5K33]
 gi|261302381|gb|EEY05878.1| conserved hypothetical protein [Brucella pinnipedialis
          M163/99/10]
 gi|261736770|gb|EEY24766.1| conserved hypothetical protein [Brucella sp. F5/99]
 gi|261740042|gb|EEY27968.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513]
 gi|261743315|gb|EEY31241.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686]
 gi|262550530|gb|EEZ06691.1| conserved hypothetical protein [Brucella ceti M490/95/1]
 gi|262763871|gb|EEZ09903.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
          Ether]
 gi|263092230|gb|EEZ16527.1| conserved hypothetical protein [Brucella melitensis bv. 2 str.
          63/9]
 gi|264658738|gb|EEZ28999.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1]
 gi|264664045|gb|EEZ34306.1| conserved hypothetical protein [Brucella sp. 83/13]
 gi|297173472|gb|EFH32836.1| hypothetical protein BAYG_02362 [Brucella abortus bv. 5 str.
          B3196]
 gi|306273803|gb|EFM55641.1| protein of unknown function DUF339 [Brucella sp. BO1]
 gi|306288177|gb|EFM59564.1| protein of unknown function DUF339 [Brucella sp. BO2]
 gi|306405896|gb|EFM62154.1| protein of unknown function DUF339 [Brucella sp. NF 2653]
 gi|326410737|gb|ADZ67801.1| conserved hypothetical protein [Brucella melitensis M28]
 gi|326554030|gb|ADZ88669.1| conserved hypothetical protein [Brucella melitensis M5-90]
          Length = 95

 Score =  119 bits (300), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 32/82 (39%), Positives = 50/82 (60%)

Query: 2  KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
           +N++++ RK+++R W RG REMDLILG + D +I+  +  +L   E I+E  D +L KW
Sbjct: 8  TENLDVRRRKLLFRAWHRGMREMDLILGQYADKYIVSFNDDQLNEFEHILEVLDRDLLKW 67

Query: 62 FTGMEKPPEYLRTPIFKKIYDY 83
           TG    P    TP+F+ I  +
Sbjct: 68 VTGESPIPAEYDTPLFRDIVAF 89


>gi|163760201|ref|ZP_02167284.1| hypothetical protein HPDFL43_08064 [Hoeflea phototrophica DFL-43]
 gi|162282600|gb|EDQ32888.1| hypothetical protein HPDFL43_08064 [Hoeflea phototrophica DFL-43]
          Length = 107

 Score =  119 bits (300), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 34/85 (40%), Positives = 54/85 (63%)

Query: 2  KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
            +++ + R+I+ R WRRG REMDL++G F D  I  L   EL  LE++++EDD ++ KW
Sbjct: 8  SADLDPRRRRILVRAWRRGIREMDLVIGGFADAEIGTLDEAELDQLEALMDEDDGDILKW 67

Query: 62 FTGMEKPPEYLRTPIFKKIYDYYSN 86
           TG  + PE  RT +F+++  Y  +
Sbjct: 68 VTGEAETPERFRTAVFERMRAYVPD 92


>gi|154248181|ref|YP_001419139.1| hypothetical protein Xaut_4261 [Xanthobacter autotrophicus Py2]
 gi|154162266|gb|ABS69482.1| protein of unknown function DUF339 [Xanthobacter autotrophicus
          Py2]
          Length = 98

 Score =  119 bits (300), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 34/83 (40%), Positives = 50/83 (60%)

Query: 2  KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
             ++ + R+I++R W RG REMDLILG F +  I  LS  EL   E+++E DD  +F W
Sbjct: 8  SDGLDERRRRILFRAWHRGMREMDLILGGFANVEIETLSDAELDAFEALLEPDDQKVFSW 67

Query: 62 FTGMEKPPEYLRTPIFKKIYDYY 84
           +  E  P    TP+F+KI D++
Sbjct: 68 ISASEPTPAEFDTPLFRKIRDFH 90


>gi|15965405|ref|NP_385758.1| hypothetical protein SMc00227 [Sinorhizobium meliloti 1021]
 gi|307308796|ref|ZP_07588492.1| protein of unknown function DUF339 [Sinorhizobium meliloti
          BL225C]
 gi|307317269|ref|ZP_07596710.1| protein of unknown function DUF339 [Sinorhizobium meliloti AK83]
 gi|15074586|emb|CAC46231.1| Conserved hypothetical protein [Sinorhizobium meliloti 1021]
 gi|306897357|gb|EFN28102.1| protein of unknown function DUF339 [Sinorhizobium meliloti AK83]
 gi|306900802|gb|EFN31413.1| protein of unknown function DUF339 [Sinorhizobium meliloti
          BL225C]
          Length = 101

 Score =  119 bits (300), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 34/85 (40%), Positives = 53/85 (62%)

Query: 2  KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
            +++ + R+I++R W RG REMDLILG F +  +  LS  EL  LE+I+ E+D++L +W
Sbjct: 8  SADLDPRRRRILFRAWHRGIREMDLILGQFAEAELATLSEAELDELEAIMGEEDNDLVRW 67

Query: 62 FTGMEKPPEYLRTPIFKKIYDYYSN 86
           TG +  PE   T +F +I  Y  +
Sbjct: 68 ITGEKPLPERYATELFFRIAAYRPD 92


>gi|167646580|ref|YP_001684243.1| hypothetical protein Caul_2618 [Caulobacter sp. K31]
 gi|167349010|gb|ABZ71745.1| protein of unknown function DUF339 [Caulobacter sp. K31]
          Length = 97

 Score =  119 bits (299), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 28/83 (33%), Positives = 42/83 (50%)

Query: 1  MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
          M  + + + R++ +R W RG RE DLILG F D     L+  +L   E ++EE D  ++ 
Sbjct: 1  MTIDHDSRLRRLKFRAWHRGFREADLILGPFADTHGPNLTPEQLDTFEILMEESDREIYA 60

Query: 61 WFTGMEKPPEYLRTPIFKKIYDY 83
          W  G E  PE   T +   I  +
Sbjct: 61 WIVGQEPTPEKFDTDVLTLIKTF 83


>gi|222148734|ref|YP_002549691.1| hypothetical protein Avi_2364 [Agrobacterium vitis S4]
 gi|221735720|gb|ACM36683.1| conserved hypothetical protein [Agrobacterium vitis S4]
          Length = 115

 Score =  118 bits (297), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 31/85 (36%), Positives = 52/85 (61%)

Query: 2  KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
            +++ + R+I++RCW RG REMDL+LG F +  I  L+  EL  LE I+ E+D++L  W
Sbjct: 8  SADLDPRRRRILFRCWHRGIREMDLMLGQFAEAEISALNDAELDDLELIMAEEDNDLISW 67

Query: 62 FTGMEKPPEYLRTPIFKKIYDYYSN 86
            G    P +++ P+F++I     +
Sbjct: 68 INGAAPVPVHMQIPLFERIAATRPD 92


>gi|192291315|ref|YP_001991920.1| hypothetical protein Rpal_2937 [Rhodopseudomonas palustris TIE-1]
 gi|192285064|gb|ACF01445.1| protein of unknown function DUF339 [Rhodopseudomonas palustris
          TIE-1]
          Length = 96

 Score =  118 bits (297), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 32/82 (39%), Positives = 49/82 (59%)

Query: 2  KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
             ++ + +++++RCW RGTREMDLILG F D  I  LS  EL  LE +IE +D +L+  
Sbjct: 8  SGGLDDRRKRLLFRCWHRGTREMDLILGQFADAEIGTLSEAELDELERLIEVNDHDLYAA 67

Query: 62 FTGMEKPPEYLRTPIFKKIYDY 83
            G +  P   +  +F++I  Y
Sbjct: 68 VAGGDTLPAEFKGGLFERIKTY 89


>gi|316934178|ref|YP_004109160.1| hypothetical protein Rpdx1_2844 [Rhodopseudomonas palustris DX-1]
 gi|315601892|gb|ADU44427.1| protein of unknown function DUF339 [Rhodopseudomonas palustris
          DX-1]
          Length = 96

 Score =  118 bits (297), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 32/82 (39%), Positives = 49/82 (59%)

Query: 2  KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
             ++ + +++++RCW RGTREMDLILG F D  I  LS  EL  LE +IE +D +L+  
Sbjct: 8  SGGLDDRRKRLLFRCWHRGTREMDLILGQFADAEIGTLSEAELDELERLIEVNDHDLYAA 67

Query: 62 FTGMEKPPEYLRTPIFKKIYDY 83
            G +  P   +  +F++I  Y
Sbjct: 68 VAGGDTLPAEFKGGLFERIKTY 89


>gi|16126088|ref|NP_420652.1| hypothetical protein CC_1845 [Caulobacter crescentus CB15]
 gi|13423284|gb|AAK23820.1| hypothetical protein CC_1845 [Caulobacter crescentus CB15]
          Length = 116

 Score =  117 bits (294), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 26/83 (31%), Positives = 42/83 (50%)

Query: 1   MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
           M  + + + R++ +R W RG RE DLILG F D     L+  +   LE+++E+ D  ++ 
Sbjct: 20  MTIDHDSRLRRLRFRAWHRGFREADLILGPFADTHGPNLTPEQFDTLETLLEQSDREIYA 79

Query: 61  WFTGMEKPPEYLRTPIFKKIYDY 83
           W  G E  P    T +   I  +
Sbjct: 80  WIVGQEPTPAKFETDVMAMIRTF 102


>gi|304391610|ref|ZP_07373552.1| putative protein EMI5-like protein [Ahrensia sp. R2A130]
 gi|303295839|gb|EFL90197.1| putative protein EMI5-like protein [Ahrensia sp. R2A130]
          Length = 93

 Score =  117 bits (294), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 21/83 (25%), Positives = 48/83 (57%)

Query: 2  KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
             ++ + +++++R W RG REMD +LG+F +  I ++S  +L   E +++  D +++KW
Sbjct: 8  SAGLDARRKRLLFRSWHRGMREMDYVLGTFANAAIEDMSDEQLAEFEMLMQVPDPDMYKW 67

Query: 62 FTGMEKPPEYLRTPIFKKIYDYY 84
           +G  + P      + ++I  ++
Sbjct: 68 LSGTIEVPPNWNNEVVRRIRKFH 90


>gi|49474196|ref|YP_032238.1| hypothetical protein BQ05830 [Bartonella quintana str. Toulouse]
 gi|49239700|emb|CAF26075.1| hypothetical protein BQ05830 [Bartonella quintana str. Toulouse]
          Length = 96

 Score =  117 bits (294), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 33/83 (39%), Positives = 54/83 (65%)

Query: 2  KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
          +  ++++ R++++R W RG RE+DLILG +VD  I E+S+  L+ LE I+  DD +L  W
Sbjct: 8  ENQLDIRRRRLIFRAWHRGIREIDLILGHYVDAHIGEMSNKMLSELEYIMSFDDRDLLTW 67

Query: 62 FTGMEKPPEYLRTPIFKKIYDYY 84
           TG   PP  +  P+F+ I +Y+
Sbjct: 68 ITGEISPPSEVDGPLFRDIINYH 90


>gi|319405679|emb|CBI79302.1| conserved hypothetical protein [Bartonella sp. AR 15-3]
          Length = 96

 Score =  117 bits (294), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 29/84 (34%), Positives = 51/84 (60%)

Query: 2  KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
          +  ++ + R++++R W RG RE+DLI G +VD  I ++S   ++ LE I+  +D +L  W
Sbjct: 8  ENQLDSRRRRLIFRAWHRGIREIDLIFGQYVDAHINKMSDQTVSKLEYIMSFEDRDLLTW 67

Query: 62 FTGMEKPPEYLRTPIFKKIYDYYS 85
           TG    P  + +P+F+ I +Y S
Sbjct: 68 ITGEVSVPSEVDSPLFRDIINYCS 91


>gi|115524795|ref|YP_781706.1| hypothetical protein RPE_2789 [Rhodopseudomonas palustris BisA53]
 gi|115518742|gb|ABJ06726.1| protein of unknown function DUF339 [Rhodopseudomonas palustris
          BisA53]
          Length = 96

 Score =  117 bits (294), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 34/90 (37%), Positives = 53/90 (58%), Gaps = 2/90 (2%)

Query: 2  KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
             ++ + +++++RCW RGTREMDLILG F D  I  LS VE+  LE + E +D +L+  
Sbjct: 8  SGGLDDRRKRLLFRCWHRGTREMDLILGQFADAEIGTLSEVEVDELEGLTELNDHDLYAA 67

Query: 62 FTGMEKPPEYLRTPIFKKIYDYYSNNLDRK 91
           TG    P   +  +F+++  Y   N DR+
Sbjct: 68 VTGHGTLPPQFQGGLFERVKTY--GNWDRQ 95


>gi|254502253|ref|ZP_05114404.1| hypothetical protein SADFL11_2291 [Labrenzia alexandrii DFL-11]
 gi|222438324|gb|EEE45003.1| hypothetical protein SADFL11_2291 [Labrenzia alexandrii DFL-11]
          Length = 105

 Score =  117 bits (293), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 30/81 (37%), Positives = 50/81 (61%)

Query: 4  NMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFT 63
          + + + +KI++RCW RG +EMDL+LG F +  I EL+  EL  LE ++   D +L+ W T
Sbjct: 15 SRDARRKKILFRCWHRGMKEMDLLLGGFANAKIDELNEDELRELEHLLTAHDQDLYAWMT 74

Query: 64 GMEKPPEYLRTPIFKKIYDYY 84
          G +  P     P++++I  Y+
Sbjct: 75 GRKSLPAEWDGPLYRRIIAYH 95


>gi|182677885|ref|YP_001832031.1| hypothetical protein Bind_0893 [Beijerinckia indica subsp. indica
          ATCC 9039]
 gi|182633768|gb|ACB94542.1| protein of unknown function DUF339 [Beijerinckia indica subsp.
          indica ATCC 9039]
          Length = 98

 Score =  116 bits (292), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 34/83 (40%), Positives = 52/83 (62%)

Query: 5  MNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTG 64
          ++ + R+I +R W RG REMDL+LG FVD  + +LS  EL  LE +++  D +LF W TG
Sbjct: 11 LDTRRRRIQFRAWHRGMREMDLLLGGFVDSELAKLSDAELDDLEHLMDALDRDLFTWLTG 70

Query: 65 MEKPPEYLRTPIFKKIYDYYSNN 87
              P    TP+F KI  +++++
Sbjct: 71 EVALPADYDTPMFHKILAFHTHS 93


>gi|163868354|ref|YP_001609563.1| hypothetical protein Btr_1198 [Bartonella tribocorum CIP 105476]
 gi|161018010|emb|CAK01568.1| conserved hypothetical protein [Bartonella tribocorum CIP 105476]
          Length = 95

 Score =  116 bits (292), Expect = 9e-25,   Method: Composition-based stats.
 Identities = 32/84 (38%), Positives = 51/84 (60%)

Query: 2  KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
          K  ++ + R++++R W RG REMDLI G +VD  I  ++   L+ LE I+  DD +L  W
Sbjct: 8  KNQLDARRRRLIFRAWHRGIREMDLIFGHYVDAHITGMNDKTLSELEYIMSFDDRDLLTW 67

Query: 62 FTGMEKPPEYLRTPIFKKIYDYYS 85
           TG   PP  + +P+F+ I +Y +
Sbjct: 68 ITGEILPPSEIDSPLFRDIANYRT 91


>gi|121602633|ref|YP_989089.1| hypothetical protein BARBAKC583_0797 [Bartonella bacilliformis
          KC583]
 gi|120614810|gb|ABM45411.1| conserved hypothetical protein [Bartonella bacilliformis KC583]
          Length = 97

 Score =  116 bits (292), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 28/82 (34%), Positives = 51/82 (62%)

Query: 2  KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
           + ++++ R++++R W RG REMDL+ G +VD  I ++S   ++ LE I+  +D +L  W
Sbjct: 9  NQQLDIRRRRLIFRAWHRGIREMDLVFGPYVDAHISKMSDKAISELEYIMSFEDRDLLTW 68

Query: 62 FTGMEKPPEYLRTPIFKKIYDY 83
           TG    P  + TP+F+ + +Y
Sbjct: 69 ITGEAITPPKVDTPLFRDVINY 90


>gi|295689523|ref|YP_003593216.1| hypothetical protein Cseg_2134 [Caulobacter segnis ATCC 21756]
 gi|295431426|gb|ADG10598.1| protein of unknown function DUF339 [Caulobacter segnis ATCC 21756]
          Length = 123

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 27/83 (32%), Positives = 43/83 (51%)

Query: 1   MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
           M  + + + R++ +R W RG RE DLILG F D     L+  +   LE+++E+ D  ++ 
Sbjct: 27  MTIDHDSRLRRLRFRAWHRGFREADLILGPFADIHGPNLTPEQFDTLETLLEQSDREIYA 86

Query: 61  WFTGMEKPPEYLRTPIFKKIYDY 83
           W  G E  PE   T +   I  +
Sbjct: 87  WIVGQEPTPERFETDVLAMIRAF 109


>gi|114570036|ref|YP_756716.1| hypothetical protein Mmar10_1486 [Maricaulis maris MCS10]
 gi|114340498|gb|ABI65778.1| protein of unknown function DUF339 [Maricaulis maris MCS10]
          Length = 97

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 27/86 (31%), Positives = 47/86 (54%)

Query: 1  MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
          M  +  +Q +K+  R WRRG +E DLILG F D  +  LS  E+   E +++E+D++++ 
Sbjct: 1  MTDDTEIQRKKLRIRAWRRGFKEADLILGRFADARLDGLSPAEVDDFERLLDENDADIYA 60

Query: 61 WFTGMEKPPEYLRTPIFKKIYDYYSN 86
          W  G E  P+    P+   +  +  +
Sbjct: 61 WIIGKEPTPDQFDGPVMDALKGFRVD 86


>gi|221234858|ref|YP_002517294.1| TPR repeat containing protein [Caulobacter crescentus NA1000]
 gi|220964030|gb|ACL95386.1| TPR repeat containing protein [Caulobacter crescentus NA1000]
          Length = 97

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 26/83 (31%), Positives = 42/83 (50%)

Query: 1  MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
          M  + + + R++ +R W RG RE DLILG F D     L+  +   LE+++E+ D  ++ 
Sbjct: 1  MTIDHDSRLRRLRFRAWHRGFREADLILGPFADTHGPNLTPEQFDTLETLLEQSDREIYA 60

Query: 61 WFTGMEKPPEYLRTPIFKKIYDY 83
          W  G E  P    T +   I  +
Sbjct: 61 WIVGQEPTPAKFETDVMAMIRTF 83


>gi|254469769|ref|ZP_05083174.1| TPR repeat region superfamily protein [Pseudovibrio sp. JE062]
 gi|211961604|gb|EEA96799.1| TPR repeat region superfamily protein [Pseudovibrio sp. JE062]
          Length = 103

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 32/88 (36%), Positives = 54/88 (61%)

Query: 2   KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
              ++ + ++IV+RC  RG +EMD++LG +V+  I +++  EL  LE  ++  D +LF W
Sbjct: 15  NIELDNRRKRIVFRCHHRGMKEMDIMLGGYVEKHIAQMNDEELNELEVFLQHHDQDLFSW 74

Query: 62  FTGMEKPPEYLRTPIFKKIYDYYSNNLD 89
           F G +  P+   T +F+KI DYY +  D
Sbjct: 75  FIGTKPVPDEANTELFRKILDYYKDKSD 102


>gi|17989032|ref|NP_541665.1| putative cytoplasmic protein [Brucella melitensis bv. 1 str. 16M]
 gi|256043475|ref|ZP_05446404.1| putative cytoplasmic protein [Brucella melitensis bv. 1 str.
          Rev.1]
 gi|260564671|ref|ZP_05835156.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
          16M]
 gi|265989893|ref|ZP_06102450.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
          Rev.1]
 gi|17984873|gb|AAL53929.1| hypothetical cytosolic protein [Brucella melitensis bv. 1 str.
          16M]
 gi|260152314|gb|EEW87407.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
          16M]
 gi|263000562|gb|EEZ13252.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
          Rev.1]
          Length = 97

 Score =  115 bits (290), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 32/84 (38%), Positives = 50/84 (59%), Gaps = 2/84 (2%)

Query: 2  KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
           +N++++ RK+++R W RG REMDLILG + D +I+  +  +L   E I+E  D +L KW
Sbjct: 8  TENLDVRRRKLLFRAWHRGMREMDLILGQYADKYIVSFNDDQLNEFEHILEVLDRDLLKW 67

Query: 62 FTGM--EKPPEYLRTPIFKKIYDY 83
           TG      P    TP+F+ I  +
Sbjct: 68 VTGESPSPIPAEYDTPLFRDIVAF 91


>gi|319408598|emb|CBI82253.1| conserved hypothetical protein [Bartonella schoenbuchensis R1]
          Length = 96

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 33/82 (40%), Positives = 52/82 (63%)

Query: 2  KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
          K  +N + R++++R W RG REMDLILG +VD  I+E+S   ++ LE I+  +D +L  W
Sbjct: 8  KNQLNARRRRLIFRAWHRGIREMDLILGQYVDSHIIEMSDETISELEYIMSFEDRDLLMW 67

Query: 62 FTGMEKPPEYLRTPIFKKIYDY 83
           TG    P  + +P+F+ I +Y
Sbjct: 68 ITGEIPTPSEVDSPLFRDIANY 89


>gi|299133933|ref|ZP_07027127.1| protein of unknown function DUF339 [Afipia sp. 1NLS2]
 gi|298591769|gb|EFI51970.1| protein of unknown function DUF339 [Afipia sp. 1NLS2]
          Length = 134

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 25/83 (30%), Positives = 43/83 (51%)

Query: 2   KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
              ++ + +++++RCW RGT+EMD I G F D  I +LS  E+   E +I+  D +L+  
Sbjct: 46  SDGLDDRRKRLLFRCWHRGTKEMDYIFGRFADAHIADLSEEEVADFERLIDLPDPDLYNA 105

Query: 62  FTGMEKPPEYLRTPIFKKIYDYY 84
           F             IF++I  + 
Sbjct: 106 FNDKTPLEPAYAEGIFRRIKAFT 128


>gi|294678198|ref|YP_003578813.1| hypothetical protein [Rhodobacter capsulatus SB 1003]
 gi|294477018|gb|ADE86406.1| TPR repeat domain protein [Rhodobacter capsulatus SB 1003]
          Length = 90

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 28/90 (31%), Positives = 50/90 (55%), Gaps = 1/90 (1%)

Query: 1  MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
          M +    + +++  R WRRG REMDLILG + D  +    + +L + ++++EE+D +L+ 
Sbjct: 1  MSETHEARIKRMKMRSWRRGIREMDLILGPYADAKLEGFDTAQLDLFDTLLEENDQDLYP 60

Query: 61 WFTGMEKPPEYLRTPIFKKIYDYYSNNLDR 90
          WF+G +  P      +F +I  +    L R
Sbjct: 61 WFSGAQPCPPQY-VDLFAEIATFMQGKLAR 89


>gi|110634055|ref|YP_674263.1| hypothetical protein Meso_1703 [Mesorhizobium sp. BNC1]
 gi|110285039|gb|ABG63098.1| protein of unknown function DUF339 [Chelativorans sp. BNC1]
          Length = 120

 Score =  114 bits (287), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 31/81 (38%), Positives = 46/81 (56%)

Query: 2   KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
             N+  + R+I+ R WRRG REMDL+LG F D  I +LS  EL   E++++  D+ L +W
Sbjct: 33  SANLEPRRRRILVRSWRRGMREMDLVLGGFADAHIEQLSDEELAQFEALLDVPDATLLQW 92

Query: 62  FTGMEKPPEYLRTPIFKKIYD 82
            TG         T +F++I  
Sbjct: 93  VTGEMPVTAPHDTALFERIRA 113


>gi|86749968|ref|YP_486464.1| hypothetical protein RPB_2851 [Rhodopseudomonas palustris HaA2]
 gi|86572996|gb|ABD07553.1| Protein of unknown function DUF339 [Rhodopseudomonas palustris
          HaA2]
          Length = 96

 Score =  114 bits (286), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 30/82 (36%), Positives = 47/82 (57%)

Query: 2  KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
             ++ + +++++RCW RGTREMDLILG F D  I  L+  EL  LE +IE +D +L+  
Sbjct: 8  SGGLDDRRKRLLFRCWHRGTREMDLILGQFADAEIGTLTDAELDELERLIELNDHDLYNA 67

Query: 62 FTGMEKPPEYLRTPIFKKIYDY 83
              +  P   +  +F +I  Y
Sbjct: 68 VADADTLPAEFKGGLFDRIKTY 89


>gi|319898901|ref|YP_004158994.1| hypothetical protein BARCL_0735 [Bartonella clarridgeiae 73]
 gi|319402865|emb|CBI76416.1| conserved protein of unknown function [Bartonella clarridgeiae
          73]
          Length = 96

 Score =  114 bits (286), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 30/84 (35%), Positives = 52/84 (61%)

Query: 2  KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
          +  ++ + R++++R W RG REMDLILG +VD  I +++   ++ LE I+  +D +L  W
Sbjct: 8  ENQLDSRRRRLIFRAWHRGIREMDLILGQYVDAHIAKMNDQTVSELEYIMSFEDRDLLTW 67

Query: 62 FTGMEKPPEYLRTPIFKKIYDYYS 85
           TG    P  + +P+F+ I +Y S
Sbjct: 68 ITGEVSVPYKVDSPLFRDIINYRS 91


>gi|91977092|ref|YP_569751.1| hypothetical protein RPD_2621 [Rhodopseudomonas palustris BisB5]
 gi|91683548|gb|ABE39850.1| protein of unknown function DUF339 [Rhodopseudomonas palustris
          BisB5]
          Length = 96

 Score =  114 bits (286), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 31/82 (37%), Positives = 48/82 (58%)

Query: 2  KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
             ++ + +++++RCW RGTREMDLILG F D  I  L   EL  LE +IE +D +L+  
Sbjct: 8  SGGLDDRRKRLLFRCWHRGTREMDLILGQFADAEIGTLEDAELDELERLIELNDHDLYNA 67

Query: 62 FTGMEKPPEYLRTPIFKKIYDY 83
            G +  P   +  +F++I  Y
Sbjct: 68 VAGADTLPAEFQGGLFERIKTY 89


>gi|217978361|ref|YP_002362508.1| protein of unknown function DUF339 [Methylocella silvestris BL2]
 gi|217503737|gb|ACK51146.1| protein of unknown function DUF339 [Methylocella silvestris BL2]
          Length = 98

 Score =  113 bits (285), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 28/85 (32%), Positives = 48/85 (56%)

Query: 2  KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
            +++ + R+I +R W RG  E DL+LG F D  + +LS  EL   ++++E  D ++F W
Sbjct: 8  TISVDARRRRIKFRAWHRGMLETDLLLGRFADAEVEKLSLSELDDFDALLEALDRDVFAW 67

Query: 62 FTGMEKPPEYLRTPIFKKIYDYYSN 86
           TG    P    TP+F++I  ++  
Sbjct: 68 ATGETPTPVEFDTPLFRRIVAFHGG 92


>gi|90424108|ref|YP_532478.1| hypothetical protein RPC_2609 [Rhodopseudomonas palustris BisB18]
 gi|90106122|gb|ABD88159.1| protein of unknown function DUF339 [Rhodopseudomonas palustris
          BisB18]
          Length = 96

 Score =  113 bits (285), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 32/89 (35%), Positives = 53/89 (59%), Gaps = 2/89 (2%)

Query: 2  KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
             ++++ ++++++CW RGTREMDLILG F D  I  L+  E+  LE +IE  D +L+  
Sbjct: 8  SGGLDVRRKRLLFQCWHRGTREMDLILGQFADAEIGSLTDGEVDELERLIELTDHDLYAA 67

Query: 62 FTGMEKPPEYLRTPIFKKIYDYYSNNLDR 90
           TG    P   +  +F+++  Y   N+DR
Sbjct: 68 VTGDAALPAPFQGGLFERVKTY--GNMDR 94


>gi|332186184|ref|ZP_08387930.1| hypothetical protein SUS17_1084 [Sphingomonas sp. S17]
 gi|332013999|gb|EGI56058.1| hypothetical protein SUS17_1084 [Sphingomonas sp. S17]
          Length = 88

 Score =  113 bits (285), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 23/79 (29%), Positives = 42/79 (53%)

Query: 4  NMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFT 63
          +   + +++ +R W RGT+E DL++G F D     LS  EL   E+++EE D ++  W  
Sbjct: 2  DHETRIKRLRFRAWHRGTKEADLMIGGFFDAHHETLSLEELDWFEALLEEQDVDIMAWAI 61

Query: 64 GMEKPPEYLRTPIFKKIYD 82
          G +  P     P+ +++  
Sbjct: 62 GTQPCPPQWDGPVMQRMRA 80


>gi|288958062|ref|YP_003448403.1| hypothetical protein AZL_012210 [Azospirillum sp. B510]
 gi|288910370|dbj|BAI71859.1| hypothetical protein AZL_012210 [Azospirillum sp. B510]
          Length = 107

 Score =  113 bits (284), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 23/81 (28%), Positives = 44/81 (54%)

Query: 3  KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
          +++  + +++ +R W RGTREMDL++GSF D  +       L   E+++E  D +L+ W 
Sbjct: 19 ESLENRRKRLRFRSWHRGTREMDLLMGSFADAHVGGFDHAMLDRFEALLELGDPDLYDWM 78

Query: 63 TGMEKPPEYLRTPIFKKIYDY 83
          +G E  P      + + +  +
Sbjct: 79 SGREPVPAEHDNDVMRLLTAF 99


>gi|92117583|ref|YP_577312.1| hypothetical protein Nham_2054 [Nitrobacter hamburgensis X14]
 gi|91800477|gb|ABE62852.1| protein of unknown function DUF339 [Nitrobacter hamburgensis X14]
          Length = 96

 Score =  112 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 30/85 (35%), Positives = 49/85 (57%)

Query: 2  KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
             ++ + +++++RCW RG RE+DLILG F D  I  L+  EL  LES+IE  D +L+  
Sbjct: 8  SDGLDDRRKRLLFRCWHRGMREVDLILGRFADAEIGSLTDSELIDLESLIEVPDPDLYAA 67

Query: 62 FTGMEKPPEYLRTPIFKKIYDYYSN 86
           +G        RT +F +I  + ++
Sbjct: 68 LSGGAPLAPEYRTALFNRIKSFRTS 92


>gi|329850696|ref|ZP_08265541.1| hypothetical protein ABI_36070 [Asticcacaulis biprosthecum C19]
 gi|328841011|gb|EGF90582.1| hypothetical protein ABI_36070 [Asticcacaulis biprosthecum C19]
          Length = 107

 Score =  112 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 25/84 (29%), Positives = 44/84 (52%)

Query: 2  KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
           +    + +K+ +R WRRG +E D+ILG F D  +  +S  +L + E ++E  D +L+ W
Sbjct: 16 SEAREARLKKLSFRAWRRGFKEADIILGHFADEHLGRMSDADLDIFEVLLEVPDHDLYGW 75

Query: 62 FTGMEKPPEYLRTPIFKKIYDYYS 85
              E  P    + I K++  +Y 
Sbjct: 76 IIEREPAPADFDSEIMKQLNQFYK 99


>gi|75675706|ref|YP_318127.1| hypothetical protein Nwi_1514 [Nitrobacter winogradskyi Nb-255]
 gi|74420576|gb|ABA04775.1| Protein of unknown function DUF339 [Nitrobacter winogradskyi
           Nb-255]
          Length = 122

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 32/86 (37%), Positives = 48/86 (55%)

Query: 2   KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
            + M+ + ++++YRCW RG REMDLILG FVD  I  L+  EL  LE++IE  D +L+  
Sbjct: 35  SEGMDDRRKRLLYRCWHRGMREMDLILGRFVDEEIGSLTEAELKDLENLIEVPDPDLYAA 94

Query: 62  FTGMEKPPEYLRTPIFKKIYDYYSNN 87
            +         RT +F +I  +    
Sbjct: 95  LSDGAPLASEYRTALFDRIKSFRRGQ 120


>gi|319783817|ref|YP_004143293.1| hypothetical protein Mesci_4131 [Mesorhizobium ciceri biovar
          biserrulae WSM1271]
 gi|317169705|gb|ADV13243.1| protein of unknown function DUF339 [Mesorhizobium ciceri biovar
          biserrulae WSM1271]
          Length = 95

 Score =  111 bits (278), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 26/85 (30%), Positives = 47/85 (55%)

Query: 2  KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
           + ++++ RK+++R W RG REMDLILG+F D  I  L++ E+   E +++  D+     
Sbjct: 8  SEGLDVRRRKLLFRSWHRGMREMDLILGTFADAEIGVLTNEEIDQYERLLDIPDTEFLPM 67

Query: 62 FTGMEKPPEYLRTPIFKKIYDYYSN 86
           TG    P  +   + +KI  +  +
Sbjct: 68 VTGERPVPADIDCAVLRKILAFRRS 92


>gi|298291680|ref|YP_003693619.1| hypothetical protein Snov_1695 [Starkeya novella DSM 506]
 gi|296928191|gb|ADH89000.1| protein of unknown function DUF339 [Starkeya novella DSM 506]
          Length = 98

 Score =  110 bits (277), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 32/88 (36%), Positives = 49/88 (55%), Gaps = 1/88 (1%)

Query: 2  KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
             ++ + R+I+YR W RGTREMDL++G F D  I ++S  ++   E +IE +D +LF W
Sbjct: 8  SAGLDARRRRILYRSWHRGTREMDLLMGRFADKLIADMSDEDVADFEQLIEVEDPDLFGW 67

Query: 62 FTGMEKPPEYLRTPIFKKIYDYYSNNLD 89
                 PEY  TPIF +   +  +   
Sbjct: 68 LASGIPAPEY-DTPIFHRFRQFQMSGEG 94


>gi|159043316|ref|YP_001532110.1| hypothetical protein Dshi_0764 [Dinoroseobacter shibae DFL 12]
 gi|157911076|gb|ABV92509.1| protein of unknown function DUF339 [Dinoroseobacter shibae DFL
          12]
          Length = 99

 Score =  110 bits (277), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 24/77 (31%), Positives = 45/77 (58%)

Query: 2  KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
           +    + +++  R WRRG +EMDLILG + D  +  +S  EL   +++++E+D +L++W
Sbjct: 17 NETPEARIKRMKIRAWRRGIKEMDLILGPYADTHLAGMSEAELDAFDALLKENDQDLYQW 76

Query: 62 FTGMEKPPEYLRTPIFK 78
           +G   PPE     + +
Sbjct: 77 VSGQAAPPERFAALVTR 93


>gi|319407248|emb|CBI80887.1| conserved hypothetical protein [Bartonella sp. 1-1C]
          Length = 96

 Score =  110 bits (277), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 28/84 (33%), Positives = 50/84 (59%)

Query: 2  KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
          +  ++ + R++++R W RG RE+DLILG +VD  I ++S   ++ LE I+  +D +L  W
Sbjct: 8  ENRLDSRRRRLIFRAWHRGIREIDLILGQYVDAHIAKMSDQTVSELEYIMSFEDRDLLGW 67

Query: 62 FTGMEKPPEYLRTPIFKKIYDYYS 85
           T     P  + + +F+ I +Y S
Sbjct: 68 ITREVSIPAEVDSALFRDIINYCS 91


>gi|304321709|ref|YP_003855352.1| hypothetical protein PB2503_10794 [Parvularcula bermudensis
          HTCC2503]
 gi|303300611|gb|ADM10210.1| hypothetical protein PB2503_10794 [Parvularcula bermudensis
          HTCC2503]
          Length = 96

 Score =  110 bits (276), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 22/83 (26%), Positives = 44/83 (53%)

Query: 1  MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
          M++ M  + R+++YR   RG +E DL++G+F    +  ++  EL   + ++E  D  L+ 
Sbjct: 1  MEEIMPPERRRLLYRAQHRGFKEADLVIGTFAKQQLAAMTEAELEEFQRLLEVPDQELYA 60

Query: 61 WFTGMEKPPEYLRTPIFKKIYDY 83
          W  G E  P     P+ +++  +
Sbjct: 61 WIIGRETVPTNYEGPVMRQLQAF 83


>gi|319404240|emb|CBI77833.1| conserved hypothetical protein [Bartonella rochalimae ATCC
          BAA-1498]
          Length = 96

 Score =  110 bits (276), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 28/84 (33%), Positives = 50/84 (59%)

Query: 2  KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
          +  ++ + R++++R W RG RE+DLILG +VD  I ++S   ++ LE I+  +D +L  W
Sbjct: 8  ENRLDSRRRRLIFRAWHRGIREVDLILGQYVDAHIAKMSDQTVSELEYIMSFEDRDLLGW 67

Query: 62 FTGMEKPPEYLRTPIFKKIYDYYS 85
           T     P  + + +F+ I +Y S
Sbjct: 68 ITREVSIPPKVDSALFRDIINYCS 91


>gi|154253520|ref|YP_001414344.1| hypothetical protein Plav_3080 [Parvibaculum lavamentivorans
          DS-1]
 gi|154157470|gb|ABS64687.1| protein of unknown function DUF339 [Parvibaculum lavamentivorans
          DS-1]
          Length = 101

 Score =  110 bits (276), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 28/80 (35%), Positives = 45/80 (56%)

Query: 4  NMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFT 63
            +++ R++ +R W RG +EMDLILG F D  +  L+  EL   E++IE +D+ L+ W T
Sbjct: 12 GRDVRLRRLKFRSWHRGIKEMDLILGHFADSALESLTDSELDQYEALIEVEDTVLYNWVT 71

Query: 64 GMEKPPEYLRTPIFKKIYDY 83
          G E       T +  +I  +
Sbjct: 72 GRENVAPEHDTGLLTRIRTF 91


>gi|298712750|emb|CBJ33347.1| conserved unknown protein [Ectocarpus siliculosus]
          Length = 209

 Score =  110 bits (275), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 22/81 (27%), Positives = 48/81 (59%)

Query: 7   LQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGME 66
           ++ +++VYR  +RG  E+DL+LG++ +  +  LS+ ++   E I+  +  ++F + TG  
Sbjct: 110 VRRKRLVYRSKQRGWLEVDLLLGTWAERNVAGLSAADMDSYEDILNLETVDIFNFITGNA 169

Query: 67  KPPEYLRTPIFKKIYDYYSNN 87
            PP ++  P+  ++  Y  +N
Sbjct: 170 DPPAFVDAPMLARLQAYVKSN 190


>gi|260426903|ref|ZP_05780882.1| TPR repeat protein [Citreicella sp. SE45]
 gi|260421395|gb|EEX14646.1| TPR repeat protein [Citreicella sp. SE45]
          Length = 86

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 27/86 (31%), Positives = 48/86 (55%), Gaps = 1/86 (1%)

Query: 1  MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
          M +    + +++  R  RRG +EMD+IL  +VD  +  +S+ EL   E+++EE+D +L++
Sbjct: 1  MTETPENRLKRLTMRSMRRGIKEMDIILMRYVDVRLAGMSAAELDAYEALLEENDQDLYQ 60

Query: 61 WFTGMEKPPEYLRTPIFKKIYDYYSN 86
          W +G    P  L+ P+   I     N
Sbjct: 61 WVSGQRPAPASLQ-PLIADITAVACN 85


>gi|317106611|dbj|BAJ53118.1| JHL07K02.8 [Jatropha curcas]
          Length = 188

 Score =  108 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 50/81 (61%), Gaps = 1/81 (1%)

Query: 11  KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
           +++YR  +RG  E+DL+LG +V+  I  +    +  L  +++ ++ +L+KW T  E+PPE
Sbjct: 75  RLLYRSKQRGFLELDLVLGKWVEEHISSMDENGIKALVHLLDLENPDLWKWLTCQEQPPE 134

Query: 71  YLRT-PIFKKIYDYYSNNLDR 90
            + T P+F  + D   NNL+R
Sbjct: 135 AVSTNPVFSAVRDKVMNNLNR 155


>gi|325193361|emb|CCA27700.1| conserved hypothetical protein [Albugo laibachii Nc14]
          Length = 186

 Score =  107 bits (269), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 24/90 (26%), Positives = 50/90 (55%), Gaps = 1/90 (1%)

Query: 7   LQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGME 66
            + ++++YR  +RG  E+DL+LGS+    +  L   EL   E+I+ ++  +++ + T   
Sbjct: 87  ARKKRLLYRSRQRGWLEVDLLLGSWTQKSVEGLQEAELDHFEAILNQETIDIYNYITKQR 146

Query: 67  KPPEYLRTPIFKKIYDYYSNN-LDRKNMLG 95
             P  L T +  ++ +Y +N+ L + +M G
Sbjct: 147 PIPSELDTNVMHRLQEYCANSPLGKASMDG 176


>gi|195608742|gb|ACG26201.1| TPR repeat region family protein [Zea mays]
 gi|224033271|gb|ACN35711.1| unknown [Zea mays]
          Length = 180

 Score =  107 bits (269), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 27/89 (30%), Positives = 51/89 (57%), Gaps = 4/89 (4%)

Query: 6   NLQCR---KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
             + R   ++VYR  +RG  E+DL+LG++V+  +  +    +  L  +++ ++ +L+KW 
Sbjct: 59  ESRRRLLNRLVYRSKQRGFLELDLVLGTWVEQHVHAMDEANIRALLQVLDLENPDLWKWL 118

Query: 63  TGMEKPPEYLR-TPIFKKIYDYYSNNLDR 90
           T  E+PPE L   P+F  I    ++NL +
Sbjct: 119 TSQEQPPEDLNSNPVFAAIKSKVTDNLTK 147


>gi|326525791|dbj|BAJ88942.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 174

 Score =  107 bits (269), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 27/92 (29%), Positives = 53/92 (57%), Gaps = 5/92 (5%)

Query: 6   NLQCRKI----VYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
           +   R++    +YR  +RG  E+DL+LG++V+  +  +    +  L  I++ ++ +L+KW
Sbjct: 53  DESRRRLVNSLMYRSKQRGFLELDLVLGTWVEQHVRSMDEANIRSLLQILDLENPDLWKW 112

Query: 62  FTGMEKPPEYLR-TPIFKKIYDYYSNNLDRKN 92
            TG E+PPE +   P+F  I    ++NL + +
Sbjct: 113 LTGQEQPPETVNSNPVFAAIKSKVTDNLSKHS 144


>gi|296535471|ref|ZP_06897660.1| TPR repeat region superfamily protein [Roseomonas cervicalis ATCC
          49957]
 gi|296264192|gb|EFH10628.1| TPR repeat region superfamily protein [Roseomonas cervicalis ATCC
          49957]
          Length = 112

 Score =  107 bits (268), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 27/84 (32%), Positives = 47/84 (55%)

Query: 4  NMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFT 63
          +++ + R++V+R   RGT+E DL++G FV   I   S  EL  LE ++E  D +L  W +
Sbjct: 14 DLSPRRRRLVFRATHRGTKETDLMVGGFVTRNIAAFSEAELDELEGVLELLDVDLADWLS 73

Query: 64 GMEKPPEYLRTPIFKKIYDYYSNN 87
          G    P  + TP+  ++ +  S +
Sbjct: 74 GRRPIPPEVMTPMLARMAEECSRS 97


>gi|242068643|ref|XP_002449598.1| hypothetical protein SORBIDRAFT_05g019780 [Sorghum bicolor]
 gi|241935441|gb|EES08586.1| hypothetical protein SORBIDRAFT_05g019780 [Sorghum bicolor]
          Length = 179

 Score =  107 bits (267), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 27/89 (30%), Positives = 51/89 (57%), Gaps = 4/89 (4%)

Query: 6   NLQCR---KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
             + R   ++VYR  +RG  E+DL+LG++V+  +  +    +  L  +++ ++ +L+KW 
Sbjct: 58  ESRRRLLNRLVYRSKQRGFLELDLVLGTWVEQHVHGMDEANIRALLQVLDLENPDLWKWL 117

Query: 63  TGMEKPPEYLR-TPIFKKIYDYYSNNLDR 90
           T  E+PPE L   P+F  I    ++NL +
Sbjct: 118 TSQEQPPEDLNSNPVFAAIKSKVTDNLTK 146


>gi|326495936|dbj|BAJ90590.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 175

 Score =  107 bits (267), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 27/92 (29%), Positives = 53/92 (57%), Gaps = 5/92 (5%)

Query: 6   NLQCRKI----VYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
           +   R++    +YR  +RG  E+DL+LG++V+  +  +    +  L  I++ ++ +L+KW
Sbjct: 54  DESRRRLVNSLMYRSKQRGFLELDLVLGTWVEQHVRSMDEANIRSLLQILDLENPDLWKW 113

Query: 62  FTGMEKPPEYLR-TPIFKKIYDYYSNNLDRKN 92
            TG E+PPE +   P+F  I    ++NL + +
Sbjct: 114 LTGQEQPPETVNSNPVFAAIKSKVTDNLSKHS 145


>gi|56417131|ref|YP_154205.1| hypothetical protein AM1093 [Anaplasma marginale str. St. Maries]
 gi|222475496|ref|YP_002563913.1| hypothetical protein AMF_826 [Anaplasma marginale str. Florida]
 gi|56388363|gb|AAV86950.1| hypothetical protein AM1093 [Anaplasma marginale str. St. Maries]
 gi|222419634|gb|ACM49657.1| Conserved hypothetical protein [Anaplasma marginale str. Florida]
          Length = 110

 Score =  106 bits (266), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 23/84 (27%), Positives = 41/84 (48%)

Query: 4   NMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFT 63
            +  + R+++YR   RG +E D++LG+F   ++  L   EL   E I+E DD  L+ +  
Sbjct: 27  GLEGRKRRLLYRSTHRGCKETDILLGAFAQRYLALLDEEELVQYEKIVELDDELLYSYIV 86

Query: 64  GMEKPPEYLRTPIFKKIYDYYSNN 87
           G    P+ +   +  +I    S  
Sbjct: 87  GRRPVPDSIDKALVSRISACASGK 110


>gi|83951510|ref|ZP_00960242.1| TPR repeat family protein [Roseovarius nubinhibens ISM]
 gi|83836516|gb|EAP75813.1| TPR repeat family protein [Roseovarius nubinhibens ISM]
          Length = 88

 Score =  106 bits (266), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 21/82 (25%), Positives = 43/82 (52%), Gaps = 1/82 (1%)

Query: 1  MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
          M +  +++ +++  R  RRG +EMD++L  F +  +  +    L + + ++EE+D +L+ 
Sbjct: 1  MSEPRDIRLKRLTMRSMRRGIKEMDILLTRFAEAELASMPQEGLDLYDRLLEENDQDLYA 60

Query: 61 WFTGMEKPPEYLRTPIFKKIYD 82
          W TG    PE     +  +I  
Sbjct: 61 WVTGQTPAPEPFAG-LIAQIAA 81


>gi|77464337|ref|YP_353841.1| hypothetical protein RSP_0761 [Rhodobacter sphaeroides 2.4.1]
 gi|77388755|gb|ABA79940.1| conserved hypothetical protein [Rhodobacter sphaeroides 2.4.1]
          Length = 89

 Score =  106 bits (266), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 30/90 (33%), Positives = 51/90 (56%), Gaps = 1/90 (1%)

Query: 1  MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
          M +  + + +++  R WRRGT+EMDLILG + D  +  LS   L + +S++ E+D +L  
Sbjct: 1  MIEAEDARLKRMSMRSWRRGTKEMDLILGPWSDAHLAGLSEERLALYDSLLNENDQDLLP 60

Query: 61 WFTGMEKPPEYLRTPIFKKIYDYYSNNLDR 90
          W  G  +PP +L   +  +I  +  + L R
Sbjct: 61 WVLGQREPPAHL-AALIAEIGAFARSRLAR 89


>gi|114763960|ref|ZP_01443201.1| TPR repeat family protein [Pelagibaca bermudensis HTCC2601]
 gi|114543552|gb|EAU46566.1| TPR repeat family protein [Roseovarius sp. HTCC2601]
          Length = 86

 Score =  106 bits (266), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 26/86 (30%), Positives = 47/86 (54%), Gaps = 1/86 (1%)

Query: 1  MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
          M +    + +++  R  RRG +EMD+IL  + D  +  + + +L   E+++EE+D +L++
Sbjct: 1  MTETPENRLKRLTMRSMRRGIKEMDIILMRYADARLAAMDAAQLDAYEALLEENDQDLYQ 60

Query: 61 WFTGMEKPPEYLRTPIFKKIYDYYSN 86
          W +G    PE LR P+   I     N
Sbjct: 61 WVSGQRPAPEALR-PLITDISQVACN 85


>gi|328874720|gb|EGG23085.1| DUF339 family protein [Dictyostelium fasciculatum]
          Length = 145

 Score =  106 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 21/82 (25%), Positives = 41/82 (50%)

Query: 6   NLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGM 65
            +  +K++Y+   RG  E DL+LG+F    +   +  +L   + II++ D +++ W    
Sbjct: 56  EILRKKLLYQSKERGMLENDLLLGTFATKHLHSFTDAQLKKYDIIIQQPDPDIYNWVLSK 115

Query: 66  EKPPEYLRTPIFKKIYDYYSNN 87
           +  PE L   + K +  +  NN
Sbjct: 116 DIVPEELDNDVMKLLQHHCQNN 137


>gi|255540023|ref|XP_002511076.1| conserved hypothetical protein [Ricinus communis]
 gi|223550191|gb|EEF51678.1| conserved hypothetical protein [Ricinus communis]
          Length = 188

 Score =  106 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 28/92 (30%), Positives = 53/92 (57%), Gaps = 3/92 (3%)

Query: 1   MKKNMNLQC--RKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNL 58
           +  + + +    +++YR  +RG  E+DL+LG +V+  I  +    +  L  +++ ++ +L
Sbjct: 63  LSNDESKRRLFNRLLYRSRQRGFLELDLVLGKWVEGHIHSMDENGIKALVHVLDLENPDL 122

Query: 59  FKWFTGMEKPPEYLR-TPIFKKIYDYYSNNLD 89
           +KW TG E+PPE +   P+F  + D   NNLD
Sbjct: 123 WKWLTGQEQPPEAVNINPVFSAVRDKIMNNLD 154


>gi|114768936|ref|ZP_01446562.1| TPR repeat family protein [alpha proteobacterium HTCC2255]
 gi|114549853|gb|EAU52734.1| TPR repeat family protein [alpha proteobacterium HTCC2255]
          Length = 86

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 29/85 (34%), Positives = 51/85 (60%), Gaps = 1/85 (1%)

Query: 3  KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
          ++ + + +++  R W RG +EMDLILG F D+ + +LS  EL   E ++ E+D +L+ W 
Sbjct: 2  EDHSTRLKRLRMRSWHRGIKEMDLILGGFADNEMSKLSIEELNEHELMMSENDHDLYNWV 61

Query: 63 TGMEKPPEYLRTPIFKKIYDYYSNN 87
          +G  + P  L + I  +I +Y+  N
Sbjct: 62 SGKSEIPPELLSAI-NRITNYFLKN 85


>gi|269958467|ref|YP_003328254.1| hypothetical protein ACIS_00270 [Anaplasma centrale str. Israel]
 gi|269848296|gb|ACZ48940.1| hypothetical protein ACIS_00270 [Anaplasma centrale str. Israel]
          Length = 110

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 23/86 (26%), Positives = 43/86 (50%)

Query: 2   KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
           +  +  + R+++YR   RG +E D++LG+F   ++  L   EL   E I+E DD  L+ +
Sbjct: 25  EFGLEGRKRRLLYRSTHRGCKETDILLGAFAREYLALLDEEELAQYEKIVELDDELLYSY 84

Query: 62  FTGMEKPPEYLRTPIFKKIYDYYSNN 87
             G  + P  +   +  +I +  S  
Sbjct: 85  IVGRREVPSSIDKALVSRIANCVSGK 110


>gi|85717290|ref|ZP_01048244.1| hypothetical protein NB311A_19335 [Nitrobacter sp. Nb-311A]
 gi|85695879|gb|EAQ33783.1| hypothetical protein NB311A_19335 [Nitrobacter sp. Nb-311A]
          Length = 95

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 32/86 (37%), Positives = 47/86 (54%)

Query: 2  KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
           + ++ + ++++YRCW RG REMDLILG FVD  I  L+  EL  LES+IE  D +L+  
Sbjct: 8  SQGLDDRRKRLLYRCWHRGMREMDLILGRFVDEEIGSLTDGELNDLESLIEVPDPDLYAA 67

Query: 62 FTGMEKPPEYLRTPIFKKIYDYYSNN 87
                     RT +F +I  +    
Sbjct: 68 LNDGAPLASEYRTALFDRIKSFRPER 93


>gi|89055143|ref|YP_510594.1| hypothetical protein Jann_2652 [Jannaschia sp. CCS1]
 gi|88864692|gb|ABD55569.1| protein of unknown function DUF339 [Jannaschia sp. CCS1]
          Length = 91

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 25/90 (27%), Positives = 48/90 (53%), Gaps = 1/90 (1%)

Query: 1  MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
          M +   ++ +++  R W RG +EMDLILG + D  + + +  +L   E+++ E D +L++
Sbjct: 1  MSEPREIRLKRLRLRAWHRGIKEMDLILGGWADRNLSDATDADLDAFEAVMAEADHDLYQ 60

Query: 61 WFTGMEKPPEYLRTPIFKKIYDYYSNNLDR 90
          W +G  + P  L + +  +I       L R
Sbjct: 61 WISGQAEAPSEL-SAMVDRIGADMRPTLGR 89


>gi|260463948|ref|ZP_05812144.1| protein of unknown function DUF339 [Mesorhizobium opportunistum
          WSM2075]
 gi|259030323|gb|EEW31603.1| protein of unknown function DUF339 [Mesorhizobium opportunistum
          WSM2075]
          Length = 95

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 26/81 (32%), Positives = 44/81 (54%)

Query: 2  KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
           + +++  RK+++R W RG REMDLILG+F D  I  L++ E+   E +++  D+     
Sbjct: 8  SEGLDVHRRKLLFRSWHRGLREMDLILGTFADAEIGALTAEEIDQYERLLDIPDTEFLPL 67

Query: 62 FTGMEKPPEYLRTPIFKKIYD 82
           TG    P  +   + +KI  
Sbjct: 68 ITGERPVPADIDCAVLQKILA 88


>gi|126463180|ref|YP_001044294.1| hypothetical protein Rsph17029_2420 [Rhodobacter sphaeroides ATCC
          17029]
 gi|332559229|ref|ZP_08413551.1| hypothetical protein RSWS8N_09240 [Rhodobacter sphaeroides WS8N]
 gi|126104844|gb|ABN77522.1| protein of unknown function DUF339 [Rhodobacter sphaeroides ATCC
          17029]
 gi|332276941|gb|EGJ22256.1| hypothetical protein RSWS8N_09240 [Rhodobacter sphaeroides WS8N]
          Length = 89

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 30/90 (33%), Positives = 50/90 (55%), Gaps = 1/90 (1%)

Query: 1  MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
          M +  + + +++  R WRRGT+EMDLILG + D  +  LS   L + +S++ E+D +L  
Sbjct: 1  MIEAEDARLKRMSMRSWRRGTKEMDLILGPWSDAHLAGLSEERLALYDSLLNENDQDLLP 60

Query: 61 WFTGMEKPPEYLRTPIFKKIYDYYSNNLDR 90
          W  G  +PP +L   +  +I  +    L R
Sbjct: 61 WVLGQREPPAHL-AALIAEIGAFARTRLAR 89


>gi|225447729|ref|XP_002277790.1| PREDICTED: hypothetical protein [Vitis vinifera]
          Length = 187

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 28/91 (30%), Positives = 52/91 (57%), Gaps = 4/91 (4%)

Query: 3   KNMNLQCR---KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLF 59
            N   + R   +++YR  +RG  E+DL+LG +V+  I  +    +  L  +++ ++ +L+
Sbjct: 63  SNEESKRRLFNRLLYRSKQRGFLELDLVLGKWVEEHIHSMDHNGIKSLVHVLDLENPDLW 122

Query: 60  KWFTGMEKPPEYLR-TPIFKKIYDYYSNNLD 89
           KW TG E+PPE +   P+F  + +   NNL+
Sbjct: 123 KWLTGQEQPPEAVSINPVFCAVREKVMNNLN 153


>gi|296088155|emb|CBI35625.3| unnamed protein product [Vitis vinifera]
          Length = 174

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 28/91 (30%), Positives = 52/91 (57%), Gaps = 4/91 (4%)

Query: 3   KNMNLQCR---KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLF 59
            N   + R   +++YR  +RG  E+DL+LG +V+  I  +    +  L  +++ ++ +L+
Sbjct: 50  SNEESKRRLFNRLLYRSKQRGFLELDLVLGKWVEEHIHSMDHNGIKSLVHVLDLENPDLW 109

Query: 60  KWFTGMEKPPEYLR-TPIFKKIYDYYSNNLD 89
           KW TG E+PPE +   P+F  + +   NNL+
Sbjct: 110 KWLTGQEQPPEAVSINPVFCAVREKVMNNLN 140


>gi|83858281|ref|ZP_00951803.1| hypothetical protein OA2633_02241 [Oceanicaulis alexandrii
          HTCC2633]
 gi|83853104|gb|EAP90956.1| hypothetical protein OA2633_02241 [Oceanicaulis alexandrii
          HTCC2633]
          Length = 107

 Score =  105 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 21/76 (27%), Positives = 41/76 (53%)

Query: 8  QCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEK 67
          + +++ +R WRRG +E DLI+G F D  +  LS+ E+   E +++  D+ ++ W  G  +
Sbjct: 18 RLKRLTFRAWRRGFKEADLIMGRFADTKLYSLSAEEVDEFERLLDAPDTEVYGWICGTIE 77

Query: 68 PPEYLRTPIFKKIYDY 83
           P     P+   +  +
Sbjct: 78 TPPNYEGPVLDALKAF 93


>gi|115485717|ref|NP_001068002.1| Os11g0528300 [Oryza sativa Japonica Group]
 gi|77551232|gb|ABA94029.1| TPR repeat region family protein, expressed [Oryza sativa Japonica
           Group]
 gi|113645224|dbj|BAF28365.1| Os11g0528300 [Oryza sativa Japonica Group]
 gi|125577345|gb|EAZ18567.1| hypothetical protein OsJ_34096 [Oryza sativa Japonica Group]
          Length = 186

 Score =  105 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 26/91 (28%), Positives = 52/91 (57%), Gaps = 4/91 (4%)

Query: 6   NLQCR---KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
             + R   ++VYR  +RG  E+DL+LG++V+  I  +    +  L  +++ ++ +L+KW 
Sbjct: 66  ESRRRLINRLVYRSKQRGFLELDLVLGTWVEQHIHSMDEANIRALLQVLDLENPDLWKWL 125

Query: 63  TGMEKPPEYLR-TPIFKKIYDYYSNNLDRKN 92
           T  E+PPE +   P+F  +    ++NL + +
Sbjct: 126 TSQEQPPEAVNSNPVFIAVKSKVTDNLSKHS 156


>gi|209964569|ref|YP_002297484.1| TPR domain protein [Rhodospirillum centenum SW]
 gi|209958035|gb|ACI98671.1| TPR domain protein [Rhodospirillum centenum SW]
          Length = 105

 Score =  105 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 17/80 (21%), Positives = 42/80 (52%)

Query: 4  NMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFT 63
              + +++ +R   RGT+E+D++ G+F +  +  +++ EL   E +++  D  ++ W +
Sbjct: 20 TREARVKRLKFRSGHRGTKELDILFGAFAERHLDGMAAAELDAFERLLDLPDLEVYDWIS 79

Query: 64 GMEKPPEYLRTPIFKKIYDY 83
          G  +PP      +  +I  +
Sbjct: 80 GAAEPPAGPVGALVARIRAF 99


>gi|254461912|ref|ZP_05075328.1| TPR repeat family protein [Rhodobacterales bacterium HTCC2083]
 gi|206678501|gb|EDZ42988.1| TPR repeat family protein [Rhodobacteraceae bacterium HTCC2083]
          Length = 86

 Score =  105 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 24/82 (29%), Positives = 49/82 (59%), Gaps = 1/82 (1%)

Query: 1  MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
          M +  + + +++  R  RRG +EMD+IL ++ D+ + ++S  ++T+ ++++ E+D +L+ 
Sbjct: 2  MPETSDTRIKRLKMRSMRRGIKEMDIILSAYADNSLAQMSESDITLYDTLLNENDQDLYS 61

Query: 61 WFTGMEKPPEYLRTPIFKKIYD 82
          W TG   PPE   T +   I  
Sbjct: 62 WVTGQTVPPEKF-TDMLADIAQ 82


>gi|260575729|ref|ZP_05843726.1| protein of unknown function DUF339 [Rhodobacter sp. SW2]
 gi|259022127|gb|EEW25426.1| protein of unknown function DUF339 [Rhodobacter sp. SW2]
          Length = 90

 Score =  105 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 28/86 (32%), Positives = 45/86 (52%), Gaps = 1/86 (1%)

Query: 3  KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
          +    + +++  R WRRGT+EMDLILG + D  +  L +  L + E ++ E+D +L  W 
Sbjct: 2  ETAESRLKRLGMRSWRRGTKEMDLILGPWSDAHLAGLDAPTLALFEVLLAENDQDLLPWV 61

Query: 63 TGMEKPPEYLRTPIFKKIYDYYSNNL 88
           G   PP  L   +  +I  +  N L
Sbjct: 62 LGHVPPPPAL-ADLIAEIGQFARNRL 86


>gi|157828770|ref|YP_001495012.1| hypothetical protein A1G_05045 [Rickettsia rickettsii str.
          'Sheila Smith']
 gi|165933498|ref|YP_001650287.1| hypothetical protein RrIowa_1086 [Rickettsia rickettsii str.
          Iowa]
 gi|238650717|ref|YP_002916570.1| hypothetical protein RPR_04120 [Rickettsia peacockii str. Rustic]
 gi|13235396|emb|CAC33673.1| hypothetical protein [Rickettsia rickettsii]
 gi|157801251|gb|ABV76504.1| hypothetical protein A1G_05045 [Rickettsia rickettsii str.
          'Sheila Smith']
 gi|165908585|gb|ABY72881.1| hypothetical protein RrIowa_1086 [Rickettsia rickettsii str.
          Iowa]
 gi|238624815|gb|ACR47521.1| hypothetical protein RPR_04120 [Rickettsia peacockii str. Rustic]
          Length = 87

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 28/80 (35%), Positives = 44/80 (55%)

Query: 2  KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
          K N N   +K+VYR   RG REMD ILGSF + ++  +   +L     I++++D++L+ W
Sbjct: 3  KLNKNSLQKKLVYRSKNRGCREMDYILGSFAEKYLSLMDEKKLGSYSLILDQNDNDLYNW 62

Query: 62 FTGMEKPPEYLRTPIFKKIY 81
                 P YL   I  K++
Sbjct: 63 INNKSSAPSYLDAEIIDKLH 82


>gi|163793171|ref|ZP_02187147.1| hypothetical protein BAL199_25319 [alpha proteobacterium BAL199]
 gi|159181817|gb|EDP66329.1| hypothetical protein BAL199_25319 [alpha proteobacterium BAL199]
          Length = 88

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 25/83 (30%), Positives = 42/83 (50%)

Query: 1  MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
          M    + + +++ YR    GT+E D++LG F    + +L   +L   E ++E DD  L+K
Sbjct: 1  MTDVRDARRKRLYYRSTYTGTKETDVLLGGFAARHLTDLDDQQLADYEKLLEIDDPRLYK 60

Query: 61 WFTGMEKPPEYLRTPIFKKIYDY 83
          W T  E PP    T + + I  +
Sbjct: 61 WATSQETPPPEYDTSVLRLIQAF 83


>gi|57239551|ref|YP_180687.1| hypothetical protein Erum8240 [Ehrlichia ruminantium str.
          Welgevonden]
 gi|58579537|ref|YP_197749.1| hypothetical protein ERWE_CDS_08730 [Ehrlichia ruminantium str.
          Welgevonden]
 gi|58617591|ref|YP_196790.1| hypothetical protein ERGA_CDS_08640 [Ehrlichia ruminantium str.
          Gardel]
 gi|57161630|emb|CAH58559.1| conserved hypothetical protein [Ehrlichia ruminantium str.
          Welgevonden]
 gi|58417203|emb|CAI28316.1| Conserved hypothetical protein [Ehrlichia ruminantium str.
          Gardel]
 gi|58418163|emb|CAI27367.1| Conserved hypothetical protein [Ehrlichia ruminantium str.
          Welgevonden]
          Length = 93

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 32/76 (42%), Positives = 47/76 (61%)

Query: 8  QCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEK 67
          + ++++YR   RG +EMD+ILG+F  H I  LS  ++   E II  +D  L+K+ TG E 
Sbjct: 7  KRKRLLYRSLHRGCKEMDIILGNFALHHIYLLSIEDVDEYEKIINTNDYQLYKYITGEEL 66

Query: 68 PPEYLRTPIFKKIYDY 83
           PEYL + I K I D+
Sbjct: 67 VPEYLSSNIIKNIVDF 82


>gi|67458758|ref|YP_246382.1| hypothetical protein RF_0366 [Rickettsia felis URRWXCal2]
 gi|67004291|gb|AAY61217.1| unknown [Rickettsia felis URRWXCal2]
          Length = 87

 Score =  105 bits (262), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 26/80 (32%), Positives = 42/80 (52%)

Query: 2  KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
          K N N   +K+ YR   RG +EMD ILGSF + ++  +   +L     I++++D++L+ W
Sbjct: 3  KLNKNSLQKKLFYRSKNRGCKEMDYILGSFAEKYLSLMDEKKLGSYSLILDQNDNDLYNW 62

Query: 62 FTGMEKPPEYLRTPIFKKIY 81
                 P YL   I  K+ 
Sbjct: 63 INNKSSAPSYLDAEIIDKLR 82


>gi|195607848|gb|ACG25754.1| TPR repeat region family protein [Zea mays]
          Length = 175

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 27/89 (30%), Positives = 51/89 (57%), Gaps = 4/89 (4%)

Query: 6   NLQCR---KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
             + R   ++VYR  +RG  E+DL+LG++V+  +  +    +  L  +++ ++ +L+KW 
Sbjct: 54  ESRRRLLNRLVYRSKQRGFLELDLVLGTWVEQHVHAMDEPNIRALLQVLDLENPDLWKWL 113

Query: 63  TGMEKPPEYLR-TPIFKKIYDYYSNNLDR 90
           T  E+PPE L   P+F  I    ++NL +
Sbjct: 114 TSQEQPPEDLNSNPVFSAIKSKVTDNLIK 142


>gi|221640223|ref|YP_002526485.1| hypothetical protein RSKD131_2124 [Rhodobacter sphaeroides KD131]
 gi|221161004|gb|ACM01984.1| Hypothetical Protein RSKD131_2124 [Rhodobacter sphaeroides KD131]
          Length = 89

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 30/90 (33%), Positives = 50/90 (55%), Gaps = 1/90 (1%)

Query: 1  MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
          M +  + + +++  R WRRGT+EMDLILG + D  +  LS   L + +S++ E+D +L  
Sbjct: 1  MIEAEDARLKRMSMRSWRRGTKEMDLILGPWSDAHLAGLSEDRLALYDSLLNENDQDLLP 60

Query: 61 WFTGMEKPPEYLRTPIFKKIYDYYSNNLDR 90
          W  G  +PP +L   +  +I  +    L R
Sbjct: 61 WVLGQREPPAHLAG-LIAEIGAFARTRLAR 89


>gi|323136888|ref|ZP_08071968.1| protein of unknown function DUF339 [Methylocystis sp. ATCC 49242]
 gi|322397649|gb|EFY00171.1| protein of unknown function DUF339 [Methylocystis sp. ATCC 49242]
          Length = 100

 Score =  104 bits (261), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 30/85 (35%), Positives = 49/85 (57%), Gaps = 1/85 (1%)

Query: 3  KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
              L+ R+I  R WRRG RE+D++LG FVD  +  LS  EL+  E +++  D+ L  W 
Sbjct: 13 SESELRRRRIKIRAWRRGMRELDILLGGFVDAQLSALSDPELSEFEGLLDLPDAELLDWL 72

Query: 63 TGMEKPPEYLRTPIFKKIYDYYSNN 87
          +G   PPE   T + ++I  ++++ 
Sbjct: 73 SGATPPPER-DTALLRRIIAFHTHE 96


>gi|34581454|ref|ZP_00142934.1| hypothetical protein [Rickettsia sibirica 246]
 gi|229586941|ref|YP_002845442.1| Tetratricopeptide repeat-containing protein [Rickettsia africae
          ESF-5]
 gi|28262839|gb|EAA26343.1| unknown [Rickettsia sibirica 246]
 gi|228021991|gb|ACP53699.1| Tetratricopeptide repeat-containing protein [Rickettsia africae
          ESF-5]
          Length = 87

 Score =  104 bits (261), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 27/80 (33%), Positives = 43/80 (53%)

Query: 2  KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
          K N N   +K+ YR   RG REMD ILGSF + ++  +   +L     I++++D++L+ W
Sbjct: 3  KLNKNSLQKKLFYRSKNRGCREMDYILGSFAEKYLSLMDETKLGSYSLILDQNDNDLYNW 62

Query: 62 FTGMEKPPEYLRTPIFKKIY 81
                 P YL   I  K++
Sbjct: 63 INNKSSAPSYLDAEIIDKLH 82


>gi|149203900|ref|ZP_01880868.1| hypothetical protein RTM1035_10280 [Roseovarius sp. TM1035]
 gi|149142342|gb|EDM30387.1| hypothetical protein RTM1035_10280 [Roseovarius sp. TM1035]
          Length = 98

 Score =  104 bits (261), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 21/79 (26%), Positives = 42/79 (53%), Gaps = 1/79 (1%)

Query: 8  QCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEK 67
          + +++  R  RRG +EMD+IL  + +  +  + +  L   ++++ E+D +L++W TG   
Sbjct: 19 RIKRLRMRAMRRGIKEMDIILSRYAEARLGAMDAAALDGFDALLCENDQDLYQWVTGQAA 78

Query: 68 PPEYLRTPIFKKIYDYYSN 86
          PP     P+  +I    S 
Sbjct: 79 PPAQF-APLVAEIAAEASG 96


>gi|224136360|ref|XP_002322310.1| predicted protein [Populus trichocarpa]
 gi|222869306|gb|EEF06437.1| predicted protein [Populus trichocarpa]
          Length = 186

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 29/91 (31%), Positives = 51/91 (56%), Gaps = 4/91 (4%)

Query: 3   KNMNLQCR---KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLF 59
            N   + R   +++YR  +RG  E+DL+LG +V+  I  +    +  L  +++ ++ +L+
Sbjct: 62  SNEESKRRLCNRLLYRSRQRGFLELDLVLGKWVEEHIYSMDENGVKALIDVLDLENPDLW 121

Query: 60  KWFTGMEKPPEYLR-TPIFKKIYDYYSNNLD 89
           KW TG E+PPE +   P+F  + D   NNL 
Sbjct: 122 KWLTGQEQPPEAVSINPVFSAVRDKIMNNLS 152


>gi|157964741|ref|YP_001499565.1| TPR repeat-containing protein [Rickettsia massiliae MTU5]
 gi|239947626|ref|ZP_04699379.1| tetratricopeptide repeat-containing protein [Rickettsia
          endosymbiont of Ixodes scapularis]
 gi|157844517|gb|ABV85018.1| Tetratricopeptide repeat-containing protein [Rickettsia massiliae
          MTU5]
 gi|239921902|gb|EER21926.1| tetratricopeptide repeat-containing protein [Rickettsia
          endosymbiont of Ixodes scapularis]
          Length = 87

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 27/80 (33%), Positives = 42/80 (52%)

Query: 2  KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
          K N N   +K+ YR   RG REMD ILGSF + ++  +   +L     I++++D++L+ W
Sbjct: 3  KLNKNSLQKKLFYRSKNRGCREMDYILGSFAEKYLSLMDEKKLGSYSLILDQNDNDLYNW 62

Query: 62 FTGMEKPPEYLRTPIFKKIY 81
                 P YL   I  K+ 
Sbjct: 63 INNKSSAPSYLDAEIIDKLR 82


>gi|110681029|ref|YP_684036.1| hypothetical protein RD1_3890 [Roseobacter denitrificans OCh 114]
 gi|109457145|gb|ABG33350.1| conserved hypothetical protein [Roseobacter denitrificans OCh
          114]
          Length = 88

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 23/82 (28%), Positives = 42/82 (51%), Gaps = 1/82 (1%)

Query: 1  MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
          M +    + +++  R  RRG +EMDLIL  F +  +  +    L   ++++ E+D +L++
Sbjct: 1  MTELHEHRIKRLKMRSMRRGIKEMDLILQHFAERQLDGMDDAGLGQYDAMLNENDHDLYQ 60

Query: 61 WFTGMEKPPEYLRTPIFKKIYD 82
          W TG   PPE     +   I +
Sbjct: 61 WVTGQVAPPEPY-AALIAAIRN 81


>gi|281206223|gb|EFA80412.1| DUF339 family protein [Polysphondylium pallidum PN500]
          Length = 137

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 24/85 (28%), Positives = 46/85 (54%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
            N ++  +K++Y+   RG  E DL+LGSF   ++ +    +L   ++II++ D +++ W 
Sbjct: 46  SNTDILRKKLIYQSKERGMLENDLLLGSFASKYLNDFDHNKLVEYDNIIQQPDPDIYNWA 105

Query: 63  TGMEKPPEYLRTPIFKKIYDYYSNN 87
              +  PE L T + K +  +  NN
Sbjct: 106 LNKQDIPEELNTEVMKLLQHHCQNN 130


>gi|315499870|ref|YP_004088673.1| hypothetical protein Astex_2885 [Asticcacaulis excentricus CB 48]
 gi|315417882|gb|ADU14522.1| protein of unknown function DUF339 [Asticcacaulis excentricus CB
          48]
          Length = 105

 Score =  103 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 23/89 (25%), Positives = 47/89 (52%), Gaps = 4/89 (4%)

Query: 1  MKKNMN----LQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDS 56
          M    +     + RK+ +R  RRG +E D+ILG F + ++  +++ +L + E+++E  D 
Sbjct: 9  MTDTADDLHQARLRKLWFRASRRGFKEADIILGHFAEEYLPTMTAEQLDIFEALLEAPDQ 68

Query: 57 NLFKWFTGMEKPPEYLRTPIFKKIYDYYS 85
          +L+ W    +  P   ++ I  ++  YY 
Sbjct: 69 DLYGWIIERDPVPPEHKSEIMSQLNQYYK 97


>gi|13235410|emb|CAC33610.1| hypothetical protein [Rickettsia montanensis]
          Length = 87

 Score =  103 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 27/80 (33%), Positives = 42/80 (52%)

Query: 2  KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
          K N N   +K+ YR   RG REMD ILGSF + ++  +   +L     I++++D++L+ W
Sbjct: 3  KLNKNSLQKKLFYRSKNRGCREMDYILGSFAEKYLSLMDEKKLGSYSLILDQNDNDLYNW 62

Query: 62 FTGMEKPPEYLRTPIFKKIY 81
                 P YL   I  K+ 
Sbjct: 63 INNKSSAPSYLDAKIIDKLR 82


>gi|99081573|ref|YP_613727.1| hypothetical protein TM1040_1732 [Ruegeria sp. TM1040]
 gi|99037853|gb|ABF64465.1| protein of unknown function DUF339 [Ruegeria sp. TM1040]
          Length = 92

 Score =  103 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 18/76 (23%), Positives = 43/76 (56%)

Query: 1  MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
          ++++   + +++  R  RRG +EMD++L  +    +  +S  +L + ++++ E+D +L++
Sbjct: 8  IEESRETRIKRLTMRSMRRGIKEMDILLSGYAAANLAAMSDAQLALYDALLRENDQDLYQ 67

Query: 61 WFTGMEKPPEYLRTPI 76
          W TG    PE     +
Sbjct: 68 WVTGQTPAPERFNALV 83


>gi|307942227|ref|ZP_07657578.1| conserved hypothetical protein [Roseibium sp. TrichSKD4]
 gi|307774513|gb|EFO33723.1| conserved hypothetical protein [Roseibium sp. TrichSKD4]
          Length = 101

 Score =  103 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 31/84 (36%), Positives = 52/84 (61%)

Query: 3  KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
          ++ + + +KI++RCW RG +EMDL+LG F    I  L+  EL  LE I+   D +L+ W 
Sbjct: 14 EDRDPRRKKILFRCWHRGIKEMDLLLGGFAKDHIDLLNEEELAELEHILTAHDQDLYAWM 73

Query: 63 TGMEKPPEYLRTPIFKKIYDYYSN 86
          TG +  PE    P++++I  Y+++
Sbjct: 74 TGRKPLPEEWDGPLYRRIIAYHAD 97


>gi|330799426|ref|XP_003287746.1| hypothetical protein DICPUDRAFT_32960 [Dictyostelium purpureum]
 gi|325082255|gb|EGC35743.1| hypothetical protein DICPUDRAFT_32960 [Dictyostelium purpureum]
          Length = 134

 Score =  103 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 23/85 (27%), Positives = 44/85 (51%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
            N+    +K++Y+   RG  E DL+LGSF  + I +L+  +L   + ++++ D ++F W 
Sbjct: 43  SNVEKLRKKLLYQSKERGMLENDLLLGSFATNNIQKLTEQQLKDYDLLLQQPDPDIFNWI 102

Query: 63  TGMEKPPEYLRTPIFKKIYDYYSNN 87
                 P+   T + K I  +  N+
Sbjct: 103 LNKTVIPDEFETEVLKMIQHHCQND 127


>gi|162147669|ref|YP_001602130.1| hypothetical protein GDI_1885 [Gluconacetobacter diazotrophicus PAl
           5]
 gi|209542294|ref|YP_002274523.1| hypothetical protein Gdia_0108 [Gluconacetobacter diazotrophicus
           PAl 5]
 gi|161786246|emb|CAP55828.1| conserved hypothetical protein [Gluconacetobacter diazotrophicus
           PAl 5]
 gi|209529971|gb|ACI49908.1| protein of unknown function DUF339 [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 103

 Score =  103 bits (259), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 24/92 (26%), Positives = 49/92 (53%)

Query: 4   NMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFT 63
           N++ + R++ +R   RGT E D+++G FV   +  L+  E+  LE ++E  D++L  W +
Sbjct: 10  NLDPRRRRLYFRATHRGTHETDILIGGFVAPRLAGLTDAEMDALEEVMELPDADLADWLS 69

Query: 64  GMEKPPEYLRTPIFKKIYDYYSNNLDRKNMLG 95
           G +  P  +  P+ + I    ++   +  + G
Sbjct: 70  GRKPVPAEVDGPMMRAIMADANDPARQAAIRG 101


>gi|114797711|ref|YP_760686.1| TPR repeat-containing protein [Hyphomonas neptunium ATCC 15444]
 gi|114737885|gb|ABI76010.1| TPR repeat protein [Hyphomonas neptunium ATCC 15444]
          Length = 87

 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 24/78 (30%), Positives = 43/78 (55%)

Query: 6  NLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGM 65
          + +  K+ +R WRRG RE+DL++GSF D  +  +S   L   E +++  D  +F W  G 
Sbjct: 3  DTRRSKLKFRAWRRGFRELDLLMGSFADQSLESMSQDGLDEFERLLDVPDWEIFAWLVGQ 62

Query: 66 EKPPEYLRTPIFKKIYDY 83
          E  P+  + P+  ++  +
Sbjct: 63 EPVPDKHKGPVLDQLIGF 80


>gi|330994821|ref|ZP_08318743.1| Succinate dehydrogenase assembly factor 2 [Gluconacetobacter sp.
           SXCC-1]
 gi|329758082|gb|EGG74604.1| Succinate dehydrogenase assembly factor 2 [Gluconacetobacter sp.
           SXCC-1]
          Length = 103

 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 28/92 (30%), Positives = 50/92 (54%)

Query: 5   MNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTG 64
           ++ + RKI YR   RGT E D+++G FV   +  ++  +L  LE++++  D++L  W +G
Sbjct: 11  LDTRRRKIYYRATHRGTHETDVLIGGFVAPRLEGMTEAQLDALEAVMDLPDADLADWLSG 70

Query: 65  MEKPPEYLRTPIFKKIYDYYSNNLDRKNMLGS 96
               PE L TP+ K+I    ++      + G 
Sbjct: 71  RRPVPEELNTPMMKEIMADATDPARLAAIRGG 102


>gi|15604449|ref|NP_220967.1| hypothetical protein RP599 [Rickettsia prowazekii str. Madrid E]
 gi|3861143|emb|CAA15043.1| unknown [Rickettsia prowazekii]
 gi|292572221|gb|ADE30136.1| Tetratricopeptide repeat-containing protein [Rickettsia
          prowazekii Rp22]
          Length = 87

 Score =  103 bits (258), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 26/80 (32%), Positives = 42/80 (52%)

Query: 2  KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
          K N N   +K+ YR  +RG REMD ILG F + ++  +   +L     I++++D++L+ W
Sbjct: 3  KLNKNALQKKLFYRSKKRGCREMDYILGRFAEKYLSSMDEKKLKSYTLILDQNDNDLYNW 62

Query: 62 FTGMEKPPEYLRTPIFKKIY 81
                 P YL   I  K+ 
Sbjct: 63 INNKPSAPSYLDPEIIDKLR 82


>gi|58584317|ref|YP_197890.1| hypothetical protein Wbm0056 [Wolbachia endosymbiont strain TRS
          of Brugia malayi]
 gi|58418633|gb|AAW70648.1| Uncharacterized conserved protein [Wolbachia endosymbiont strain
          TRS of Brugia malayi]
          Length = 93

 Score =  103 bits (258), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 27/84 (32%), Positives = 45/84 (53%)

Query: 4  NMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFT 63
          +++L  RK++YR W RG +E D++LG F  +++ + S  EL   E I++ DD  L+ + T
Sbjct: 5  DISLLRRKLIYRSWHRGCKETDILLGYFALNYLDKFSLNELIEYEKIVDLDDYELYCYIT 64

Query: 64 GMEKPPEYLRTPIFKKIYDYYSNN 87
               P  L + I   I  +   N
Sbjct: 65 CKTNLPSNLSSDIVNLITHFIKAN 88


>gi|13470980|ref|NP_102549.1| hypothetical protein msl0828 [Mesorhizobium loti MAFF303099]
 gi|14021723|dbj|BAB48335.1| msl0828 [Mesorhizobium loti MAFF303099]
          Length = 95

 Score =  103 bits (258), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 26/81 (32%), Positives = 42/81 (51%)

Query: 2  KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
           + ++   RK+++R W RG REMDLILG+F D  I  L+  E+   E +++  D+     
Sbjct: 8  SEGLDAHRRKLLFRSWHRGMREMDLILGTFADAEIGALTGEEIEQYERLLDISDTEFLPL 67

Query: 62 FTGMEKPPEYLRTPIFKKIYD 82
           TG    P  +   + +KI  
Sbjct: 68 ITGERPIPADIDCAVLQKILA 88


>gi|15892837|ref|NP_360551.1| hypothetical protein RC0914 [Rickettsia conorii str. Malish 7]
 gi|15620022|gb|AAL03452.1| unknown [Rickettsia conorii str. Malish 7]
          Length = 87

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 26/80 (32%), Positives = 42/80 (52%)

Query: 2  KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
          K N N   +K+ YR   RG REMD IL SF + ++  +   +L     I++++D++L+ W
Sbjct: 3  KLNKNSLQKKLFYRSKNRGCREMDYILSSFAEKYLSLMDETQLGSYSLILDQNDNDLYNW 62

Query: 62 FTGMEKPPEYLRTPIFKKIY 81
                 P YL   I  K++
Sbjct: 63 INNKSSAPSYLDAEIIDKLH 82


>gi|125534599|gb|EAY81147.1| hypothetical protein OsI_36329 [Oryza sativa Indica Group]
          Length = 186

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 26/91 (28%), Positives = 51/91 (56%), Gaps = 4/91 (4%)

Query: 6   NLQCR---KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
             + R   ++VYR  +RG  E+DL+LG++V+  I  +    +  L  +++ ++ +L+KW 
Sbjct: 66  ESRRRLINRLVYRSKQRGFLELDLVLGTWVEQHIHSMDEANIRALLQVLDLENPDLWKWL 125

Query: 63  TGMEKPPEYLR-TPIFKKIYDYYSNNLDRKN 92
           T  E+PPE +   P+F  +    + NL + +
Sbjct: 126 TDQEQPPEAMNSNPVFIAVKSKVTENLSKHS 156


>gi|51473777|ref|YP_067534.1| hypothetical protein RT0587 [Rickettsia typhi str. Wilmington]
 gi|13235383|emb|CAC33733.1| hypothetical protein [Rickettsia typhi]
 gi|51460089|gb|AAU04052.1| conserved hypothetical protein [Rickettsia typhi str. Wilmington]
          Length = 90

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 27/87 (31%), Positives = 44/87 (50%)

Query: 2  KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
          K N N   +K+ YR  +RG REMD ILGSF + ++  +    L     I++++D++L+ W
Sbjct: 3  KLNKNALQKKLFYRSKKRGCREMDYILGSFAEKYLSFMDEKTLKRYTLILDQNDNDLYNW 62

Query: 62 FTGMEKPPEYLRTPIFKKIYDYYSNNL 88
                 P Y+ + I  K+       L
Sbjct: 63 INNKSSAPSYIDSEIIDKLSKIAQIKL 89


>gi|254440656|ref|ZP_05054149.1| hypothetical protein OA307_71 [Octadecabacter antarcticus 307]
 gi|198250734|gb|EDY75049.1| hypothetical protein OA307_71 [Octadecabacter antarcticus 307]
          Length = 91

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 22/82 (26%), Positives = 44/82 (53%), Gaps = 1/82 (1%)

Query: 1  MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
          M + +++  +++  R  RRG +EMDLIL  F    +  L + +L + + ++ E+D +L++
Sbjct: 1  MSEPLDVMRKRLHMRSIRRGIKEMDLILMGFSKAHLAGLDATQLAVYDRLLNENDHDLYQ 60

Query: 61 WFTGMEKPPEYLRTPIFKKIYD 82
          W +G    P    T +   I +
Sbjct: 61 WVSGQSDGPTEYDT-LMAIIRE 81


>gi|254421029|ref|ZP_05034753.1| TPR repeat region superfamily [Brevundimonas sp. BAL3]
 gi|196187206|gb|EDX82182.1| TPR repeat region superfamily [Brevundimonas sp. BAL3]
          Length = 109

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 27/82 (32%), Positives = 43/82 (52%)

Query: 8   QCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEK 67
           +  +I +R WRRG RE D++LG F D     L+  EL  LE +I+E+D  L+ W    + 
Sbjct: 20  RLGRIQFRSWRRGFREADMVLGPFSDQVAPTLTDAELDQLELLIDEEDQWLYGWIIERDP 79

Query: 68  PPEYLRTPIFKKIYDYYSNNLD 89
            P    TP+  K+  +   ++ 
Sbjct: 80  TPPEFETPVMAKVRAFMREHVA 101


>gi|85707127|ref|ZP_01038215.1| TPR repeat family protein [Roseovarius sp. 217]
 gi|85668413|gb|EAQ23286.1| TPR repeat family protein [Roseovarius sp. 217]
          Length = 98

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 21/79 (26%), Positives = 40/79 (50%), Gaps = 1/79 (1%)

Query: 8  QCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEK 67
          + +++  R  RRG +EMD+IL  + +  +  +    L   ++++ E+D +L++W TG   
Sbjct: 19 RLKRLHMRAMRRGIKEMDIILSRYAEARLEAMEDSALDGFDALLCENDQDLYQWVTGQTP 78

Query: 68 PPEYLRTPIFKKIYDYYSN 86
          PP     P+   I    S 
Sbjct: 79 PPARF-APLVADIATQASA 96


>gi|163734589|ref|ZP_02142028.1| hypothetical protein RLO149_14218 [Roseobacter litoralis Och 149]
 gi|161392082|gb|EDQ16412.1| hypothetical protein RLO149_14218 [Roseobacter litoralis Och 149]
          Length = 88

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 24/82 (29%), Positives = 44/82 (53%), Gaps = 1/82 (1%)

Query: 1  MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
          M +    + +++  R  RRG +EMDLIL  F +  +  +    LT  ++++ E+D +L++
Sbjct: 1  MTELHEHRIKRLKMRSMRRGIKEMDLILQHFAERKLEGMDDAGLTHYDAMLNENDHDLYQ 60

Query: 61 WFTGMEKPPEYLRTPIFKKIYD 82
          W TG   PPE     + + I +
Sbjct: 61 WVTGQIAPPEPY-VALIEAIKN 81


>gi|88607462|ref|YP_505743.1| TPR repeat-containing protein [Anaplasma phagocytophilum HZ]
 gi|88598525|gb|ABD43995.1| TPR repeat protein [Anaplasma phagocytophilum HZ]
          Length = 88

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 25/79 (31%), Positives = 45/79 (56%)

Query: 9  CRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKP 68
           R+++YR   RG +EMD++LGSF  H +  LS  ++   E+I+E DD+ L+ +  G    
Sbjct: 10 RRRLLYRSVHRGCKEMDILLGSFAQHHLHLLSDEQVANYEAIVELDDALLYSYVVGRVPI 69

Query: 69 PEYLRTPIFKKIYDYYSNN 87
          P+ + + + + I  + S  
Sbjct: 70 PQGIDSALIELISGFASRK 88


>gi|260433145|ref|ZP_05787116.1| TPR repeat family protein [Silicibacter lacuscaerulensis
          ITI-1157]
 gi|260416973|gb|EEX10232.1| TPR repeat family protein [Silicibacter lacuscaerulensis
          ITI-1157]
          Length = 85

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 20/82 (24%), Positives = 41/82 (50%), Gaps = 1/82 (1%)

Query: 1  MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
          M +    + +++  R  RRG +EMD+IL ++ +  +  +    L   ++++ E+D +L++
Sbjct: 1  MTETRETRIKRMKMRSMRRGIKEMDIILQAYAERNLDAMDDAGLDRYDALLHENDQDLYQ 60

Query: 61 WFTGMEKPPEYLRTPIFKKIYD 82
          W TG   PP      +   I  
Sbjct: 61 WVTGQVAPPAPF-GDLISDIAQ 81


>gi|83954061|ref|ZP_00962781.1| TPR repeat family protein [Sulfitobacter sp. NAS-14.1]
 gi|83841098|gb|EAP80268.1| TPR repeat family protein [Sulfitobacter sp. NAS-14.1]
          Length = 88

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 24/87 (27%), Positives = 45/87 (51%), Gaps = 1/87 (1%)

Query: 1  MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
          M +    + +++  R  RRG +EMDLIL S+    +  +    L++ + ++ E+D +L++
Sbjct: 1  MAELHEHKVKRLHMRSMRRGIKEMDLILPSYASTRLATMDDAALSLYDDMLSENDHDLYQ 60

Query: 61 WFTGMEKPPEYLRTPIFKKIYDYYSNN 87
          W TG    PE   T +   I  + + N
Sbjct: 61 WVTGQTPAPEPF-TALIADIQTHLAAN 86


>gi|144898257|emb|CAM75121.1| protein containing DUF339 [Magnetospirillum gryphiswaldense
          MSR-1]
          Length = 88

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 20/84 (23%), Positives = 45/84 (53%)

Query: 6  NLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGM 65
            + +++ +R    G+ E D++ G F + ++  LS+ ++   E++I E D++LF W TG 
Sbjct: 3  EARLKRLKFRAHHMGSNENDILFGGFAEKYLYSLSAEQVDRFETLIAETDTDLFNWVTGK 62

Query: 66 EKPPEYLRTPIFKKIYDYYSNNLD 89
           + P +L   + + + ++  N   
Sbjct: 63 VEVPVHLDHDVMQMVRNFVQNEAA 86


>gi|297792415|ref|XP_002864092.1| hypothetical protein ARALYDRAFT_495170 [Arabidopsis lyrata subsp.
           lyrata]
 gi|297309927|gb|EFH40351.1| hypothetical protein ARALYDRAFT_495170 [Arabidopsis lyrata subsp.
           lyrata]
          Length = 185

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 24/90 (26%), Positives = 52/90 (57%), Gaps = 1/90 (1%)

Query: 2   KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
           ++N      +++YR  +RG  E+DL+LG++V+  +  +    +  L  ++  ++ +L+KW
Sbjct: 63  EENKRRTINRLLYRSKQRGFLELDLVLGNWVEENVDSMDENGVKSLIHVLNLENPDLWKW 122

Query: 62  FTGMEKPPEYL-RTPIFKKIYDYYSNNLDR 90
            T  E+PPE +   P+F  +++    NL++
Sbjct: 123 LTEQEQPPEEVSSNPVFSALHEKVMKNLNK 152


>gi|83942890|ref|ZP_00955350.1| TPR repeat-containing protein [Sulfitobacter sp. EE-36]
 gi|83845898|gb|EAP83775.1| TPR repeat-containing protein [Sulfitobacter sp. EE-36]
          Length = 88

 Score =  102 bits (256), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 24/87 (27%), Positives = 45/87 (51%), Gaps = 1/87 (1%)

Query: 1  MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
          M +    + +++  R  RRG +EMDLIL S+    +  +    L++ + ++ E+D +L++
Sbjct: 1  MAELHEHKVKRLHMRSMRRGIKEMDLILPSYAATRLATMDDAALSLYDDMLSENDHDLYQ 60

Query: 61 WFTGMEKPPEYLRTPIFKKIYDYYSNN 87
          W TG    PE   T +   I  + + N
Sbjct: 61 WVTGQTPAPEPF-TALIADIQTHLAAN 86


>gi|255630474|gb|ACU15595.1| unknown [Glycine max]
          Length = 182

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 25/80 (31%), Positives = 47/80 (58%), Gaps = 1/80 (1%)

Query: 11  KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
           +++YR  +RG  E+DL+LG +V+  I  L    +  L  +++ ++ +L+KW +G E+PPE
Sbjct: 69  RLLYRSKQRGFLELDLVLGKWVEENIHSLDENRIKALIHVLDLENPDLWKWISGQEQPPE 128

Query: 71  YLRTP-IFKKIYDYYSNNLD 89
            +    +F  + +    NLD
Sbjct: 129 SVSANLVFAAVRERVKKNLD 148


>gi|148554436|ref|YP_001262018.1| hypothetical protein Swit_1517 [Sphingomonas wittichii RW1]
 gi|148499626|gb|ABQ67880.1| protein of unknown function DUF339 [Sphingomonas wittichii RW1]
          Length = 88

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 18/78 (23%), Positives = 38/78 (48%)

Query: 4  NMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFT 63
          N + + +++ +R W RGTRE D ++G F D          L   E ++ ++D+++  W  
Sbjct: 2  NHDDRLKRLRFRAWHRGTREADYMIGGFFDRLHQGWDGEALDWFEGLLAQEDADILGWVM 61

Query: 64 GMEKPPEYLRTPIFKKIY 81
          G    P   +  + +++ 
Sbjct: 62 GTIPVPAEWQGALMERMQ 79


>gi|27379713|ref|NP_771242.1| hypothetical protein bsl4602 [Bradyrhizobium japonicum USDA 110]
 gi|27352865|dbj|BAC49867.1| bsl4602 [Bradyrhizobium japonicum USDA 110]
          Length = 96

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 31/82 (37%), Positives = 49/82 (59%)

Query: 2  KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
             ++ + +++++RCW RGTREMDLILG F D  I  LS  EL  LE ++E +D +L+  
Sbjct: 8  SNGLDDRRKRLLFRCWHRGTREMDLILGRFADAEIGNLSDAELDELEHLLEVNDPDLYAA 67

Query: 62 FTGMEKPPEYLRTPIFKKIYDY 83
           TG +  P  +   +F +I  +
Sbjct: 68 ITGDKVLPADVTGALFARIKAF 89


>gi|326427862|gb|EGD73432.1| hypothetical protein PTSG_05135 [Salpingoeca sp. ATCC 50818]
          Length = 211

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 25/88 (28%), Positives = 53/88 (60%), Gaps = 3/88 (3%)

Query: 2   KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDD--SNLF 59
            +  + +  +++Y+  +RG +EMDLIL ++ D ++  ++  +L   +SI+ + D   ++F
Sbjct: 107 NETTDHKRARLLYQSRKRGIKEMDLILATYADQYLDTMTEQQLEEYDSILNDHDNEWDMF 166

Query: 60  KWFTGMEKPPEYLRT-PIFKKIYDYYSN 86
           KW TG E+ PEYL+   + + + ++  N
Sbjct: 167 KWLTGKEELPEYLQGSGVMQHLMEFTKN 194


>gi|255003481|ref|ZP_05278445.1| hypothetical protein AmarPR_04530 [Anaplasma marginale str.
          Puerto Rico]
 gi|255004606|ref|ZP_05279407.1| hypothetical protein AmarV_04895 [Anaplasma marginale str.
          Virginia]
          Length = 88

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 23/84 (27%), Positives = 41/84 (48%)

Query: 4  NMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFT 63
           +  + R+++YR   RG +E D++LG+F   ++  L   EL   E I+E DD  L+ +  
Sbjct: 5  GLEGRKRRLLYRSTHRGCKETDILLGAFAQRYLALLDEEELVQYEKIVELDDELLYSYIV 64

Query: 64 GMEKPPEYLRTPIFKKIYDYYSNN 87
          G    P+ +   +  +I    S  
Sbjct: 65 GRRPVPDSIDKALVSRISACASGK 88


>gi|159471722|ref|XP_001694005.1| predicted protein [Chlamydomonas reinhardtii]
 gi|158277172|gb|EDP02941.1| predicted protein [Chlamydomonas reinhardtii]
          Length = 173

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 26/88 (29%), Positives = 52/88 (59%), Gaps = 5/88 (5%)

Query: 6   NLQCR----KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
             + R    K++YR  +RG  E+DL++G + +  I +++  EL  +  +++E++ +LFKW
Sbjct: 46  EERRRGIANKLLYRSKQRGFLELDLLMGLWAEANIPKMTMAELNQMAFVLDEENPDLFKW 105

Query: 62  FTGMEKPPEYLR-TPIFKKIYDYYSNNL 88
            TG  + PE+++  P+F  I  + +  L
Sbjct: 106 LTGQLQAPEHMQKNPVFVAIQSHVAQQL 133


>gi|323447553|gb|EGB03469.1| hypothetical protein AURANDRAFT_16750 [Aureococcus
          anophagefferens]
 gi|323447555|gb|EGB03471.1| hypothetical protein AURANDRAFT_16747 [Aureococcus
          anophagefferens]
          Length = 82

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 23/76 (30%), Positives = 43/76 (56%)

Query: 9  CRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKP 68
           ++++YR  +RG  E+DL+LG++    +  L+S E    E I+  +  ++F + TG +  
Sbjct: 1  KKRLIYRSKQRGWLEVDLLLGTWAVENVDGLTSAECDEYEDILNCETIDIFNFITGKDPV 60

Query: 69 PEYLRTPIFKKIYDYY 84
          P  L T + K++ DY 
Sbjct: 61 PPRLDTAMMKRLQDYC 76


>gi|255632444|gb|ACU16572.1| unknown [Glycine max]
          Length = 177

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 29/91 (31%), Positives = 53/91 (58%), Gaps = 4/91 (4%)

Query: 3   KNMNLQCR---KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLF 59
            N   + R   +++YR  +RG  E+DL+LG +V+  I  L  + +  L  +++ ++ +L+
Sbjct: 53  SNEESKRRLFNQLLYRSKQRGFLELDLVLGKWVEDNIHSLDEIRIKALIHVLDLENPDLW 112

Query: 60  KWFTGMEKPPEYLRT-PIFKKIYDYYSNNLD 89
           KW +G E+PPE + T P+F  + +    NLD
Sbjct: 113 KWISGQEQPPESVSTNPVFAAVRERVMKNLD 143


>gi|254995303|ref|ZP_05277493.1| hypothetical protein AmarM_05065 [Anaplasma marginale str.
          Mississippi]
          Length = 88

 Score =  102 bits (254), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 23/84 (27%), Positives = 41/84 (48%)

Query: 4  NMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFT 63
           +  + R+++YR   RG +E D++LG+F   ++  L   EL   E I+E DD  L+ +  
Sbjct: 5  GLEGRKRRLLYRSTHRGCKEADILLGAFAQRYLALLDEEELVQYEKIVELDDELLYSYIV 64

Query: 64 GMEKPPEYLRTPIFKKIYDYYSNN 87
          G    P+ +   +  +I    S  
Sbjct: 65 GRRPVPDSIDKALVSRISACASGK 88


>gi|83311565|ref|YP_421829.1| hypothetical protein amb2466 [Magnetospirillum magneticum AMB-1]
 gi|82946406|dbj|BAE51270.1| Uncharacterized conserved protein [Magnetospirillum magneticum
           AMB-1]
          Length = 105

 Score =  102 bits (254), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 24/90 (26%), Positives = 45/90 (50%), Gaps = 1/90 (1%)

Query: 1   MKKNMN-LQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLF 59
           M   M+  + +++++R    G+ E D++ G F   ++  L+S +    ES+I E+DS+LF
Sbjct: 14  MPDTMDQDRLKRLMFRAHHMGSNENDILFGGFAAKYLETLTSEQAERFESLIAENDSDLF 73

Query: 60  KWFTGMEKPPEYLRTPIFKKIYDYYSNNLD 89
            W TG  + P  L   +   I  +  +   
Sbjct: 74  NWVTGKAEVPAVLDHDVMAMIKKFVQSEAA 103


>gi|301108613|ref|XP_002903388.1| conserved hypothetical protein [Phytophthora infestans T30-4]
 gi|262097760|gb|EEY55812.1| conserved hypothetical protein [Phytophthora infestans T30-4]
          Length = 172

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 28/91 (30%), Positives = 52/91 (57%), Gaps = 1/91 (1%)

Query: 6   NLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGM 65
               ++I+YR  +RG  E+DL+LG +    +++LSS EL   E I+ E+  ++F + +G 
Sbjct: 72  EANRKRIIYRSKQRGWLEVDLLLGRWASQNVMQLSSDELKQYEDILNEETIDIFNYISGK 131

Query: 66  EKPPEYLRTPIFKKIYDYY-SNNLDRKNMLG 95
              P  L TP+ K++ +Y  ++ L + +  G
Sbjct: 132 SAVPHRLDTPMMKRLQEYCLTSPLGKASTEG 162


>gi|21592766|gb|AAM64715.1| unknown [Arabidopsis thaliana]
          Length = 188

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 24/90 (26%), Positives = 52/90 (57%), Gaps = 1/90 (1%)

Query: 2   KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
           ++N      +++YR  +RG  E+DL+LG++V+  +  +    +  L  ++  ++ +L+KW
Sbjct: 66  EENKRRTINRLLYRSKQRGFLELDLVLGNWVEENVNSMDENGVKSLIHVLNLENPDLWKW 125

Query: 62  FTGMEKPPEYL-RTPIFKKIYDYYSNNLDR 90
            T  E+PPE +   P+F  +++    NL++
Sbjct: 126 LTEQEQPPEAVSSNPVFSALHEKVMKNLNK 155


>gi|307295469|ref|ZP_07575305.1| protein of unknown function DUF339 [Sphingobium chlorophenolicum
          L-1]
 gi|306878508|gb|EFN09728.1| protein of unknown function DUF339 [Sphingobium chlorophenolicum
          L-1]
          Length = 89

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 24/78 (30%), Positives = 38/78 (48%)

Query: 4  NMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFT 63
          N + + R++ +R W RG +E DL +G F D +       EL   E  IEE D+++  W  
Sbjct: 2  NEDPRIRRLQFRAWHRGIKEADLAVGGFFDRYHAGWGEEELDWFERFIEEQDADIMAWAL 61

Query: 64 GMEKPPEYLRTPIFKKIY 81
          G    P+    P++ K  
Sbjct: 62 GTLPLPDEWGGPMWDKFA 79


>gi|15241359|ref|NP_199917.1| unknown protein [Arabidopsis thaliana]
 gi|9758251|dbj|BAB08750.1| unnamed protein product [Arabidopsis thaliana]
 gi|98960953|gb|ABF58960.1| At5g51040 [Arabidopsis thaliana]
 gi|110738284|dbj|BAF01071.1| hypothetical protein [Arabidopsis thaliana]
 gi|332008641|gb|AED96024.1| uncharacterized protein [Arabidopsis thaliana]
          Length = 188

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 24/90 (26%), Positives = 52/90 (57%), Gaps = 1/90 (1%)

Query: 2   KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
           ++N      +++YR  +RG  E+DL+LG++V+  +  +    +  L  ++  ++ +L+KW
Sbjct: 66  EENKRRTINRLLYRSKQRGFLELDLVLGNWVEENVNSMDENGVKSLIHVLNLENPDLWKW 125

Query: 62  FTGMEKPPEYL-RTPIFKKIYDYYSNNLDR 90
            T  E+PPE +   P+F  +++    NL++
Sbjct: 126 LTEQEQPPEAVSSNPVFSALHEKVMKNLNK 155


>gi|255633446|gb|ACU17081.1| unknown [Glycine max]
          Length = 175

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 27/91 (29%), Positives = 51/91 (56%), Gaps = 4/91 (4%)

Query: 3   KNMNLQCR---KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLF 59
            N   + R   +++YR  +RG  E+DL+LG +V+  I  L    +  L  +++ ++ +L+
Sbjct: 51  SNQESKRRLFNRLLYRSKQRGFLELDLVLGKWVEDNIHSLDEYRVRALILLLDLENPDLW 110

Query: 60  KWFTGMEKPPEYLR-TPIFKKIYDYYSNNLD 89
           KW +G E+PPE +   P+F  + +    NL+
Sbjct: 111 KWISGQEQPPESIHINPVFAAVREGVMKNLE 141


>gi|146340718|ref|YP_001205766.1| hypothetical protein BRADO3770 [Bradyrhizobium sp. ORS278]
 gi|146193524|emb|CAL77540.1| conserved hypothetical protein [Bradyrhizobium sp. ORS278]
          Length = 77

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 30/77 (38%), Positives = 43/77 (55%)

Query: 13 VYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPEYL 72
          ++RCW RGTREMDLILG F D  I  L+  EL  LE ++E  D + +   TG    P   
Sbjct: 1  MFRCWHRGTREMDLILGRFADAEIGTLTESELDQLEQLLEVSDPDFYAAITGARPLPPEQ 60

Query: 73 RTPIFKKIYDYYSNNLD 89
             +F++I  + + + D
Sbjct: 61 TPALFERIKSFRAVDAD 77


>gi|114327499|ref|YP_744656.1| TPR repeat-containing protein [Granulibacter bethesdensis
          CGDNIH1]
 gi|114315673|gb|ABI61733.1| TPR repeat containing protein [Granulibacter bethesdensis
          CGDNIH1]
          Length = 99

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 23/78 (29%), Positives = 42/78 (53%)

Query: 5  MNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTG 64
          +  + R++++R   RGT E D+++G +V   + + S  EL  LE+I++  D +L  W TG
Sbjct: 18 LESRRRRLLFRATHRGTHENDILIGGYVAARLEQFSEAELDALEAIMDLPDPDLADWLTG 77

Query: 65 MEKPPEYLRTPIFKKIYD 82
              P    T + + + D
Sbjct: 78 RRPIPPDHDTSLLRAMKD 95


>gi|66799941|ref|XP_628896.1| DUF339 family protein [Dictyostelium discoideum AX4]
 gi|74850425|sp|Q54B20|SDHF2_DICDI RecName: Full=Succinate dehydrogenase assembly factor 2,
           mitochondrial; Short=SDH assembly factor 2; AltName:
           Full=Succinate dehydrogenase subunit 5, mitochondrial;
           Flags: Precursor
 gi|60462245|gb|EAL60472.1| DUF339 family protein [Dictyostelium discoideum AX4]
          Length = 141

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 22/85 (25%), Positives = 42/85 (49%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
             +    +K++Y+   RG  E DL+LGSF    I +L+  +L     ++++ D ++F W 
Sbjct: 50  SEIEKLRKKLLYQSKERGMLENDLLLGSFATLNIHKLTESQLRDYNLLLQQPDPDIFNWI 109

Query: 63  TGMEKPPEYLRTPIFKKIYDYYSNN 87
               + PE   T + K +  +  N+
Sbjct: 110 LKKAEVPEEFETEVLKLVQHHCKND 134


>gi|91205665|ref|YP_538020.1| TPR repeat-containing protein [Rickettsia bellii RML369-C]
 gi|91069209|gb|ABE04931.1| Tetratricopeptide repeat-containing protein [Rickettsia bellii
          RML369-C]
          Length = 87

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 24/80 (30%), Positives = 43/80 (53%)

Query: 2  KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
          K N N   +K+ YR   RG +EMD ILG+F   ++  ++  +L     I++++D++L+ W
Sbjct: 3  KLNKNSLQKKLFYRSKNRGCKEMDYILGNFASLYLPFMAEEKLLSYALILDQNDNDLYNW 62

Query: 62 FTGMEKPPEYLRTPIFKKIY 81
           T     P  L   I +++ 
Sbjct: 63 ITNKSSVPSNLDAEIMEQLR 82


>gi|294011406|ref|YP_003544866.1| hypothetical protein SJA_C1-14200 [Sphingobium japonicum UT26S]
 gi|292674736|dbj|BAI96254.1| conserved hypothetical protein [Sphingobium japonicum UT26S]
          Length = 89

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 26/78 (33%), Positives = 41/78 (52%)

Query: 4  NMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFT 63
          N + + R++ +R W RG +E DL +G F D +  E    EL   E  IEE D+++  W  
Sbjct: 2  NEDPRIRRLQFRAWHRGIKEADLAVGGFFDRYHAEWGEEELDWFERFIEEQDADIMAWAL 61

Query: 64 GMEKPPEYLRTPIFKKIY 81
          G    PE  R P++++  
Sbjct: 62 GTLPLPEQWRGPMWERFA 79


>gi|146276466|ref|YP_001166625.1| hypothetical protein Rsph17025_0414 [Rhodobacter sphaeroides ATCC
          17025]
 gi|145554707|gb|ABP69320.1| protein of unknown function DUF339 [Rhodobacter sphaeroides ATCC
          17025]
          Length = 89

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 30/90 (33%), Positives = 49/90 (54%), Gaps = 1/90 (1%)

Query: 1  MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
          M +    + +++  R WRRGT+EMDLILG + D  +  LS   L + +S++ E+D +L  
Sbjct: 1  MIEADEARLKRMSMRSWRRGTKEMDLILGPWSDAHLAHLSEERLALYDSLLNENDQDLLP 60

Query: 61 WFTGMEKPPEYLRTPIFKKIYDYYSNNLDR 90
          W  G  +PP  L   +  +I ++    L R
Sbjct: 61 WILGQREPPAPL-AALISEIGEFARTRLAR 89


>gi|259418444|ref|ZP_05742362.1| TPR repeat family protein [Silicibacter sp. TrichCH4B]
 gi|259345839|gb|EEW57683.1| TPR repeat family protein [Silicibacter sp. TrichCH4B]
          Length = 92

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 20/76 (26%), Positives = 43/76 (56%)

Query: 1  MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
          ++++  ++ +++  R  RRG +EMD++L  F    + E++  +L   + ++ E+D +L++
Sbjct: 8  LEESREIRIKRLTMRSMRRGIKEMDILLSGFAAANLAEMTDAQLGEYDHLLRENDQDLYQ 67

Query: 61 WFTGMEKPPEYLRTPI 76
          W TG    PE     I
Sbjct: 68 WVTGQAPAPERFNALI 83


>gi|118589911|ref|ZP_01547315.1| hypothetical protein SIAM614_14640 [Stappia aggregata IAM 12614]
 gi|118437408|gb|EAV44045.1| hypothetical protein SIAM614_14640 [Stappia aggregata IAM 12614]
          Length = 105

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 31/81 (38%), Positives = 49/81 (60%)

Query: 4  NMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFT 63
            + + +KI++RCW RG +EMDL+LG F D  I  LS  EL  LE ++   D +L+ W T
Sbjct: 15 ERDSRRKKILFRCWHRGMKEMDLLLGGFADAKIDSLSEEELRELEHLLTAHDQDLYAWMT 74

Query: 64 GMEKPPEYLRTPIFKKIYDYY 84
          G +  P+    P++++I  Y+
Sbjct: 75 GRKPLPQEWDGPLYRRIIAYH 95


>gi|328543942|ref|YP_004304051.1| TPR repeat region superfamily protein [polymorphum gilvum
          SL003B-26A1]
 gi|326413686|gb|ADZ70749.1| TPR repeat region superfamily protein [Polymorphum gilvum
          SL003B-26A1]
          Length = 100

 Score =  100 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%)

Query: 7  LQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGME 66
          ++ ++I++RCW RG +EMDL+LG F    I  L++ EL  LE +++ +D +LF W TG  
Sbjct: 18 VRRKRILFRCWHRGMKEMDLLLGGFAQAQIETLTTAELDELEDLLDINDQDLFSWMTGRT 77

Query: 67 KPPEYLRTPIFKKIYDYYSNN 87
            P     P++++I  ++++ 
Sbjct: 78 PVPAERDRPLYRRILAFHADK 98


>gi|42520893|ref|NP_966808.1| hypothetical protein WD1087 [Wolbachia endosymbiont of Drosophila
          melanogaster]
 gi|58698450|ref|ZP_00373359.1| AER200Cp [Wolbachia endosymbiont of Drosophila ananassae]
 gi|99036033|ref|ZP_01315071.1| hypothetical protein Wendoof_01000088 [Wolbachia endosymbiont of
          Drosophila willistoni TSC#14030-0811.24]
 gi|225630817|ref|YP_002727608.1| hypothetical protein WRi_011210 [Wolbachia sp. wRi]
 gi|225631213|ref|ZP_03787909.1| hypothetical protein WUni_003680 [Wolbachia endosymbiont of
          Muscidifurax uniraptor]
 gi|42410634|gb|AAS14742.1| conserved hypothetical protein [Wolbachia endosymbiont of
          Drosophila melanogaster]
 gi|58535042|gb|EAL59132.1| AER200Cp [Wolbachia endosymbiont of Drosophila ananassae]
 gi|225591093|gb|EEH12279.1| hypothetical protein WUni_003680 [Wolbachia endosymbiont of
          Muscidifurax uniraptor]
 gi|225592798|gb|ACN95817.1| hypothetical protein WRi_011210 [Wolbachia sp. wRi]
          Length = 92

 Score =  100 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 27/84 (32%), Positives = 43/84 (51%)

Query: 4  NMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFT 63
          + +L  RK++YR W RG +E D++LG F   ++ + S  EL   E I++ DD  L+ + T
Sbjct: 3  DTSLLRRKLIYRSWHRGCKETDILLGHFALKYLDKFSLSELIEYEKIVDLDDYELYCYIT 62

Query: 64 GMEKPPEYLRTPIFKKIYDYYSNN 87
               P  L + I   I  +   N
Sbjct: 63 RKTNLPPGLNSQIVNLIACFIEAN 86


>gi|73667474|ref|YP_303490.1| hypothetical protein Ecaj_0861 [Ehrlichia canis str. Jake]
 gi|72394615|gb|AAZ68892.1| protein of unknown function DUF339 [Ehrlichia canis str. Jake]
          Length = 93

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 26/80 (32%), Positives = 47/80 (58%)

Query: 3  KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
            +  + +K++YR   RG +EMD+ILG+F  ++I  LS  ++ + E I++ +D  L+K+ 
Sbjct: 2  DELLAKRKKLLYRSLHRGCKEMDIILGNFASYYIHLLSDEDINIYEKIVDTNDHQLYKYI 61

Query: 63 TGMEKPPEYLRTPIFKKIYD 82
          TG E  P+ L   + + I  
Sbjct: 62 TGEEFIPQDLDGNVMRSIIA 81


>gi|84515361|ref|ZP_01002723.1| TPR repeat family protein [Loktanella vestfoldensis SKA53]
 gi|84510644|gb|EAQ07099.1| TPR repeat family protein [Loktanella vestfoldensis SKA53]
          Length = 94

 Score =  100 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 21/82 (25%), Positives = 41/82 (50%), Gaps = 1/82 (1%)

Query: 1  MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
          M +      +++  R  RRG +EMDLIL +F    + ++   EL + ++++ E+D +L+ 
Sbjct: 2  MTETTEHTRKRLHMRSMRRGIKEMDLILPAFAAEHLADMDEAELALYDALLSENDHDLYG 61

Query: 61 WFTGMEKPPEYLRTPIFKKIYD 82
          W  G    P+     +  +I  
Sbjct: 62 WVGGQFAVPDVY-ADMISRIAA 82


>gi|94495556|ref|ZP_01302136.1| hypothetical protein SKA58_05890 [Sphingomonas sp. SKA58]
 gi|94424944|gb|EAT09965.1| hypothetical protein SKA58_05890 [Sphingomonas sp. SKA58]
          Length = 92

 Score =  100 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 22/80 (27%), Positives = 37/80 (46%)

Query: 1  MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
          M        R++ +R W RGTRE D  +G F D +    +  E+   E  +EE D+++  
Sbjct: 4  MTMTDTPHLRRMKFRAWHRGTRESDYTVGGFFDRYHATWNEEEIAWFERFMEEQDADIMG 63

Query: 61 WFTGMEKPPEYLRTPIFKKI 80
          W  G    P+  + P+  + 
Sbjct: 64 WAMGTIPVPDEWKGPMMDQF 83


>gi|254475964|ref|ZP_05089350.1| TPR repeat family protein [Ruegeria sp. R11]
 gi|214030207|gb|EEB71042.1| TPR repeat family protein [Ruegeria sp. R11]
          Length = 94

 Score =  100 bits (250), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 18/83 (21%), Positives = 45/83 (54%), Gaps = 1/83 (1%)

Query: 3  KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
          ++   + +++  R  RRG +EMD++L ++    +  +S  +L + ++++ E+D +L++W 
Sbjct: 13 ESRETRIKRLTMRSMRRGIKEMDILLSAYAAQKLAAMSDADLDLYDALLHENDQDLYQWV 72

Query: 63 TGMEKPPEYLRTPIFKKIYDYYS 85
          TG    P+   + +   I   + 
Sbjct: 73 TGQVAAPQGY-SVLIADIAQTHQ 94


>gi|302783166|ref|XP_002973356.1| hypothetical protein SELMODRAFT_98920 [Selaginella
          moellendorffii]
 gi|302789552|ref|XP_002976544.1| hypothetical protein SELMODRAFT_105340 [Selaginella
          moellendorffii]
 gi|300155582|gb|EFJ22213.1| hypothetical protein SELMODRAFT_105340 [Selaginella
          moellendorffii]
 gi|300159109|gb|EFJ25730.1| hypothetical protein SELMODRAFT_98920 [Selaginella
          moellendorffii]
          Length = 122

 Score =  100 bits (249), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 26/80 (32%), Positives = 45/80 (56%), Gaps = 1/80 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          +++YR  +RG  E+DL+LG +    I +L    L  L  +++ ++ +L+KW TG  + PE
Sbjct: 8  RLLYRSKQRGFLELDLVLGKWTQENIHQLDDKHLESLIQVLDLENPDLWKWLTGQAEVPE 67

Query: 71 YL-RTPIFKKIYDYYSNNLD 89
           +   P+F  I    S NL+
Sbjct: 68 SITANPVFACIQKQISGNLE 87


>gi|157803548|ref|YP_001492097.1| hypothetical protein A1E_01835 [Rickettsia canadensis str.
          McKiel]
 gi|157784811|gb|ABV73312.1| hypothetical protein A1E_01835 [Rickettsia canadensis str.
          McKiel]
          Length = 87

 Score = 99.7 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 25/80 (31%), Positives = 42/80 (52%)

Query: 2  KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
          K N N   +K++Y    RG +EMD ILGSF + ++  +   +L     I++++D++L+ W
Sbjct: 3  KLNKNSLQKKLLYLSKNRGCKEMDYILGSFTEKYLSLMDEKKLESYALILDQNDNDLYNW 62

Query: 62 FTGMEKPPEYLRTPIFKKIY 81
                 P YL   I  K+ 
Sbjct: 63 INNKSSAPSYLDIEIIDKLR 82


>gi|148255540|ref|YP_001240125.1| hypothetical protein BBta_4158 [Bradyrhizobium sp. BTAi1]
 gi|146407713|gb|ABQ36219.1| hypothetical protein BBta_4158 [Bradyrhizobium sp. BTAi1]
          Length = 95

 Score = 99.7 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 31/88 (35%), Positives = 49/88 (55%)

Query: 2  KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
           + ++ + +++++RCW RGTREMDLILG F D  I  LS  EL  LE ++E  D + +  
Sbjct: 8  SQGLDDRRKRLLFRCWHRGTREMDLILGRFADAEIGTLSEGELAELEQLLEVPDPDFYAA 67

Query: 62 FTGMEKPPEYLRTPIFKKIYDYYSNNLD 89
           TG    P      +F +I  + + + D
Sbjct: 68 VTGARPLPPEQTPALFARIKAFRAADAD 95


>gi|315122359|ref|YP_004062848.1| hypothetical protein CKC_03055 [Candidatus Liberibacter
          solanacearum CLso-ZC1]
 gi|313495761|gb|ADR52360.1| hypothetical protein CKC_03055 [Candidatus Liberibacter
          solanacearum CLso-ZC1]
          Length = 75

 Score = 99.3 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 60/75 (80%), Positives = 66/75 (88%)

Query: 24 MDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPEYLRTPIFKKIYDY 83
          MD ILGSFVD FIL+LS +EL MLESIIEEDDSNLFKWFTG+EK PE+L TPIFKKI DY
Sbjct: 1  MDFILGSFVDQFILDLSPIELDMLESIIEEDDSNLFKWFTGIEKVPEHLCTPIFKKICDY 60

Query: 84 YSNNLDRKNMLGSLQ 98
          YS NL+ KN+LGSLQ
Sbjct: 61 YSINLNHKNILGSLQ 75


>gi|254464263|ref|ZP_05077674.1| TPR repeat family protein [Rhodobacterales bacterium Y4I]
 gi|206685171|gb|EDZ45653.1| TPR repeat family protein [Rhodobacterales bacterium Y4I]
          Length = 85

 Score = 99.3 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 21/83 (25%), Positives = 48/83 (57%)

Query: 1  MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
          M+++  ++ +++  R  RRG +EMD++L +F    + ++ + +L + + ++ E+D +L++
Sbjct: 1  MQEDRTIRLKRLQMRSMRRGIKEMDILLSAFAAANLEQMDAAQLDLYDQLLHENDQDLYQ 60

Query: 61 WFTGMEKPPEYLRTPIFKKIYDY 83
          W TG  +P E  R  +      Y
Sbjct: 61 WVTGQAEPQERFRALVADIAQTY 83


>gi|157825986|ref|YP_001493706.1| hypothetical protein A1C_04680 [Rickettsia akari str. Hartford]
 gi|157799944|gb|ABV75198.1| hypothetical protein A1C_04680 [Rickettsia akari str. Hartford]
          Length = 87

 Score = 99.3 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 24/84 (28%), Positives = 41/84 (48%)

Query: 2  KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
          K N N   +K+ YR   R  +EMD ILGSF + ++  +   +L     I++++D++++ W
Sbjct: 3  KLNKNSLQKKLFYRSKNRSCKEMDYILGSFAEKYLSLMDEKKLECYTLILDQNDNDIYNW 62

Query: 62 FTGMEKPPEYLRTPIFKKIYDYYS 85
                 P YL   I  K+     
Sbjct: 63 INNESSAPSYLDAEIMDKLRKIAR 86


>gi|254293941|ref|YP_003059964.1| hypothetical protein Hbal_1579 [Hirschia baltica ATCC 49814]
 gi|254042472|gb|ACT59267.1| protein of unknown function DUF339 [Hirschia baltica ATCC 49814]
          Length = 91

 Score = 99.3 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 21/79 (26%), Positives = 44/79 (55%)

Query: 5  MNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTG 64
          M+ + RK+++R   RG +EMD+++G F    + ++    L   E +++ DD +++ W  G
Sbjct: 1  MDARRRKLLFRANHRGFKEMDMMMGEFAGKHLDQMDEKALDEFERLLDTDDQDVYGWIIG 60

Query: 65 MEKPPEYLRTPIFKKIYDY 83
           E+ PE L+  +   +  +
Sbjct: 61 REQEPEMLQGKVMDMLKAF 79


>gi|163737398|ref|ZP_02144815.1| TPR repeat family protein [Phaeobacter gallaeciensis BS107]
 gi|163740932|ref|ZP_02148325.1| TPR repeat family protein [Phaeobacter gallaeciensis 2.10]
 gi|161385923|gb|EDQ10299.1| TPR repeat family protein [Phaeobacter gallaeciensis 2.10]
 gi|161388924|gb|EDQ13276.1| TPR repeat family protein [Phaeobacter gallaeciensis BS107]
          Length = 86

 Score = 98.9 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 19/76 (25%), Positives = 41/76 (53%)

Query: 1  MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
          M +    + +++  R  RRG +EMD++L ++ D  +  +   EL + + +++E+D +L++
Sbjct: 1  MSELPAHRLKRLQMRSMRRGIKEMDILLSAYADRNLAVMGPAELDLYDRLLQENDQDLYQ 60

Query: 61 WFTGMEKPPEYLRTPI 76
          W TG    P      +
Sbjct: 61 WVTGQVAAPAQFAALV 76


>gi|157826878|ref|YP_001495942.1| TPR repeat-containing protein [Rickettsia bellii OSU 85-389]
 gi|157802182|gb|ABV78905.1| Tetratricopeptide repeat-containing protein [Rickettsia bellii
          OSU 85-389]
          Length = 87

 Score = 98.9 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 24/80 (30%), Positives = 42/80 (52%)

Query: 2  KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
          K N N   +K+ YR   RG +EMD ILG+F   ++  ++  +L     I+ ++D++L+ W
Sbjct: 3  KLNKNSLQKKLFYRSKNRGCKEMDYILGNFASLYLPFMAEEKLLSYALILYQNDNDLYNW 62

Query: 62 FTGMEKPPEYLRTPIFKKIY 81
           T     P  L   I +++ 
Sbjct: 63 ITNKSSVPSNLDAEIMEQLR 82


>gi|68171454|ref|ZP_00544842.1| Protein of unknown function DUF339 [Ehrlichia chaffeensis str.
          Sapulpa]
 gi|88657579|ref|YP_507854.1| TPR repeat-containing protein [Ehrlichia chaffeensis str.
          Arkansas]
 gi|67999135|gb|EAM85797.1| Protein of unknown function DUF339 [Ehrlichia chaffeensis str.
          Sapulpa]
 gi|88599036|gb|ABD44505.1| TPR repeat protein [Ehrlichia chaffeensis str. Arkansas]
          Length = 98

 Score = 98.9 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 30/79 (37%), Positives = 46/79 (58%)

Query: 3  KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
            + ++ ++++YR   RG +EMD+ILG+F  H I  LSS ++   E I+   D  L+K+ 
Sbjct: 7  DELLVKRKRLLYRSLHRGCKEMDIILGNFALHCIHLLSSKDVDEYEKIVNTSDYQLYKYI 66

Query: 63 TGMEKPPEYLRTPIFKKIY 81
          TG E  P+YL   I K I 
Sbjct: 67 TGEELIPQYLDNNIMKDII 85


>gi|126735191|ref|ZP_01750937.1| TPR repeat family protein [Roseobacter sp. CCS2]
 gi|126715746|gb|EBA12611.1| TPR repeat family protein [Roseobacter sp. CCS2]
          Length = 90

 Score = 98.6 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 20/72 (27%), Positives = 37/72 (51%)

Query: 1  MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
          M +  +   +++  R  RRG +EMDLIL +F D  +   S  +L + + ++ E+D +++ 
Sbjct: 1  MTERRDTMIKRLRMRSMRRGIKEMDLILQAFADAHLDAFSDEDLVLYDQLLSENDHDIYG 60

Query: 61 WFTGMEKPPEYL 72
          W  G    P   
Sbjct: 61 WVGGQFPTPAQY 72


>gi|86137417|ref|ZP_01055994.1| TPR repeat family protein [Roseobacter sp. MED193]
 gi|85825752|gb|EAQ45950.1| TPR repeat family protein [Roseobacter sp. MED193]
          Length = 89

 Score = 98.6 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 18/80 (22%), Positives = 45/80 (56%), Gaps = 1/80 (1%)

Query: 8  QCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEK 67
          + +++  R  RRG +EMD++L ++ D  +  + + +L + + ++ E+D +L++W TG   
Sbjct: 11 RLKRLKMRSMRRGIKEMDILLTAYADANLPAMDAAKLDLYDQLLHENDQDLYQWVTGQVA 70

Query: 68 PPEYLRTPIFKKIYDYYSNN 87
           P    + + +++   + N 
Sbjct: 71 TPSPYES-LIEEVAQTHQNK 89


>gi|320167736|gb|EFW44635.1| DUF339 family protein [Capsaspora owczarzaki ATCC 30864]
          Length = 216

 Score = 98.6 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 17/87 (19%), Positives = 39/87 (44%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
           +   ++  +++Y+  +RG  E DL+L +F       LS  +L   + ++++ D +++ W 
Sbjct: 116 ETRQVKIARLLYQTRKRGILENDLLLSTFFAEHANALSDAQLQTFDKLLDQIDWDIYYWI 175

Query: 63  TGMEKPPEYLRTPIFKKIYDYYSNNLD 89
           T     P    T +   I  +     +
Sbjct: 176 TKARPVPPEFDTDVMALIQAHTLARRN 202


>gi|299744835|ref|XP_002910843.1| mitochondrial protein [Coprinopsis cinerea okayama7#130]
 gi|298406310|gb|EFI27349.1| mitochondrial protein [Coprinopsis cinerea okayama7#130]
          Length = 156

 Score = 98.2 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 23/87 (26%), Positives = 48/87 (55%), Gaps = 1/87 (1%)

Query: 2   KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
            ++ +    ++VY+  +RGT E DL+L +F    + ++S  EL   + +++E D +++ W
Sbjct: 59  NESESSLRARLVYQSRKRGTLETDLLLSTFAQENLAKMSVPELKEFDKLLDEPDWDIYYW 118

Query: 62  FTGMEKPPEYL-RTPIFKKIYDYYSNN 87
            TG   PPE   ++ + +K+  +  N 
Sbjct: 119 CTGKRTPPERWAKSELLEKLRVHAQNE 145


>gi|326403947|ref|YP_004284029.1| hypothetical protein ACMV_18000 [Acidiphilium multivorum AIU301]
 gi|325050809|dbj|BAJ81147.1| hypothetical protein ACMV_18000 [Acidiphilium multivorum AIU301]
          Length = 102

 Score = 98.2 bits (244), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 24/81 (29%), Positives = 43/81 (53%)

Query: 2  KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
           + +  + R+++YR   RGT E DL++G F   +I  +    L  LE+++E  D+ L  W
Sbjct: 6  SEALIQRRRRLLYRATHRGTYENDLMIGGFARKYIDGMDDEALDALEAVMEHPDAELADW 65

Query: 62 FTGMEKPPEYLRTPIFKKIYD 82
           TG +  P    + + ++I D
Sbjct: 66 LTGRKPVPAEAESDMLRRIRD 86


>gi|40063588|gb|AAR38377.1| conserved hypothetical protein [uncultured marine bacterium 582]
          Length = 87

 Score = 97.4 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 21/82 (25%), Positives = 46/82 (56%), Gaps = 1/82 (1%)

Query: 1  MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
          M + +  + +++  R  RRG +EMDLIL +F +  + +++  +L + ++++ E+D +L++
Sbjct: 1  MGELLEHRVKRLKMRSMRRGIKEMDLILSAFANSHLEKMTEADLILYDAMLSENDHDLYQ 60

Query: 61 WFTGMEKPPEYLRTPIFKKIYD 82
          W TG    PE     +   +  
Sbjct: 61 WVTGQIAAPERF-AAMIAMVAT 81


>gi|103487137|ref|YP_616698.1| hypothetical protein Sala_1652 [Sphingopyxis alaskensis RB2256]
 gi|98977214|gb|ABF53365.1| protein of unknown function DUF339 [Sphingopyxis alaskensis
          RB2256]
          Length = 86

 Score = 97.4 bits (242), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 25/78 (32%), Positives = 41/78 (52%), Gaps = 1/78 (1%)

Query: 5  MNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTG 64
          M  + +++ +R W RGTRE D ++G F D +       EL   E+++EEDD ++  W  G
Sbjct: 1  MTDRLKRLKFRAWHRGTREADYMIGGFFDRYSPAWGETELAWFEAVVEEDDVDIMAWALG 60

Query: 65 MEKPPEYLRTP-IFKKIY 81
             PP +L  P +   + 
Sbjct: 61 TAAPPAHLDKPDLIAAMR 78


>gi|326387813|ref|ZP_08209419.1| hypothetical protein Y88_0727 [Novosphingobium nitrogenifigens
          DSM 19370]
 gi|326207859|gb|EGD58670.1| hypothetical protein Y88_0727 [Novosphingobium nitrogenifigens
          DSM 19370]
          Length = 88

 Score = 97.0 bits (241), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 21/78 (26%), Positives = 35/78 (44%)

Query: 4  NMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFT 63
              + R++ +R W RGTRE D ++G F D    E     +   E +++EDD ++  W  
Sbjct: 2  EKEDRLRRLKFRAWHRGTREADYMIGCFFDRHHTEWDEASIAWYERLMDEDDVDIMGWAL 61

Query: 64 GMEKPPEYLRTPIFKKIY 81
          G    P     P+   + 
Sbjct: 62 GTIPIPADYAGPMMDAMA 79


>gi|261328771|emb|CBH11749.1| hypothetical protein, conserved [Trypanosoma brucei gambiense
           DAL972]
          Length = 146

 Score = 96.6 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 22/89 (24%), Positives = 51/89 (57%), Gaps = 1/89 (1%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
           ++   + R+++Y+   RG  EMD+ILG+F    I  LS+ +L   ++++   D++L+KW 
Sbjct: 52  ESNEAKRRRLLYQSTYRGMVEMDIILGAFARQNIETLSAPQLEEYDAVLRHFDNDLYKWL 111

Query: 63  TGMEKPPEYL-RTPIFKKIYDYYSNNLDR 90
               + P  + + P+F+ ++ +  +  ++
Sbjct: 112 VMDVEAPAEVAQIPVFQSLHSFVRDEREK 140


>gi|190571426|ref|YP_001975784.1| hypothetical protein WPa_1039 [Wolbachia endosymbiont of Culex
          quinquefasciatus Pel]
 gi|190357698|emb|CAQ55147.1| Hypothetical protein WP1039 [Wolbachia endosymbiont of Culex
          quinquefasciatus Pel]
          Length = 90

 Score = 96.6 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 25/80 (31%), Positives = 43/80 (53%)

Query: 4  NMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFT 63
          +++L  RK++YR W RG +E D++LG F   ++ + S  EL   E I++ DD  L+ + T
Sbjct: 5  DISLLRRKLMYRSWHRGCKETDILLGHFALKYLDKFSLSELIEYEKIVDLDDCELYCYIT 64

Query: 64 GMEKPPEYLRTPIFKKIYDY 83
               P  L + +   I  +
Sbjct: 65 RKRLLPPDLSSEVVDLIASF 84


>gi|87199998|ref|YP_497255.1| hypothetical protein Saro_1981 [Novosphingobium aromaticivorans
          DSM 12444]
 gi|87135679|gb|ABD26421.1| protein of unknown function DUF339 [Novosphingobium
          aromaticivorans DSM 12444]
          Length = 93

 Score = 96.2 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 24/73 (32%), Positives = 37/73 (50%)

Query: 9  CRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKP 68
           R++ +R W RGTRE D ++G F D +    S+ ++   E +IEEDD  +  W  G E  
Sbjct: 12 LRRLHFRAWHRGTREADYMIGCFFDRYHASWSAADVAWFEELIEEDDVEIMAWALGTEAV 71

Query: 69 PEYLRTPIFKKIY 81
          PE     +   + 
Sbjct: 72 PEKYAGALMDAMR 84


>gi|300121586|emb|CBK22104.2| unnamed protein product [Blastocystis hominis]
          Length = 174

 Score = 96.2 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 21/82 (25%), Positives = 42/82 (51%)

Query: 6   NLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGM 65
           +   +++++R  +RG  E+DL+LG +    I  LS  EL   E+++  +  ++F W T  
Sbjct: 74  DALRKRLLHRSRQRGMLEVDLLLGKWAQLNINRLSRQELDQYEALLNSETVDIFSWITDK 133

Query: 66  EKPPEYLRTPIFKKIYDYYSNN 87
              P  +  PI ++I  +  + 
Sbjct: 134 SPLPPEMDLPIVREIQQWVKSK 155


>gi|163745990|ref|ZP_02153349.1| hypothetical protein OIHEL45_10398 [Oceanibulbus indolifex
          HEL-45]
 gi|161380735|gb|EDQ05145.1| hypothetical protein OIHEL45_10398 [Oceanibulbus indolifex
          HEL-45]
          Length = 88

 Score = 96.2 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 20/73 (27%), Positives = 41/73 (56%)

Query: 1  MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
          M +    + +++  R  RRG +EMDLIL ++ +  + ++    LT+ + ++ E+D +L+ 
Sbjct: 1  MPEVHEHRLKRLQMRSMRRGIKEMDLILSAYAEARLPQMDDAGLTLYDQMLNENDHDLYL 60

Query: 61 WFTGMEKPPEYLR 73
          W +G  + PE   
Sbjct: 61 WVSGQTEAPEKYS 73


>gi|126740656|ref|ZP_01756342.1| TPR repeat family protein [Roseobacter sp. SK209-2-6]
 gi|126718171|gb|EBA14887.1| TPR repeat family protein [Roseobacter sp. SK209-2-6]
          Length = 84

 Score = 95.9 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 22/85 (25%), Positives = 47/85 (55%), Gaps = 1/85 (1%)

Query: 1  MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
          M +    Q +++  R  RRG +EMD++L ++ D  +  + S +L + + ++ E+D +L++
Sbjct: 1  MTETRENQIKRLKMRSMRRGIKEMDILLSAYADANLEAMESDKLELYDQLLHENDQDLYQ 60

Query: 61 WFTGMEKPPEYLRTPIFKKIYDYYS 85
          W TG    P  L + +  +I + + 
Sbjct: 61 WVTGQIPAP-GLYSKLLSEIAETHQ 84


>gi|83593062|ref|YP_426814.1| hypothetical protein Rru_A1727 [Rhodospirillum rubrum ATCC 11170]
 gi|83575976|gb|ABC22527.1| Protein of unknown function DUF339 [Rhodospirillum rubrum ATCC
          11170]
          Length = 88

 Score = 95.9 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 18/82 (21%), Positives = 42/82 (51%)

Query: 5  MNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTG 64
          +  + ++ +YR   RG +E D+ +G+F    +  ++  +    E+++EE D+++  W  G
Sbjct: 6  LPPRRKRTLYRAQHRGMKEADIFIGAFAVDRLETMTDDQHDRFEALLEEHDADIMDWIMG 65

Query: 65 MEKPPEYLRTPIFKKIYDYYSN 86
            +PP   RT +   +  +  +
Sbjct: 66 RAEPPVAYRTDVMDMLRTFKLH 87


>gi|323507544|emb|CBQ67415.1| related to EMI5-protein required for transcriptional induction of
           TF IME1 [Sporisorium reilianum]
          Length = 235

 Score = 95.9 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 22/72 (30%), Positives = 38/72 (52%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
           +  N +  ++VY+C +RGT E DL+L +F    +  L   EL   + +++E D ++F W 
Sbjct: 135 EERNTKIARLVYQCRKRGTLETDLLLSTFAKKELKNLPDAELDEFDRLLDEPDWDIFYWC 194

Query: 63  TGMEKPPEYLRT 74
           T  +  PE    
Sbjct: 195 TQRKPIPERWHA 206


>gi|294083796|ref|YP_003550553.1| hypothetical protein SAR116_0226 [Candidatus Puniceispirillum
          marinum IMCC1322]
 gi|292663368|gb|ADE38469.1| protein of unknown function DUF339 [Candidatus Puniceispirillum
          marinum IMCC1322]
          Length = 87

 Score = 95.9 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 20/84 (23%), Positives = 43/84 (51%)

Query: 2  KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
           + ++ + R+++Y+    G +E DL+LG F    + +L+  EL   E++++  D  ++ W
Sbjct: 3  SEKLSNRARRLIYQASYTGMKETDLLLGHFAKVHLPDLNDNELDDFEALLKVGDPIIYAW 62

Query: 62 FTGMEKPPEYLRTPIFKKIYDYYS 85
              E  P +  T +F+ I  +  
Sbjct: 63 VMEKEPVPMHYNTRVFQLIKKFKK 86


>gi|79330527|ref|NP_001032052.1| unknown protein [Arabidopsis thaliana]
 gi|222423776|dbj|BAH19854.1| AT5G51040 [Arabidopsis thaliana]
 gi|332008642|gb|AED96025.1| uncharacterized protein [Arabidopsis thaliana]
          Length = 184

 Score = 95.9 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 23/83 (27%), Positives = 48/83 (57%), Gaps = 1/83 (1%)

Query: 9   CRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKP 68
            R+ + R  +RG  E+DL+LG++V+  +  +    +  L  ++  ++ +L+KW T  E+P
Sbjct: 69  KRRTINRSKQRGFLELDLVLGNWVEENVNSMDENGVKSLIHVLNLENPDLWKWLTEQEQP 128

Query: 69  PEYL-RTPIFKKIYDYYSNNLDR 90
           PE +   P+F  +++    NL++
Sbjct: 129 PEAVSSNPVFSALHEKVMKNLNK 151


>gi|72390155|ref|XP_845372.1| hypothetical protein [Trypanosoma brucei TREU927]
 gi|62360469|gb|AAX80883.1| hypothetical protein, conserved [Trypanosoma brucei]
 gi|70801907|gb|AAZ11813.1| hypothetical protein, conserved [Trypanosoma brucei brucei strain
           927/4 GUTat10.1]
          Length = 146

 Score = 95.9 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 22/89 (24%), Positives = 51/89 (57%), Gaps = 1/89 (1%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
           ++   + R+++Y+   RG  EMD+ILG+F    I  LS+ +L   ++++   D++L+KW 
Sbjct: 52  ESNEAKRRRLLYQSTYRGMVEMDIILGAFARQNIETLSAPQLEEYDAVLRHFDNDLYKWL 111

Query: 63  TGMEKPPEYL-RTPIFKKIYDYYSNNLDR 90
               + P  + + P+F+ ++ +  +  ++
Sbjct: 112 VMDVEAPAEVAQIPVFQSLHSFVRDEREK 140


>gi|329113370|ref|ZP_08242151.1| Hypothetical protein APO_0135 [Acetobacter pomorum DM001]
 gi|326697195|gb|EGE48855.1| Hypothetical protein APO_0135 [Acetobacter pomorum DM001]
          Length = 108

 Score = 95.5 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 25/81 (30%), Positives = 46/81 (56%)

Query: 2   KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
           + N+  + R++ +R   RGT E D+++G FV+     +++ ELT +E+I+E  D  L  W
Sbjct: 20  EDNLAARRRRLKFRANHRGTFETDILIGGFVEANADTMTAEELTDMENILEMPDPELTDW 79

Query: 62  FTGMEKPPEYLRTPIFKKIYD 82
             G    PE   TP+ +++ +
Sbjct: 80  LFGRLPLPEEKATPMLRRMVE 100


>gi|254488001|ref|ZP_05101206.1| TPR repeat family protein [Roseobacter sp. GAI101]
 gi|214044870|gb|EEB85508.1| TPR repeat family protein [Roseobacter sp. GAI101]
          Length = 88

 Score = 95.5 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 21/83 (25%), Positives = 43/83 (51%), Gaps = 1/83 (1%)

Query: 1  MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
          M +    + +++  R  RRG +EMDLIL S+    +  +    L++ + ++ E+D +L++
Sbjct: 1  MTELHEHKVKRLHMRSMRRGIKEMDLILPSYAATCLAVMDDAALSLYDLMLSENDHDLYQ 60

Query: 61 WFTGMEKPPEYLRTPIFKKIYDY 83
          W TG +  P+     +   I  +
Sbjct: 61 WVTGQKSAPDEY-AALIGDIQTH 82


>gi|242011721|ref|XP_002426595.1| early meiotic induction protein 5, putative [Pediculus humanus
           corporis]
 gi|212510744|gb|EEB13857.1| early meiotic induction protein 5, putative [Pediculus humanus
           corporis]
          Length = 151

 Score = 95.5 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 17/87 (19%), Positives = 45/87 (51%), Gaps = 2/87 (2%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEE--DDSNLFK 60
           + +  +  +++Y+  +RG  E DL+L +F    + +++  +L++ + +I    +D +++ 
Sbjct: 50  EPLEQKRARLMYQSRKRGMLENDLVLSTFAAEHLHKMTENQLSLYDRLINLPSNDWDIYY 109

Query: 61  WFTGMEKPPEYLRTPIFKKIYDYYSNN 87
           W TG +  PE     +   + ++  N 
Sbjct: 110 WATGGKPTPEEFNNEVMNMLKEHIKNK 136


>gi|46202165|ref|ZP_00053647.2| COG2938: Uncharacterized conserved protein [Magnetospirillum
          magnetotacticum MS-1]
          Length = 88

 Score = 95.5 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 20/82 (24%), Positives = 43/82 (52%)

Query: 8  QCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEK 67
          + +++++R    G+ E D++ G F   +++ LS  +    E++I E+DS+LF W T   +
Sbjct: 5  RLKRLMFRAHHMGSNENDILFGGFAAKYLMSLSPDQAERFEALIAENDSDLFNWVTSKAE 64

Query: 68 PPEYLRTPIFKKIYDYYSNNLD 89
           P++L   +   I  +  +   
Sbjct: 65 VPDHLDHDVMAMIKKFVQSEAA 86


>gi|50290339|ref|XP_447601.1| hypothetical protein [Candida glabrata CBS 138]
 gi|74609509|sp|Q6FQ93|SDHF2_CANGA RecName: Full=Succinate dehydrogenase assembly factor 2,
           mitochondrial; Short=SDH assembly factor 2; AltName:
           Full=Early meiotic induction protein 5; AltName:
           Full=Succinate dehydrogenase subunit 5, mitochondrial;
           Flags: Precursor
 gi|49526911|emb|CAG60538.1| unnamed protein product [Candida glabrata]
          Length = 153

 Score = 95.1 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 21/94 (22%), Positives = 48/94 (51%), Gaps = 4/94 (4%)

Query: 1   MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
           + ++++ +  +++Y+  +RG  E DL+L  F    +  +++ EL   ++++ E D +++ 
Sbjct: 50  INESIDKKRARLIYQSRKRGILETDLLLSGFAAKHLRSMTNEELDEYDALLNELDWDIYY 109

Query: 61  WFT---GMEKPPEYL-RTPIFKKIYDYYSNNLDR 90
           W T        PE    + I KK+ D+  N   +
Sbjct: 110 WVTKNYKTSPVPERWKNSEILKKLQDFSENKEKK 143


>gi|167999718|ref|XP_001752564.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162696464|gb|EDQ82803.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 134

 Score = 95.1 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 25/80 (31%), Positives = 41/80 (51%), Gaps = 1/80 (1%)

Query: 11  KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
           +I+YR  +RG  E+DL+LG + +  I  L    L  L  ++E ++ +L+ W TG  + P 
Sbjct: 22  RILYRSRQRGYLELDLLLGKWAEDNINNLDENRLQELVDLLEGENPDLWNWLTGQAEVPA 81

Query: 71  YL-RTPIFKKIYDYYSNNLD 89
            L    +F  I    + NL 
Sbjct: 82  ALAENSVFAAIKGQIAENLS 101


>gi|310815668|ref|YP_003963632.1| TPR repeat family protein [Ketogulonicigenium vulgare Y25]
 gi|308754403|gb|ADO42332.1| TPR repeat family protein [Ketogulonicigenium vulgare Y25]
          Length = 89

 Score = 95.1 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 22/81 (27%), Positives = 45/81 (55%), Gaps = 1/81 (1%)

Query: 6  NLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGM 65
          +L+ R++  R  RRG +EMDL+LG F    + +L+  +L + E++++E+D ++  W TG 
Sbjct: 4  DLRLRRLHMRAIRRGIKEMDLLLGHFAAARLADLAPADLDLFEALLDENDHDIHAWATGA 63

Query: 66 EKPPEYLRTPIFKKIYDYYSN 86
             P      +  ++  + + 
Sbjct: 64 LPVPGAYAG-LIAQLLAHAAA 83


>gi|149186683|ref|ZP_01864994.1| hypothetical protein ED21_29331 [Erythrobacter sp. SD-21]
 gi|148829591|gb|EDL48031.1| hypothetical protein ED21_29331 [Erythrobacter sp. SD-21]
          Length = 92

 Score = 95.1 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 22/83 (26%), Positives = 42/83 (50%), Gaps = 2/83 (2%)

Query: 1  MKKNMNL--QCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNL 58
          M + +    +  +  +R W RGTRE D ++G F D +  +  + EL   E+++EEDD ++
Sbjct: 1  MPEMLTTEGRLARAKFRSWHRGTREADYMIGGFFDRYHADWGAEELAWFEALLEEDDVDI 60

Query: 59 FKWFTGMEKPPEYLRTPIFKKIY 81
            W    +  P   +  + +K+ 
Sbjct: 61 MAWALKTQPTPPRFQGELIEKMQ 83


>gi|258542201|ref|YP_003187634.1| hypothetical protein APA01_11050 [Acetobacter pasteurianus IFO
           3283-01]
 gi|256633279|dbj|BAH99254.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-01]
 gi|256636338|dbj|BAI02307.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-03]
 gi|256639391|dbj|BAI05353.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-07]
 gi|256642447|dbj|BAI08402.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-22]
 gi|256645502|dbj|BAI11450.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-26]
 gi|256648555|dbj|BAI14496.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-32]
 gi|256651608|dbj|BAI17542.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256654599|dbj|BAI20526.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-12]
          Length = 109

 Score = 95.1 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 25/81 (30%), Positives = 46/81 (56%)

Query: 2   KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
           + N+  + R++ +R   RGT E D+++G FV+     +++ ELT +E+I+E  D  L  W
Sbjct: 21  EDNLAARRRRLKFRANHRGTFETDILIGGFVEANADTMTAEELTDMENILEMPDPELTDW 80

Query: 62  FTGMEKPPEYLRTPIFKKIYD 82
             G    PE   TP+ +++ +
Sbjct: 81  LFGRLPLPEEKATPMLRRMVE 101


>gi|260785960|ref|XP_002588027.1| hypothetical protein BRAFLDRAFT_83004 [Branchiostoma floridae]
 gi|229273184|gb|EEN44038.1| hypothetical protein BRAFLDRAFT_83004 [Branchiostoma floridae]
          Length = 150

 Score = 94.7 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 17/88 (19%), Positives = 41/88 (46%), Gaps = 2/88 (2%)

Query: 2   KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEE--DDSNLF 59
            +    +  +++Y+  +RG  E  L+  +F D ++ +    +L + + +I E  +D  ++
Sbjct: 49  NEPFETRRARLLYQSRKRGMLENGLLFSTFADRYLNKFDEQQLKLYDRLINEPSNDWEIY 108

Query: 60  KWFTGMEKPPEYLRTPIFKKIYDYYSNN 87
            W TG++  PE     +   +  +  N 
Sbjct: 109 YWVTGVKPTPEEYNNEVMDMLKQHAQNK 136


>gi|218506538|ref|ZP_03504416.1| hypothetical protein RetlB5_02499 [Rhizobium etli Brasil 5]
          Length = 84

 Score = 94.7 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 25/67 (37%), Positives = 37/67 (55%), Gaps = 3/67 (4%)

Query: 2  KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
             ++ + R+I++RCW RG REMDL+ G F +  I  LS  EL   E+I+ E    +  W
Sbjct: 8  SAGLDPRRRRILFRCWHRGIREMDLVFGQFAEAEIATLSDAELDEFETIMAE---RIMTW 64

Query: 62 FTGMEKP 68
            G  +P
Sbjct: 65 SAGSWEP 71


>gi|260826512|ref|XP_002608209.1| hypothetical protein BRAFLDRAFT_90350 [Branchiostoma floridae]
 gi|229293560|gb|EEN64219.1| hypothetical protein BRAFLDRAFT_90350 [Branchiostoma floridae]
          Length = 150

 Score = 94.3 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 17/88 (19%), Positives = 41/88 (46%), Gaps = 2/88 (2%)

Query: 2   KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEE--DDSNLF 59
            +    +  +++Y+  +RG  E  L+  +F D ++ +    +L + + +I E  +D  ++
Sbjct: 49  NEPFETRRARLLYQSRKRGMLENGLLFSTFADRYLNKFDEQQLKLYDRLINEPSNDWEIY 108

Query: 60  KWFTGMEKPPEYLRTPIFKKIYDYYSNN 87
            W TG++  PE     +   +  +  N 
Sbjct: 109 YWVTGVKPTPEEYNNEVMDMLKQHAQNK 136


>gi|254578394|ref|XP_002495183.1| ZYRO0B05324p [Zygosaccharomyces rouxii]
 gi|238938073|emb|CAR26250.1| ZYRO0B05324p [Zygosaccharomyces rouxii]
          Length = 158

 Score = 94.3 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 22/90 (24%), Positives = 47/90 (52%), Gaps = 4/90 (4%)

Query: 2   KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
            + ++ +  +++Y+  +RG  E DL+LG F   ++ E++  +L   +S+++E D +++ W
Sbjct: 55  NEPLDRKRARLIYQSRKRGILETDLLLGGFAAKYLKEMTPEQLAEYDSLLDELDWDIYYW 114

Query: 62  FT---GMEKPPEYL-RTPIFKKIYDYYSNN 87
            T        PE    + + KK+  Y  N 
Sbjct: 115 ATKNYETSPIPEKWKNSELMKKLQVYAENK 144


>gi|116791666|gb|ABK26064.1| unknown [Picea sitchensis]
          Length = 190

 Score = 94.3 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 22/82 (26%), Positives = 44/82 (53%), Gaps = 1/82 (1%)

Query: 9   CRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKP 68
             +++YR  +RG  E+DL+LG +V+  I  L    +  L  ++  ++ +L+KW +  E  
Sbjct: 76  LNRLLYRSKQRGLLELDLVLGKWVEENIQSLDETHIKALVEVLNLENPDLWKWLSAQEPA 135

Query: 69  PEY-LRTPIFKKIYDYYSNNLD 89
           PE   + P+F  +++     L+
Sbjct: 136 PEAVFKNPVFSALHEKVLKKLN 157


>gi|195120854|ref|XP_002004936.1| GI20197 [Drosophila mojavensis]
 gi|257096750|sp|B4KN44|SDF2A_DROMO RecName: Full=Succinate dehydrogenase assembly factor 2-A,
           mitochondrial; Short=SDH assembly factor 2-A; AltName:
           Full=Succinate dehydrogenase subunit 5-A, mitochondrial;
           Flags: Precursor
 gi|193910004|gb|EDW08871.1| GI20197 [Drosophila mojavensis]
          Length = 157

 Score = 94.3 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 18/93 (19%), Positives = 45/93 (48%), Gaps = 2/93 (2%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIE--EDDSNLFK 60
           + +  + ++++Y+  +RG  E DL+L +FV  ++ +  + E    + +I    +D +++ 
Sbjct: 60  EPLETRKQRLLYQSRKRGMLENDLLLSTFVAKYLKDFDAEETAQYDQLINGVSNDWDIYY 119

Query: 61  WFTGMEKPPEYLRTPIFKKIYDYYSNNLDRKNM 93
           W T  +  P    T + K +  +  N    + +
Sbjct: 120 WATNTKPTPPEYDTDVMKLLKQHVKNTERVQRI 152


>gi|296415391|ref|XP_002837373.1| hypothetical protein [Tuber melanosporum Mel28]
 gi|295633238|emb|CAZ81564.1| unnamed protein product [Tuber melanosporum]
          Length = 305

 Score = 93.9 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 15/68 (22%), Positives = 37/68 (54%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
           + ++ +  +++Y+  +RG  E DL+L +F D  + ++   +L   +  ++E+D +++ W 
Sbjct: 147 EGLSTKRARLLYQSRKRGILETDLLLSTFADENLGKMGMEQLDAYDRFLDENDWDIYYWA 206

Query: 63  TGMEKPPE 70
           T     P 
Sbjct: 207 TQTPPAPA 214


>gi|130508258|ref|NP_001076333.1| succinate dehydrogenase assembly factor 2, mitochondrial precursor
           [Danio rerio]
 gi|152032432|sp|A3KP74|SDHF2_DANRE RecName: Full=Succinate dehydrogenase assembly factor 2,
           mitochondrial; Short=SDH assembly factor 2; AltName:
           Full=Succinate dehydrogenase subunit 5, mitochondrial;
           Flags: Precursor
 gi|126631669|gb|AAI34191.1| Zgc:163000 protein [Danio rerio]
          Length = 158

 Score = 93.9 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 16/87 (18%), Positives = 44/87 (50%), Gaps = 2/87 (2%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEE--DDSNLFK 60
           + ++++ ++++Y   +RG  E  ++L  F   ++  +S  +L   + +I E  +D +++ 
Sbjct: 54  EALDIKRKRLLYESRKRGMLENCILLSLFAKQYLNTMSESQLKQYDRLINEPSNDWDIYY 113

Query: 61  WFTGMEKPPEYLRTPIFKKIYDYYSNN 87
           W T  +  PE  +  +   + ++  N 
Sbjct: 114 WATDTQPTPEVYQGEVMDMLKEFTKNR 140


>gi|332008643|gb|AED96026.1| uncharacterized protein [Arabidopsis thaliana]
          Length = 197

 Score = 93.9 bits (233), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 24/99 (24%), Positives = 52/99 (52%), Gaps = 10/99 (10%)

Query: 2   KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIE--------- 52
           ++N      +++YR  +RG  E+DL+LG++V+  +  +    +  L  ++          
Sbjct: 66  EENKRRTINRLLYRSKQRGFLELDLVLGNWVEENVNSMDENGVKSLIHVLNLVESEATKL 125

Query: 53  EDDSNLFKWFTGMEKPPEYL-RTPIFKKIYDYYSNNLDR 90
            ++ +L+KW T  E+PPE +   P+F  +++    NL++
Sbjct: 126 LENPDLWKWLTEQEQPPEAVSSNPVFSALHEKVMKNLNK 164


>gi|156846808|ref|XP_001646290.1| hypothetical protein Kpol_1032p25 [Vanderwaltozyma polyspora DSM
           70294]
 gi|156116965|gb|EDO18432.1| hypothetical protein Kpol_1032p25 [Vanderwaltozyma polyspora DSM
           70294]
          Length = 201

 Score = 93.9 bits (233), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 20/91 (21%), Positives = 46/91 (50%), Gaps = 4/91 (4%)

Query: 2   KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
            + ++ +  +++Y+  +RG  E DL+L  F   ++ E++  EL   ++++ E D +++ W
Sbjct: 98  NEPLDKKRARLIYQSRKRGILETDLLLSGFAAKYLKEMTPEELDEYDNLLNELDWDIYYW 157

Query: 62  FTG---MEKPPEYL-RTPIFKKIYDYYSNNL 88
            T        P+    + I KK+ ++  N  
Sbjct: 158 ATKNYDTTPLPDKWKDSKILKKLQEFSENKE 188


>gi|332023926|gb|EGI64144.1| Succinate dehydrogenase subunit 5, mitochondrial [Acromyrmex
           echinatior]
          Length = 181

 Score = 93.9 bits (233), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 18/94 (19%), Positives = 46/94 (48%), Gaps = 2/94 (2%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEE--DDSNLFK 60
           +N NL+  ++ Y+  +RG  E  ++L +F + ++      +L + + +I    +D ++F 
Sbjct: 84  ENANLKRARLTYQSRKRGMLENGILLSTFANKYLNTFDDKQLRLYDQLINLPSNDWDIFY 143

Query: 61  WFTGMEKPPEYLRTPIFKKIYDYYSNNLDRKNML 94
           W TG++  P      +   + ++  N   +  ++
Sbjct: 144 WATGVKPTPPEFDNEVMDLLKNHIQNEDRQAGIM 177


>gi|256076238|ref|XP_002574420.1| hypothetical protein [Schistosoma mansoni]
 gi|238659625|emb|CAZ30653.1| expressed protein [Schistosoma mansoni]
          Length = 161

 Score = 93.9 bits (233), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 19/88 (21%), Positives = 48/88 (54%), Gaps = 2/88 (2%)

Query: 2   KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDD--SNLF 59
            +  +++  +++Y+  +RG  E  ++L +F   ++  ++  +L   +S+I   D   +++
Sbjct: 62  TETDDVRRARLLYQSRKRGNLENGILLSTFAAKYLNSMTHEQLIAYDSLINLPDNEWDIY 121

Query: 60  KWFTGMEKPPEYLRTPIFKKIYDYYSNN 87
            W T  ++ PEY +T I + + ++  NN
Sbjct: 122 YWITKAKEAPEYFQTDILQLLQEHCQNN 149


>gi|85708436|ref|ZP_01039502.1| hypothetical protein NAP1_04335 [Erythrobacter sp. NAP1]
 gi|85689970|gb|EAQ29973.1| hypothetical protein NAP1_04335 [Erythrobacter sp. NAP1]
          Length = 92

 Score = 93.2 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 20/78 (25%), Positives = 38/78 (48%)

Query: 4  NMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFT 63
           +  +  +  +R W RGTRE D ++G + D +  E    E+   E ++ EDD ++  W  
Sbjct: 6  TLETRLARAKFRAWHRGTREADYMIGGYFDRYHAEWGEKEMDWFEDLLAEDDVDVMAWGL 65

Query: 64 GMEKPPEYLRTPIFKKIY 81
            +  PE  +  + +K+ 
Sbjct: 66 KTQPVPERFQGEMIEKMQ 83


>gi|88608736|ref|YP_506805.1| hypothetical protein NSE_0941 [Neorickettsia sennetsu str.
          Miyayama]
 gi|88600905|gb|ABD46373.1| conserved hypothetical protein [Neorickettsia sennetsu str.
          Miyayama]
          Length = 82

 Score = 93.2 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 28/79 (35%), Positives = 50/79 (63%), Gaps = 2/79 (2%)

Query: 4  NMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFT 63
          N++L+ ++I+YR   RG +E+D++LGSF+   + +L+  E+  +E I+E  DS +F  + 
Sbjct: 2  NIDLRKKRILYRSTHRGCKEIDILLGSFITKNLSKLTEQEVEQVECILELSDSFIFDCYQ 61

Query: 64 GMEKPPEYLRTPIFKKIYD 82
          G  +PPE    PI K++  
Sbjct: 62 GKVEPPEEF--PILKRMVQ 78


>gi|158300413|ref|XP_320341.4| AGAP012191-PA [Anopheles gambiae str. PEST]
 gi|157013147|gb|EAA00134.4| AGAP012191-PA [Anopheles gambiae str. PEST]
          Length = 145

 Score = 93.2 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 20/88 (22%), Positives = 46/88 (52%), Gaps = 2/88 (2%)

Query: 2   KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEE--DDSNLF 59
            + + LQ  +++Y+  +RG  E  L+L +F   ++ E+S  +  + + +I    +D ++F
Sbjct: 42  NEPLQLQKSRLLYQSRKRGMLENGLLLSTFAAKYLAEMSPAQTKLYDQLINLPSNDWDIF 101

Query: 60  KWFTGMEKPPEYLRTPIFKKIYDYYSNN 87
            W TG++  P+     +   + ++  NN
Sbjct: 102 YWATGVKPTPKEYDNEVMNMLKNHVKNN 129


>gi|238593559|ref|XP_002393230.1| hypothetical protein MPER_07073 [Moniliophthora perniciosa FA553]
 gi|215460401|gb|EEB94160.1| hypothetical protein MPER_07073 [Moniliophthora perniciosa FA553]
          Length = 147

 Score = 92.4 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 22/87 (25%), Positives = 44/87 (50%), Gaps = 1/87 (1%)

Query: 2   KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
            + +     ++VY+  +RGT E DL++ +F    + ++S  EL   +  ++E D +++ W
Sbjct: 51  NETVETMRARLVYQSRKRGTLESDLLMSTFARDHLGKMSEEELREYDRFLDEPDWDIYYW 110

Query: 62  FTGMEKPPEYL-RTPIFKKIYDYYSNN 87
            TG   PPE    +   +K+  +  N 
Sbjct: 111 ATGKRTPPERWAHSKTLEKLRVHAKNE 137


>gi|303273306|ref|XP_003056014.1| predicted protein [Micromonas pusilla CCMP1545]
 gi|226462098|gb|EEH59390.1| predicted protein [Micromonas pusilla CCMP1545]
          Length = 174

 Score = 92.4 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 22/87 (25%), Positives = 47/87 (54%), Gaps = 1/87 (1%)

Query: 11  KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
           +++YR  +RG  E+D+++G +    ++  S   +     +++E++  LFKW TG E PP 
Sbjct: 67  RLLYRAKQRGFLELDILVGKWAQRHLINRSEEFMASFSEVLDEENPELFKWLTGQEYPPS 126

Query: 71  YLRTPI-FKKIYDYYSNNLDRKNMLGS 96
            L   + F  +  +    +++K+  G+
Sbjct: 127 RLANNLAFISLQVHVITIMNQKSHRGA 153


>gi|219113397|ref|XP_002186282.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gi|209583132|gb|ACI65752.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
          Length = 206

 Score = 92.0 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 20/90 (22%), Positives = 49/90 (54%), Gaps = 4/90 (4%)

Query: 2   KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
           K N++++ ++++YR  +RG  E+DL+LG++    +   +  EL   E+ +  +  +++  
Sbjct: 97  KLNLDIRRKRLIYRSKQRGWLEVDLLLGTYASEHVHTFAHDELNQFEAFVNLETIDIYNI 156

Query: 62  FTGMEKPPEYLRTP----IFKKIYDYYSNN 87
            T     PE+++TP    + ++I  +   +
Sbjct: 157 ITLRLDIPEHMKTPTQDSVIERIQKWARGS 186


>gi|194757950|ref|XP_001961225.1| GF11110 [Drosophila ananassae]
 gi|257096748|sp|B3MI37|SDF2A_DROAN RecName: Full=Succinate dehydrogenase assembly factor 2-A,
           mitochondrial; Short=SDH assembly factor 2-A; AltName:
           Full=Succinate dehydrogenase subunit 5-A, mitochondrial;
           Flags: Precursor
 gi|190622523|gb|EDV38047.1| GF11110 [Drosophila ananassae]
          Length = 156

 Score = 92.0 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 18/86 (20%), Positives = 44/86 (51%), Gaps = 2/86 (2%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIE--EDDSNLFK 60
           + +  + ++++Y+  +RG  E DL+L +FV  ++   ++ +    + +I    +D ++F 
Sbjct: 59  EPLETRKQRLLYQSRKRGMLENDLLLSTFVAKYLKSFTADQTAQYDDLINGVSNDWDIFY 118

Query: 61  WFTGMEKPPEYLRTPIFKKIYDYYSN 86
           W T  +  P    T I + + ++  N
Sbjct: 119 WATETKPTPPEFDTEIMRLLKEHVKN 144


>gi|91077612|ref|XP_973651.1| PREDICTED: similar to CG14757 CG14757-PA [Tribolium castaneum]
          Length = 146

 Score = 92.0 bits (228), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 19/95 (20%), Positives = 51/95 (53%), Gaps = 3/95 (3%)

Query: 2   KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIE--EDDSNLF 59
            + +  +  +++Y+  +RG  E DL+L +FV  ++   +  +L   + +I    +D +++
Sbjct: 48  NEPLEQRRARLLYQSRKRGMLENDLLLSTFVAKYLNTFTESQLEQYDKLINGPSNDWDIY 107

Query: 60  KWFTGMEKPPEYLRTPIFKKIYDYYSNNLDRKNML 94
            W T +++ P+  +  I   + ++   NL+R++ +
Sbjct: 108 YWATEIKETPKEYQHEIMTLLKEHCK-NLNRESRI 141


>gi|254512347|ref|ZP_05124414.1| TPR repeat family protein [Rhodobacteraceae bacterium KLH11]
 gi|221536058|gb|EEE39046.1| TPR repeat family protein [Rhodobacteraceae bacterium KLH11]
          Length = 95

 Score = 92.0 bits (228), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 24/77 (31%), Positives = 41/77 (53%), Gaps = 1/77 (1%)

Query: 12 IVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPEY 71
          +  R  RRG +EMDLIL ++ D  +  +  V L   ++++ E+D +L++W TG  +PP  
Sbjct: 1  MKMRSMRRGIKEMDLILTAYADRNLSSMDDVGLETYDALLHENDQDLYQWVTGQAQPPAR 60

Query: 72 LRTPIFKKIYDYYSNNL 88
          L   +   I   + N  
Sbjct: 61 LEN-LIADIAQTFQNRE 76


>gi|302849792|ref|XP_002956425.1| hypothetical protein VOLCADRAFT_66963 [Volvox carteri f.
          nagariensis]
 gi|300258331|gb|EFJ42569.1| hypothetical protein VOLCADRAFT_66963 [Volvox carteri f.
          nagariensis]
          Length = 110

 Score = 91.6 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 24/80 (30%), Positives = 48/80 (60%), Gaps = 1/80 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          K++YR  +RG  E+DL++G + +  I ++   EL  +  ++EE++ +LFKW TG  +PP+
Sbjct: 4  KLLYRSKQRGFLELDLLIGLWAEVNIPKMDFAELKQMALVLEEENPDLFKWLTGQLQPPD 63

Query: 71 YLRT-PIFKKIYDYYSNNLD 89
           +    +F+ +  + +  L 
Sbjct: 64 RMSGNAVFEALRRHVAQQLS 83


>gi|195995797|ref|XP_002107767.1| hypothetical protein TRIADDRAFT_20085 [Trichoplax adhaerens]
 gi|190588543|gb|EDV28565.1| hypothetical protein TRIADDRAFT_20085 [Trichoplax adhaerens]
          Length = 145

 Score = 91.6 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 20/87 (22%), Positives = 45/87 (51%), Gaps = 2/87 (2%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEE--DDSNLFK 60
           + ++ +  +++Y+  +RG +E DL+L +F  HF+ ++ + +L   + ++ E  ++  L+ 
Sbjct: 48  EEVSKRKARLLYQSRKRGIKENDLLLSNFAHHFLHKMDNQQLDQYDRLLNESSNEWELYY 107

Query: 61  WFTGMEKPPEYLRTPIFKKIYDYYSNN 87
           W  G +  P      I   +  Y SN 
Sbjct: 108 WIIGTKSVPTEFDNEIMAMLQKYASNK 134


>gi|225704854|gb|ACO08273.1| Early meiotic induction protein 5, mitochondrial precursor
           [Oncorhynchus mykiss]
          Length = 163

 Score = 91.6 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 16/94 (17%), Positives = 46/94 (48%), Gaps = 2/94 (2%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEE--DDSNLFK 60
           + M+++ R+++++  +RG  E  ++L  F   ++  ++  +L   + +I E  +D +++ 
Sbjct: 58  ETMDIKRRRLLFQSRKRGMLENCILLSLFAKQYLNTMNEPQLRQYDRLINEPSNDWDIYY 117

Query: 61  WFTGMEKPPEYLRTPIFKKIYDYYSNNLDRKNML 94
           W T  +  P+     I   + ++  N    + + 
Sbjct: 118 WATEAQPVPDVYAGEIMDLLKEFTKNKDQEQRLD 151


>gi|195026384|ref|XP_001986244.1| GH20634 [Drosophila grimshawi]
 gi|193902244|gb|EDW01111.1| GH20634 [Drosophila grimshawi]
          Length = 206

 Score = 91.6 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 18/93 (19%), Positives = 47/93 (50%), Gaps = 2/93 (2%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIE--EDDSNLFK 60
           + +  + ++++Y+  +RG  E DL+L +FV  ++ + S+ +  + + +I    +D +++ 
Sbjct: 109 EPLATRKQRLLYQSRKRGMLENDLLLSTFVAKYLKDFSAEQTALYDQLINGVSNDWDIYY 168

Query: 61  WFTGMEKPPEYLRTPIFKKIYDYYSNNLDRKNM 93
           W T  +  P    T I + +  +  N    + +
Sbjct: 169 WATNTKPTPPEYNTEIMEMLKQHVKNTERVQRL 201


>gi|261205602|ref|XP_002627538.1| TPR repeat protein [Ajellomyces dermatitidis SLH14081]
 gi|239592597|gb|EEQ75178.1| TPR repeat protein [Ajellomyces dermatitidis SLH14081]
          Length = 317

 Score = 91.6 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 14/73 (19%), Positives = 36/73 (49%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
           +++     +++Y+  +RG  E DL+L +F    +  ++  +L   +  ++E+D +++ W 
Sbjct: 151 EDITTMRARLLYQSRKRGILESDLLLSTFASQHLPTMTERQLQEYDKFLDENDWDIYYWA 210

Query: 63  TGMEKPPEYLRTP 75
           T   + P      
Sbjct: 211 TQEAEDPSVTDGA 223


>gi|255262313|ref|ZP_05341655.1| TPR repeat family protein [Thalassiobium sp. R2A62]
 gi|255104648|gb|EET47322.1| TPR repeat family protein [Thalassiobium sp. R2A62]
          Length = 84

 Score = 91.2 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 23/86 (26%), Positives = 45/86 (52%), Gaps = 4/86 (4%)

Query: 1  MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
          M ++   + +++  R  RRG +EMDLIL  +    +  +S  ++   E +++E D +L+ 
Sbjct: 1  MTEDRETRIKRLKMRSMRRGIKEMDLILSQYS-ARLDAMSDAQIDHYEILLDESDHDLYA 59

Query: 61 WFTGMEKPP-EYLRTPIFKKIYDYYS 85
          W +G  + P EYL   +   I  ++ 
Sbjct: 60 WVSGAAETPLEYLD--LITDISKHFK 83


>gi|198456280|ref|XP_002138209.1| GA24523 [Drosophila pseudoobscura pseudoobscura]
 gi|257096762|sp|B5DZ31|SDF2B_DROPS RecName: Full=Succinate dehydrogenase assembly factor 2-B,
           mitochondrial; Short=SDH assembly factor 2-B; AltName:
           Full=Succinate dehydrogenase subunit 5-B, mitochondrial;
           Flags: Precursor
 gi|198135557|gb|EDY68767.1| GA24523 [Drosophila pseudoobscura pseudoobscura]
          Length = 160

 Score = 91.2 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 19/87 (21%), Positives = 47/87 (54%), Gaps = 2/87 (2%)

Query: 2   KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIE--EDDSNLF 59
            + +  + ++++Y+  +RG  E DL+L +F   ++ + S+ +  + + +I    +D +++
Sbjct: 61  NEPLETRKQRLLYQSRKRGMLENDLLLSTFAAKYLKDFSAEQTAIYDQLINGVSNDWDIY 120

Query: 60  KWFTGMEKPPEYLRTPIFKKIYDYYSN 86
            W T ++  PE   T I K + ++  N
Sbjct: 121 YWATEVKPTPEEYNTEIMKLLKEHVKN 147


>gi|195149508|ref|XP_002015699.1| GL10881 [Drosophila persimilis]
 gi|257096751|sp|B4GDB3|SDF2A_DROPE RecName: Full=Succinate dehydrogenase assembly factor 2-A,
           mitochondrial; Short=SDH assembly factor 2-A; AltName:
           Full=Succinate dehydrogenase subunit 5-A, mitochondrial;
           Flags: Precursor
 gi|194109546|gb|EDW31589.1| GL10881 [Drosophila persimilis]
          Length = 160

 Score = 91.2 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 19/87 (21%), Positives = 47/87 (54%), Gaps = 2/87 (2%)

Query: 2   KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIE--EDDSNLF 59
            + +  + ++++Y+  +RG  E DL+L +F   ++ + S+ +  + + +I    +D +++
Sbjct: 61  NEPLETRKQRLLYQSRKRGMLENDLLLSTFAAKYLKDFSAEQTAIYDQLINGVSNDWDIY 120

Query: 60  KWFTGMEKPPEYLRTPIFKKIYDYYSN 86
            W T ++  PE   T I K + ++  N
Sbjct: 121 YWATEVKPTPEEYNTEIMKLLKEHVKN 147


>gi|195475352|ref|XP_002089948.1| GE21507 [Drosophila yakuba]
 gi|257096766|sp|B4NXN5|SDF2B_DROYA RecName: Full=Succinate dehydrogenase assembly factor 2-B,
           mitochondrial; Short=SDH assembly factor 2-B; AltName:
           Full=Succinate dehydrogenase subunit 5-B, mitochondrial;
           Flags: Precursor
 gi|194176049|gb|EDW89660.1| GE21507 [Drosophila yakuba]
          Length = 156

 Score = 91.2 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 19/93 (20%), Positives = 48/93 (51%), Gaps = 2/93 (2%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIE--EDDSNLFK 60
           + +  + ++++Y+  +RG  E DL+L +FV  ++ + S+ +    + +I    +D ++F 
Sbjct: 59  EPLETRKQRLLYQSRKRGMLENDLLLSTFVAKYLKDFSAEQTAEYDQLINGVSNDWDIFY 118

Query: 61  WFTGMEKPPEYLRTPIFKKIYDYYSNNLDRKNM 93
           W T  +  P    T I + + ++  N+   + +
Sbjct: 119 WATDTKPTPPQFDTEIMRLLKEHVKNHEKVQRI 151


>gi|194757578|ref|XP_001961041.1| GF11203 [Drosophila ananassae]
 gi|257096757|sp|B3MGU5|SDF2B_DROAN RecName: Full=Succinate dehydrogenase assembly factor 2-B,
           mitochondrial; Short=SDH assembly factor 2-B; AltName:
           Full=Succinate dehydrogenase subunit 5-B, mitochondrial;
           Flags: Precursor
 gi|190622339|gb|EDV37863.1| GF11203 [Drosophila ananassae]
          Length = 163

 Score = 91.2 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 17/87 (19%), Positives = 47/87 (54%), Gaps = 2/87 (2%)

Query: 2   KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIE--EDDSNLF 59
            + ++++ ++++Y+  +RG  E DL+L +F   ++   ++ +    + +I    +D +++
Sbjct: 60  NEPLDIRKQRLLYQSRKRGMLENDLLLSTFAAKYLDNFNAEQTAQYDQLINGVSNDWDIY 119

Query: 60  KWFTGMEKPPEYLRTPIFKKIYDYYSN 86
            W T ++  P+   T I + + D+  N
Sbjct: 120 YWATDVKPTPKEYDTEIMRLLKDHVKN 146


>gi|119383688|ref|YP_914744.1| hypothetical protein Pden_0937 [Paracoccus denitrificans PD1222]
 gi|119373455|gb|ABL69048.1| protein of unknown function DUF339 [Paracoccus denitrificans
          PD1222]
          Length = 81

 Score = 91.2 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 31/81 (38%), Positives = 45/81 (55%), Gaps = 3/81 (3%)

Query: 14 YRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFT---GMEKPPE 70
           R WRRGT+EMDLILG F D  +  L+  EL + E+++ E+D +L+ W T   G  +P  
Sbjct: 1  MRSWRRGTKEMDLILGPFSDSELERLTEAELDLYEALLTENDQDLYPWITARLGDARPGP 60

Query: 71 YLRTPIFKKIYDYYSNNLDRK 91
              PI  ++  +    L RK
Sbjct: 61 QALLPILDRVASFAHARLARK 81


>gi|239611252|gb|EEQ88239.1| TPR repeat protein [Ajellomyces dermatitidis ER-3]
 gi|327348746|gb|EGE77603.1| TPR repeat protein [Ajellomyces dermatitidis ATCC 18188]
          Length = 317

 Score = 91.2 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 14/73 (19%), Positives = 36/73 (49%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
           +++     +++Y+  +RG  E DL+L +F    +  ++  +L   +  ++E+D +++ W 
Sbjct: 151 EDITTMRARLLYQSRKRGILESDLLLSTFASQHLPTMTERQLQEYDKFLDENDWDIYYWA 210

Query: 63  TGMEKPPEYLRTP 75
           T   + P      
Sbjct: 211 TQEAEDPSVTDGA 223


>gi|47230482|emb|CAF99675.1| unnamed protein product [Tetraodon nigroviridis]
          Length = 159

 Score = 91.2 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 17/94 (18%), Positives = 46/94 (48%), Gaps = 2/94 (2%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEE--DDSNLFK 60
           + + ++ R+++Y   +RG  E  ++L  F   ++  +S  +L   + +I E  +D +++ 
Sbjct: 58  EPIEVKKRRLLYESRKRGMLENCILLSLFAKQYLNTMSENQLQQYDRLINEPSNDWDIYY 117

Query: 61  WFTGMEKPPEYLRTPIFKKIYDYYSNNLDRKNML 94
           W TG +  P+  +  +   + ++  N    + + 
Sbjct: 118 WATGAQPTPDVYQGEVMDMLKEFAKNRDQEQRLD 151


>gi|198460563|ref|XP_002138856.1| GA25039 [Drosophila pseudoobscura pseudoobscura]
 gi|257096752|sp|B5E0U2|SDF2A_DROPS RecName: Full=Succinate dehydrogenase assembly factor 2-A,
           mitochondrial; Short=SDH assembly factor 2-A; AltName:
           Full=Succinate dehydrogenase subunit 5-A, mitochondrial;
           Flags: Precursor
 gi|198137059|gb|EDY69414.1| GA25039 [Drosophila pseudoobscura pseudoobscura]
          Length = 157

 Score = 91.2 bits (226), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 19/93 (20%), Positives = 45/93 (48%), Gaps = 2/93 (2%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIE--EDDSNLFK 60
           + +  + ++++Y+  +RG  E DL+L +FV   + + S+ +    + +I    +D ++F 
Sbjct: 60  EPLETRKQRLLYQSRKRGMLENDLLLSTFVAKHLRDFSAAQTAQYDELINGVSNDWDIFY 119

Query: 61  WFTGMEKPPEYLRTPIFKKIYDYYSNNLDRKNM 93
           W T  +  P    T I + +  +  N    + +
Sbjct: 120 WATETKPTPPQYDTEIMRMLKQHVKNEERVQRI 152


>gi|302383041|ref|YP_003818864.1| hypothetical protein Bresu_1930 [Brevundimonas subvibrioides ATCC
          15264]
 gi|302193669|gb|ADL01241.1| protein of unknown function DUF339 [Brevundimonas subvibrioides
          ATCC 15264]
          Length = 106

 Score = 90.8 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 25/79 (31%), Positives = 41/79 (51%), Gaps = 1/79 (1%)

Query: 8  QCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEE-DDSNLFKWFTGME 66
          +  +I +R WRRG RE DL+LG F++     LS  +L  LE+++ E +D  L+ W     
Sbjct: 16 RLGRITFRAWRRGFREADLVLGPFMEREGPGLSDADLDSLEALLAEDNDHELYAWIIETN 75

Query: 67 KPPEYLRTPIFKKIYDYYS 85
            P    TP+  ++  +  
Sbjct: 76 PTPAEHETPLMTRLRTFMR 94


>gi|195383658|ref|XP_002050543.1| GJ20144 [Drosophila virilis]
 gi|257096773|sp|B4LKE5|SDHF2_DROVI RecName: Full=Succinate dehydrogenase assembly factor 2,
           mitochondrial; Short=SDH assembly factor 2; AltName:
           Full=Succinate dehydrogenase subunit 5, mitochondrial;
           Flags: Precursor
 gi|194145340|gb|EDW61736.1| GJ20144 [Drosophila virilis]
          Length = 158

 Score = 90.8 bits (225), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 19/93 (20%), Positives = 45/93 (48%), Gaps = 2/93 (2%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIE--EDDSNLFK 60
           + +  + ++++Y+  +RG  E DL+L +FV  ++ +    E  + + +I    +D +++ 
Sbjct: 61  EPLATRKQRLLYQSRKRGMLENDLLLSTFVAKYLKDFDEDETALYDKLINGVSNDWDIYY 120

Query: 61  WFTGMEKPPEYLRTPIFKKIYDYYSNNLDRKNM 93
           W T  +  P    T I K +  +  N    + +
Sbjct: 121 WATETKPTPPEYDTDIMKLLKQHVKNTERVQRI 153


>gi|308322049|gb|ADO28162.1| mitochondrial succinate dehydrogenase assembly factor 2 [Ictalurus
           furcatus]
          Length = 159

 Score = 90.8 bits (225), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 15/95 (15%), Positives = 49/95 (51%), Gaps = 2/95 (2%)

Query: 2   KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEE--DDSNLF 59
            ++++++ ++++Y   +RG  E  ++L  F   ++  +S+ +L   + +I E  +D +++
Sbjct: 53  NESLDIKRKRLLYESRKRGMLENCILLSLFAKRYLENMSASQLRQYDRLINEPSNDWDIY 112

Query: 60  KWFTGMEKPPEYLRTPIFKKIYDYYSNNLDRKNML 94
            W T ++  P+  +  +   + ++  N    + + 
Sbjct: 113 YWATAVKPTPDVYQGEVMDLLKEFTKNREMEQRLD 147


>gi|195153451|ref|XP_002017639.1| GL17204 [Drosophila persimilis]
 gi|257096761|sp|B4GG58|SDF2B_DROPE RecName: Full=Succinate dehydrogenase assembly factor 2-B,
           mitochondrial; Short=SDH assembly factor 2-B; AltName:
           Full=Succinate dehydrogenase subunit 5-B, mitochondrial;
           Flags: Precursor
 gi|194113435|gb|EDW35478.1| GL17204 [Drosophila persimilis]
          Length = 157

 Score = 90.5 bits (224), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 19/93 (20%), Positives = 45/93 (48%), Gaps = 2/93 (2%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIE--EDDSNLFK 60
           + +  + ++++Y+  +RG  E DL+L +FV   + + S+ +    + +I    +D ++F 
Sbjct: 60  EPLETRKQRLLYQSRKRGMLENDLLLSTFVAKHLRDFSAAQTAQYDDLINGVSNDWDIFY 119

Query: 61  WFTGMEKPPEYLRTPIFKKIYDYYSNNLDRKNM 93
           W T  +  P    T I + +  +  N    + +
Sbjct: 120 WATETKPTPPQYDTEIMRMLKQHVKNEERVQRI 152


>gi|126730937|ref|ZP_01746746.1| hypothetical protein SSE37_14028 [Sagittula stellata E-37]
 gi|126708653|gb|EBA07710.1| hypothetical protein SSE37_14028 [Sagittula stellata E-37]
          Length = 91

 Score = 90.5 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 22/87 (25%), Positives = 47/87 (54%), Gaps = 1/87 (1%)

Query: 1  MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
          +++  +++ +++  R  RRGT+EMD++L  F +  +  L    L   E++++E+D +L++
Sbjct: 6  IRETHDIRLKRLTMRSMRRGTKEMDILLMRFAEARLAALDPAALDAYEALLDENDQDLYQ 65

Query: 61 WFTGMEKPPEYLRTPIFKKIYDYYSNN 87
          W +G    P     P+  +I     N 
Sbjct: 66 WISGQRPAPAA-HAPLIAEIASVAGNR 91


>gi|195474637|ref|XP_002089597.1| GE23226 [Drosophila yakuba]
 gi|257096756|sp|B4P2P8|SDF2A_DROYA RecName: Full=Succinate dehydrogenase assembly factor 2-A,
           mitochondrial; Short=SDH assembly factor 2-A; AltName:
           Full=Succinate dehydrogenase subunit 5-A, mitochondrial;
           Flags: Precursor
 gi|194175698|gb|EDW89309.1| GE23226 [Drosophila yakuba]
          Length = 162

 Score = 90.5 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 17/87 (19%), Positives = 43/87 (49%), Gaps = 2/87 (2%)

Query: 2   KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIE--EDDSNLF 59
            + +  + ++++Y+  +RG  E DL+L +F    +   S+ +    + +I    +D +++
Sbjct: 62  NEPLETRKQRLLYQSRKRGMLENDLLLSTFAAKHLQNFSAEQTAQYDQLINGVSNDWDIY 121

Query: 60  KWFTGMEKPPEYLRTPIFKKIYDYYSN 86
            W T ++  P+   T I + +  +  N
Sbjct: 122 YWATDVKPTPKEYDTEIMRLLKKHVKN 148


>gi|254797261|ref|YP_003082103.1| TPR repeat region superfamily [Neorickettsia risticii str.
          Illinois]
 gi|254590502|gb|ACT69864.1| TPR repeat region superfamily [Neorickettsia risticii str.
          Illinois]
          Length = 82

 Score = 90.5 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 28/79 (35%), Positives = 50/79 (63%), Gaps = 2/79 (2%)

Query: 4  NMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFT 63
          N++L+ ++I+YR   RG +E+D++LGSF+   + +L+  E+  +E I+E  DS +F  + 
Sbjct: 2  NIDLRKKRILYRSTHRGCKEIDILLGSFITKNLSKLTEQEVEQVECILELSDSFIFDCYQ 61

Query: 64 GMEKPPEYLRTPIFKKIYD 82
          G  +PPE    PI K++  
Sbjct: 62 GKLEPPEEF--PILKQMVQ 78


>gi|225380645|gb|AAL48877.2| RE29446p [Drosophila melanogaster]
          Length = 163

 Score = 90.5 bits (224), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 18/93 (19%), Positives = 47/93 (50%), Gaps = 2/93 (2%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIE--EDDSNLFK 60
           + +  + ++++Y+  +RG  E DL+L +FV   + + ++ +    + +I    +D ++F 
Sbjct: 66  EPLETRKQRLLYQSRKRGMLENDLLLSTFVAKHLKDFNAEQTAEYDQLINGVSNDWDIFY 125

Query: 61  WFTGMEKPPEYLRTPIFKKIYDYYSNNLDRKNM 93
           W T  +  P    T I + + ++  N+   + +
Sbjct: 126 WATDTKPTPPQFDTEIMRLLKEHVKNHEKVQRI 158


>gi|45550404|ref|NP_610586.3| CG12895 [Drosophila melanogaster]
 gi|257096759|sp|A1Z897|SDF2B_DROME RecName: Full=Succinate dehydrogenase assembly factor 2-B,
           mitochondrial; Short=SDH assembly factor 2-B; AltName:
           Full=Succinate dehydrogenase subunit 5-B, mitochondrial;
           Flags: Precursor
 gi|45445590|gb|AAF58794.2| CG12895 [Drosophila melanogaster]
          Length = 156

 Score = 90.5 bits (224), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 18/93 (19%), Positives = 47/93 (50%), Gaps = 2/93 (2%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIE--EDDSNLFK 60
           + +  + ++++Y+  +RG  E DL+L +FV   + + ++ +    + +I    +D ++F 
Sbjct: 59  EPLETRKQRLLYQSRKRGMLENDLLLSTFVAKHLKDFNAEQTAEYDQLINGVSNDWDIFY 118

Query: 61  WFTGMEKPPEYLRTPIFKKIYDYYSNNLDRKNM 93
           W T  +  P    T I + + ++  N+   + +
Sbjct: 119 WATDTKPTPPQFDTEIMRLLKEHVKNHEKVQRI 151


>gi|85373851|ref|YP_457913.1| hypothetical protein ELI_05120 [Erythrobacter litoralis HTCC2594]
 gi|84786934|gb|ABC63116.1| hypothetical protein ELI_05120 [Erythrobacter litoralis HTCC2594]
          Length = 89

 Score = 90.1 bits (223), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 20/79 (25%), Positives = 37/79 (46%)

Query: 3  KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
           +   +  +  +R W RGTRE D ++G F D +       +L   E +++EDD ++  W 
Sbjct: 2  SDFTTRLARAKFRGWHRGTREADYMIGGFFDRYSDGWGEEDLAWFEMLLDEDDVDIMAWA 61

Query: 63 TGMEKPPEYLRTPIFKKIY 81
           G    PE++     + + 
Sbjct: 62 LGTLPIPEHVAGSQMELMR 80


>gi|157169420|ref|XP_001651508.1| hypothetical protein AaeL_AAEL005866 [Aedes aegypti]
 gi|122117908|sp|Q178L7|SDHF2_AEDAE RecName: Full=Succinate dehydrogenase assembly factor 2,
           mitochondrial; Short=SDH assembly factor 2; AltName:
           Full=Succinate dehydrogenase subunit 5, mitochondrial;
           Flags: Precursor
 gi|108878400|gb|EAT42625.1| conserved hypothetical protein [Aedes aegypti]
          Length = 161

 Score = 90.1 bits (223), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 19/87 (21%), Positives = 41/87 (47%), Gaps = 2/87 (2%)

Query: 2   KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEE--DDSNLF 59
            + + LQ  +++Y+  +RG  E  L+L +F    +  +   +  + + +I    +D ++F
Sbjct: 62  NEPLQLQKSRLLYQSRKRGMLENGLLLSTFAAKHLESMDVKQTKLYDQLINMPTNDWDIF 121

Query: 60  KWFTGMEKPPEYLRTPIFKKIYDYYSN 86
            W TG++  P      I   + D+  N
Sbjct: 122 YWATGVKPTPAEYDNEIMALLKDHVKN 148


>gi|270002181|gb|EEZ98628.1| hypothetical protein TcasGA2_TC001151 [Tribolium castaneum]
          Length = 118

 Score = 90.1 bits (223), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 19/95 (20%), Positives = 51/95 (53%), Gaps = 3/95 (3%)

Query: 2   KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIE--EDDSNLF 59
            + +  +  +++Y+  +RG  E DL+L +FV  ++   +  +L   + +I    +D +++
Sbjct: 20  NEPLEQRRARLLYQSRKRGMLENDLLLSTFVAKYLNTFTESQLEQYDKLINGPSNDWDIY 79

Query: 60  KWFTGMEKPPEYLRTPIFKKIYDYYSNNLDRKNML 94
            W T +++ P+  +  I   + ++   NL+R++ +
Sbjct: 80  YWATEIKETPKEYQHEIMTLLKEHCK-NLNRESRI 113


>gi|225706318|gb|ACO09005.1| Early meiotic induction protein 5, mitochondrial precursor [Osmerus
           mordax]
          Length = 163

 Score = 90.1 bits (223), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 17/94 (18%), Positives = 44/94 (46%), Gaps = 2/94 (2%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEE--DDSNLFK 60
           + ++++ R+++Y   +RG  E  ++L  F   ++  +S  +L   + +I E  +D +++ 
Sbjct: 58  ETVDIKRRRLLYESRKRGMLENCILLSLFSKRYLNTMSETQLQQYDRLINEPSNDWDIYY 117

Query: 61  WFTGMEKPPEYLRTPIFKKIYDYYSNNLDRKNML 94
           W T     PE     +   + ++  N    + + 
Sbjct: 118 WATEAHPTPEVYDGEVMDMLKEFTKNRDQEQRLD 151


>gi|50309089|ref|XP_454550.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
 gi|74605800|sp|Q6CND9|SDHF2_KLULA RecName: Full=Succinate dehydrogenase assembly factor 2,
           mitochondrial; Short=SDH assembly factor 2; AltName:
           Full=Early meiotic induction protein 5; AltName:
           Full=Succinate dehydrogenase subunit 5, mitochondrial;
           Flags: Precursor
 gi|49643685|emb|CAG99637.1| KLLA0E13333p [Kluyveromyces lactis]
          Length = 163

 Score = 90.1 bits (223), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 18/89 (20%), Positives = 46/89 (51%), Gaps = 4/89 (4%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
           ++++ +  +++Y+  +RG  E DL+L  F   ++ E++  +L   + ++ E D +++ W 
Sbjct: 62  ESLDKKRARLIYQSRKRGILETDLLLSRFAAKYLKEMTPEQLEEYDQLLNELDWDIYYWA 121

Query: 63  TGM---EKPPEYL-RTPIFKKIYDYYSNN 87
           T        P+    + I K++ ++  N 
Sbjct: 122 TENYSITPLPDRWKNSNILKQLQEFSKNK 150


>gi|156554685|ref|XP_001603484.1| PREDICTED: similar to conserved hypothetical protein [Nasonia
           vitripennis]
          Length = 149

 Score = 89.7 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 15/94 (15%), Positives = 47/94 (50%), Gaps = 3/94 (3%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEE--DDSNLFK 60
           ++ +++  +++Y+  +RG  E  L+L +F   ++ + +   L   + +I    +D +++ 
Sbjct: 51  ESTSIKRARLLYQSRKRGMLENGLLLSTFAKKYLDDFNDKHLHQYDRLINLPSNDWDIYY 110

Query: 61  WFTGMEKPPEYLRTPIFKKIYDYYSNNLDRKNML 94
           W  G++  P   +  +   +  +   N +R++ +
Sbjct: 111 WAAGVKPVPAEFKNEVMDLLQKHIK-NENRESRI 143


>gi|226289895|gb|EEH45379.1| TPR repeat protein [Paracoccidioides brasiliensis Pb18]
          Length = 294

 Score = 89.7 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 15/73 (20%), Positives = 39/73 (53%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
           ++++    +++Y+  +RGT E DL+L +F    +  +++ +L   +  ++E+D +++ W 
Sbjct: 131 EDVSTMRARLLYQSRKRGTLESDLLLSTFASKNLPTMTAQQLEEFDKFLDENDWDIYYWA 190

Query: 63  TGMEKPPEYLRTP 75
           T   + P      
Sbjct: 191 TQEAEDPSATDKA 203


>gi|195582194|ref|XP_002080913.1| GD25982 [Drosophila simulans]
 gi|257096764|sp|B4QID8|SDF2B_DROSI RecName: Full=Succinate dehydrogenase assembly factor 2-B,
           mitochondrial; Short=SDH assembly factor 2-B; AltName:
           Full=Succinate dehydrogenase subunit 5-B, mitochondrial;
           Flags: Precursor
 gi|194192922|gb|EDX06498.1| GD25982 [Drosophila simulans]
          Length = 156

 Score = 89.7 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 18/93 (19%), Positives = 48/93 (51%), Gaps = 2/93 (2%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIE--EDDSNLFK 60
           + + ++ ++++Y+  +RG  E DL+L +FV   + + ++ +    + +I    +D ++F 
Sbjct: 59  EPLEIRKQRLLYQSRKRGMLENDLLLSTFVAKHLKDFNAEQTAEYDQLINGVSNDWDIFY 118

Query: 61  WFTGMEKPPEYLRTPIFKKIYDYYSNNLDRKNM 93
           W T  +  P    T I + + ++  N+   + +
Sbjct: 119 WATDTKPTPPQFDTEIMRLLKEHVKNHEKVQRI 151


>gi|194857859|ref|XP_001969049.1| GG25208 [Drosophila erecta]
 gi|257096758|sp|B3N6D9|SDF2B_DROER RecName: Full=Succinate dehydrogenase assembly factor 2-B,
           mitochondrial; Short=SDH assembly factor 2-B; AltName:
           Full=Succinate dehydrogenase subunit 5-B, mitochondrial;
           Flags: Precursor
 gi|190660916|gb|EDV58108.1| GG25208 [Drosophila erecta]
          Length = 156

 Score = 89.7 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 18/93 (19%), Positives = 47/93 (50%), Gaps = 2/93 (2%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIE--EDDSNLFK 60
           + +  + ++++Y+  +RG  E DL+L +FV   + + ++ +    + +I    +D ++F 
Sbjct: 59  EPLQTRKQRLLYQSRKRGMLENDLLLSTFVAKHLKDFNAEQTAEYDQLINGVSNDWDIFY 118

Query: 61  WFTGMEKPPEYLRTPIFKKIYDYYSNNLDRKNM 93
           W T  +  P    T I + + ++  N+   + +
Sbjct: 119 WATDTKPTPPQFDTEIMRLLKEHVKNHEKVQRI 151


>gi|195333141|ref|XP_002033250.1| GM20523 [Drosophila sechellia]
 gi|257096763|sp|B4HMQ1|SDF2B_DROSE RecName: Full=Succinate dehydrogenase assembly factor 2-B,
           mitochondrial; Short=SDH assembly factor 2-B; AltName:
           Full=Succinate dehydrogenase subunit 5-B, mitochondrial;
           Flags: Precursor
 gi|194125220|gb|EDW47263.1| GM20523 [Drosophila sechellia]
          Length = 156

 Score = 89.7 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 18/93 (19%), Positives = 47/93 (50%), Gaps = 2/93 (2%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIE--EDDSNLFK 60
           + +  + ++++Y+  +RG  E DL+L +FV   + + ++ +    + +I    +D ++F 
Sbjct: 59  EPLETRKQRLLYQSRKRGMLENDLLLSTFVAKHLKDFNAEQTAEYDQLINGVSNDWDIFY 118

Query: 61  WFTGMEKPPEYLRTPIFKKIYDYYSNNLDRKNM 93
           W T  +  P    T I + + ++  N+   + +
Sbjct: 119 WATDTKPTPPQFDTEIMRLLKEHVKNHEKVQRI 151


>gi|72035881|ref|XP_793951.1| PREDICTED: similar to ENSANGP00000014095 [Strongylocentrotus
           purpuratus]
 gi|115713923|ref|XP_001187661.1| PREDICTED: similar to ENSANGP00000014095 [Strongylocentrotus
           purpuratus]
          Length = 158

 Score = 89.7 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 19/87 (21%), Positives = 41/87 (47%), Gaps = 2/87 (2%)

Query: 2   KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIE--EDDSNLF 59
            ++M L+  ++VY+  +RG  E  +IL +F   ++      +L   +++I   ++D +LF
Sbjct: 52  NESMELKRARLVYQSRKRGMLENGIILSTFAGRYLEGFDEEQLDQYDNLINKPDNDWDLF 111

Query: 60  KWFTGMEKPPEYLRTPIFKKIYDYYSN 86
            W    +  PE     +   +  +  N
Sbjct: 112 YWVVQHKPTPEEYDHGVMDLLKTFAKN 138


>gi|259149415|emb|CAY86219.1| Emi5p [Saccharomyces cerevisiae EC1118]
          Length = 162

 Score = 89.7 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 18/91 (19%), Positives = 46/91 (50%), Gaps = 4/91 (4%)

Query: 2   KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
            + ++ +  +++Y+  +RG  E DL+L  F   ++ +++  EL   +S++ E D +++ W
Sbjct: 59  NEPLDKKRARLIYQSRKRGILETDLLLSGFAAKYLKKMNEEELEEYDSLLNELDWDIYYW 118

Query: 62  FT---GMEKPPEYL-RTPIFKKIYDYYSNNL 88
            T        P+    + + K++ ++  N  
Sbjct: 119 ATKNFKTSPLPDKWANSKLLKQLQEFSENKE 149


>gi|323346709|gb|EGA80993.1| Emi5p [Saccharomyces cerevisiae Lalvin QA23]
          Length = 159

 Score = 89.3 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 18/91 (19%), Positives = 46/91 (50%), Gaps = 4/91 (4%)

Query: 2   KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
            + ++ +  +++Y+  +RG  E DL+L  F   ++ +++  EL   +S++ E D +++ W
Sbjct: 56  NEPLDKKRARLIYQSRKRGILETDLLLSGFAAKYLKKMNEEELEEYDSLLNELDWDIYYW 115

Query: 62  FT---GMEKPPEYL-RTPIFKKIYDYYSNNL 88
            T        P+    + + K++ ++  N  
Sbjct: 116 ATKNFKTSPLPDKWANSKLLKQLQEFSENKE 146


>gi|323331664|gb|EGA73078.1| Emi5p [Saccharomyces cerevisiae AWRI796]
          Length = 159

 Score = 89.3 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 18/91 (19%), Positives = 46/91 (50%), Gaps = 4/91 (4%)

Query: 2   KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
            + ++ +  +++Y+  +RG  E DL+L  F   ++ +++  EL   +S++ E D +++ W
Sbjct: 56  NEPLDKKRARLIYQSRKRGILETDLLLSGFAAKYLKKMNEEELEEYDSLLNELDWDIYYW 115

Query: 62  FT---GMEKPPEYL-RTPIFKKIYDYYSNNL 88
            T        P+    + + K++ ++  N  
Sbjct: 116 ATKNFKTSPLPDKWANSKLLKQLQEFSENKE 146


>gi|332373054|gb|AEE61668.1| unknown [Dendroctonus ponderosae]
          Length = 149

 Score = 89.3 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 17/95 (17%), Positives = 49/95 (51%), Gaps = 3/95 (3%)

Query: 2   KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIE--EDDSNLF 59
            +++  +  +++Y+  +RG  E DL+L +F    +   +  ++   + +I    +D +++
Sbjct: 51  NEDLKQRKARLIYQSRKRGMLENDLLLSTFAAKHLEHFTPEQVDTYDKLINGPSNDWDIY 110

Query: 60  KWFTGMEKPPEYLRTPIFKKIYDYYSNNLDRKNML 94
            W   +++ PE   + I + +  +   NL+R++ +
Sbjct: 111 YWACEVKEIPEEYNSDIMQLLKLHCK-NLNRESRI 144


>gi|328769818|gb|EGF79861.1| hypothetical protein BATDEDRAFT_6694 [Batrachochytrium
          dendrobatidis JAM81]
          Length = 101

 Score = 89.3 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 19/87 (21%), Positives = 48/87 (55%), Gaps = 1/87 (1%)

Query: 2  KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
           + +  +  ++V++  +RG  E DL+L +++   +  +   +L   +S+++E+D +++ W
Sbjct: 5  NEPLEQKRSRLVWQSRKRGILETDLLLSTYIQQALPTMEDAQLQEYDSLLDENDWDIYYW 64

Query: 62 FTGMEKPPEYL-RTPIFKKIYDYYSNN 87
           TG ++ PE +    IF  + ++  N 
Sbjct: 65 CTGAKEAPERIKDMSIFDGLVEHCKNK 91


>gi|257096792|sp|B3LIY9|SDHF2_YEAS1 RecName: Full=Succinate dehydrogenase assembly factor 2,
           mitochondrial; Short=SDH assembly factor 2; AltName:
           Full=Early meiotic induction protein 5; AltName:
           Full=Succinate dehydrogenase subunit 5, mitochondrial;
           Flags: Precursor
 gi|257096793|sp|A6ZND9|SDHF2_YEAS7 RecName: Full=Succinate dehydrogenase assembly factor 2,
           mitochondrial; Short=SDH assembly factor 2; AltName:
           Full=Early meiotic induction protein 5; AltName:
           Full=Succinate dehydrogenase subunit 5, mitochondrial;
           Flags: Precursor
 gi|151945563|gb|EDN63804.1| early meiotic induction protein [Saccharomyces cerevisiae YJM789]
 gi|190407275|gb|EDV10542.1| early meiotic induction protein 5, mitochondrial precursor
           [Saccharomyces cerevisiae RM11-1a]
          Length = 162

 Score = 89.3 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 18/91 (19%), Positives = 46/91 (50%), Gaps = 4/91 (4%)

Query: 2   KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
            + ++ +  +++Y+  +RG  E DL+L  F   ++ +++  EL   +S++ E D +++ W
Sbjct: 59  NEPLDKKRARLIYQSRKRGILETDLLLSGFAAKYLKKMNEEELEEYDSLLNELDWDIYYW 118

Query: 62  FT---GMEKPPEYL-RTPIFKKIYDYYSNNL 88
            T        P+    + + K++ ++  N  
Sbjct: 119 ATKNFKTSPLPDKWANSKLLKQLQEFSENKE 149


>gi|6324501|ref|NP_014570.1| Emi5p [Saccharomyces cerevisiae S288c]
 gi|73620872|sp|Q08230|SDHF2_YEAST RecName: Full=Succinate dehydrogenase assembly factor 2,
           mitochondrial; Short=SDH assembly factor 2; AltName:
           Full=Early meiotic induction protein 5; AltName:
           Full=Succinate dehydrogenase subunit 5, mitochondrial;
           Flags: Precursor
 gi|1419897|emb|CAA99081.1| unnamed protein product [Saccharomyces cerevisiae]
 gi|256273938|gb|EEU08857.1| Emi5p [Saccharomyces cerevisiae JAY291]
 gi|285814819|tpg|DAA10712.1| TPA: Emi5p [Saccharomyces cerevisiae S288c]
          Length = 162

 Score = 88.9 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 18/91 (19%), Positives = 46/91 (50%), Gaps = 4/91 (4%)

Query: 2   KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
            + ++ +  +++Y+  +RG  E DL+L  F   ++ +++  EL   +S++ E D +++ W
Sbjct: 59  NEPLDKKRARLIYQSRKRGILETDLLLSGFAAKYLKKMNEEELEEYDSLLNELDWDIYYW 118

Query: 62  FT---GMEKPPEYL-RTPIFKKIYDYYSNNL 88
            T        P+    + + K++ ++  N  
Sbjct: 119 ATKNFKTSPLPDKWANSKLLKQLQEFSENKE 149


>gi|71003003|ref|XP_756182.1| hypothetical protein UM00035.1 [Ustilago maydis 521]
 gi|46096187|gb|EAK81420.1| hypothetical protein UM00035.1 [Ustilago maydis 521]
          Length = 249

 Score = 88.9 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 19/93 (20%), Positives = 41/93 (44%), Gaps = 6/93 (6%)

Query: 2   KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
            +    +  +++Y+  +RGT E DL+L +F    +  L   EL   + +++E D ++F W
Sbjct: 148 SEARETKIARLIYQTRKRGTLETDLLLSTFAKKELKNLPDAELDEFDRLLDEPDWDIFYW 207

Query: 62  FTGMEKPPEYL------RTPIFKKIYDYYSNNL 88
            T  +  P            +  ++  +  N+ 
Sbjct: 208 CTQRKPIPARWAHSFNTAGKLGHRLVAHTRNDE 240


>gi|89071274|ref|ZP_01158445.1| TPR repeat family protein [Oceanicola granulosus HTCC2516]
 gi|89043204|gb|EAR49437.1| TPR repeat family protein [Oceanicola granulosus HTCC2516]
          Length = 87

 Score = 88.9 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 23/64 (35%), Positives = 37/64 (57%)

Query: 1  MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
          M +    + +++  R  RRG +EMDL+L +F D  +  LS  EL   E ++EE D +L+ 
Sbjct: 1  MSERHETRLKRLRMRSMRRGMKEMDLLLMAFADARLAGLSGSELDAYERLLEESDQDLYA 60

Query: 61 WFTG 64
          W +G
Sbjct: 61 WISG 64


>gi|260947060|ref|XP_002617827.1| hypothetical protein CLUG_01286 [Clavispora lusitaniae ATCC 42720]
 gi|238847699|gb|EEQ37163.1| hypothetical protein CLUG_01286 [Clavispora lusitaniae ATCC 42720]
          Length = 141

 Score = 88.9 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 21/89 (23%), Positives = 45/89 (50%), Gaps = 4/89 (4%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
           + + ++  ++ Y+  +RG  E DL+L  F    +   +  +L   +S+++E D +++ W 
Sbjct: 42  ETLEIKRARLTYQSRKRGILESDLLLSRFAKKHLHTFNMEQLDEYDSLLDEADWDIYYWA 101

Query: 63  TG---MEKPPEYL-RTPIFKKIYDYYSNN 87
           TG   +   PE    + + KK+ +   NN
Sbjct: 102 TGNYDVTPIPEKWKNSEVMKKLQEDTQNN 130


>gi|289741397|gb|ADD19446.1| uncharacterized conserved protein [Glossina morsitans morsitans]
          Length = 167

 Score = 88.9 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 18/87 (20%), Positives = 46/87 (52%), Gaps = 2/87 (2%)

Query: 2   KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIE--EDDSNLF 59
            + ++++ ++++Y+  +RG  E DL+L +F   ++ +LS       +S+I    +D +++
Sbjct: 68  NEPLDIKKQRLLYQSRKRGMLENDLLLSTFAAKYLKDLSGELTEQYDSLINGVTNDWDIY 127

Query: 60  KWFTGMEKPPEYLRTPIFKKIYDYYSN 86
            W T ++  P      I + + ++  N
Sbjct: 128 YWATNVKPTPPEHDNEIMRMLKEHVLN 154


>gi|327308212|ref|XP_003238797.1| TPR repeat protein [Trichophyton rubrum CBS 118892]
 gi|326459053|gb|EGD84506.1| TPR repeat protein [Trichophyton rubrum CBS 118892]
          Length = 261

 Score = 88.9 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 16/73 (21%), Positives = 42/73 (57%), Gaps = 2/73 (2%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
           ++ + +  +++Y+  +RGT E DL+L +F   ++ +++  +L   +  ++E+D +++ W 
Sbjct: 108 EDNSTKRARLLYQSRKRGTLESDLLLSTFASTYLAKMTGSQLDEYDRFLDENDWDIYYWA 167

Query: 63  TGMEKPPEYLRTP 75
           T  ++PP      
Sbjct: 168 T--QEPPSESEAA 178


>gi|325088091|gb|EGC41401.1| G-protein comlpex beta subunit CpcB [Ajellomyces capsulatus H88]
          Length = 934

 Score = 88.9 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 15/73 (20%), Positives = 37/73 (50%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
           +++     +++Y+  +RG  E DL+L +F    +  ++  +L   +  ++E+D +++ W 
Sbjct: 377 EDIMTMRARLLYQSRKRGILESDLLLSTFASRHLPTMTERQLQEYDKFLDENDWDIYYWA 436

Query: 63  TGMEKPPEYLRTP 75
           T   K P    + 
Sbjct: 437 TQEAKDPSTTDSA 449


>gi|149914340|ref|ZP_01902871.1| TPR repeat family protein [Roseobacter sp. AzwK-3b]
 gi|149811859|gb|EDM71692.1| TPR repeat family protein [Roseobacter sp. AzwK-3b]
          Length = 88

 Score = 88.9 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 20/80 (25%), Positives = 42/80 (52%), Gaps = 1/80 (1%)

Query: 2  KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
          +++ + + R++  R  RRG +EMD+IL  + +  +  L   +L + + ++ E+D +L++W
Sbjct: 3  EEDRDTRLRRLHMRSIRRGIKEMDIILTRYSEARLAALGPDQLDLYDRLLWENDQDLYQW 62

Query: 62 FTGMEKPPEYLRTPIFKKIY 81
           TG    P      +   I 
Sbjct: 63 VTGQVAAPVDY-ADLVADIA 81


>gi|24586533|ref|NP_610363.1| CG14757 [Drosophila melanogaster]
 gi|122083845|sp|Q4V5I9|SDF2A_DROME RecName: Full=Succinate dehydrogenase assembly factor 2-A,
           mitochondrial; Short=SDH assembly factor 2-A; AltName:
           Full=Succinate dehydrogenase subunit 5-A, mitochondrial;
           Flags: Precursor
 gi|21627712|gb|AAF59116.2| CG14757 [Drosophila melanogaster]
 gi|66771543|gb|AAY55083.1| IP07694p [Drosophila melanogaster]
 gi|220951654|gb|ACL88370.1| CG14757-PA [synthetic construct]
          Length = 163

 Score = 88.9 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 17/87 (19%), Positives = 43/87 (49%), Gaps = 2/87 (2%)

Query: 2   KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIE--EDDSNLF 59
            + +  + ++++Y+  +RG  E DL+L +F    +   S+ +    + +I    +D +++
Sbjct: 63  NEPLETRKQRLLYQSRKRGMLENDLLLSTFAAKHLQNFSAEQTAQYDQLINGVSNDWDIY 122

Query: 60  KWFTGMEKPPEYLRTPIFKKIYDYYSN 86
            W T ++  P+   T I   + ++  N
Sbjct: 123 YWATEVKPTPKEYDTEIMGLLKEHVKN 149


>gi|323303142|gb|EGA56944.1| Emi5p [Saccharomyces cerevisiae FostersB]
          Length = 162

 Score = 88.9 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 18/91 (19%), Positives = 46/91 (50%), Gaps = 4/91 (4%)

Query: 2   KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
            + ++ +  +++Y+  +RG  E DL+L  F   ++ +++  EL   +S++ E D +++ W
Sbjct: 59  NEPLDKKRARLIYQSRKRGILETDLLLSGFAAKYLKKMNEEELEEYDSLLNELDWDIYYW 118

Query: 62  FT---GMEKPPEYL-RTPIFKKIYDYYSNNL 88
            T        P+    + + K++ ++  N  
Sbjct: 119 ATKNFKTSPLPDKWXNSKLLKQLQEFSENKE 149


>gi|255712621|ref|XP_002552593.1| KLTH0C08514p [Lachancea thermotolerans]
 gi|238933972|emb|CAR22155.1| KLTH0C08514p [Lachancea thermotolerans]
          Length = 159

 Score = 88.9 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 20/89 (22%), Positives = 44/89 (49%), Gaps = 4/89 (4%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
           + +  +  ++VY+  +RG  E DL+L  F   ++  ++  EL   +++++E D +++ W 
Sbjct: 58  ETLENKRARLVYQSRKRGILETDLLLSRFAAKYLSSMTPEELEEYDALLDELDWDIYYWA 117

Query: 63  TGM---EKPPEYL-RTPIFKKIYDYYSNN 87
           T        PE    + +  K+ D+  N 
Sbjct: 118 TKNYAITPLPERFKDSKLLAKLQDFSENK 146


>gi|145229999|ref|XP_001389308.1| succinate dehydrogenase assembly factor 2 [Aspergillus niger CBS
           513.88]
 gi|134055422|emb|CAK37131.1| unnamed protein product [Aspergillus niger]
          Length = 302

 Score = 88.9 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 16/74 (21%), Positives = 41/74 (55%), Gaps = 1/74 (1%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
           +++     +++Y+  +RG  E DL+L +F D ++ +++  +L   +  ++E+D +++ W 
Sbjct: 143 EDVTTMRARLLYQSRKRGILESDLLLSTFADVYLADMNKEQLQEYDRFLDENDWDIYYWA 202

Query: 63  TGMEKPPEYLRTPI 76
           T  + P E     +
Sbjct: 203 T-QDPPAEGNEAAV 215


>gi|198430883|ref|XP_002124208.1| PREDICTED: similar to AGAP012191-PA [Ciona intestinalis]
          Length = 158

 Score = 88.5 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 15/88 (17%), Positives = 42/88 (47%), Gaps = 2/88 (2%)

Query: 2   KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIE--EDDSNLF 59
            +++  +  ++ ++  +RG  E  LI  +F   ++   S  ++ + + I+    +D +++
Sbjct: 50  NESITKKRARLHWQSRKRGISENCLIFSTFAAKYLNSFSPEQIEIYDKILNKPNNDWDVY 109

Query: 60  KWFTGMEKPPEYLRTPIFKKIYDYYSNN 87
            W  G +  P   ++ I   + ++  NN
Sbjct: 110 YWMVGTKNVPNEYQSEIMDMLQEHCRNN 137


>gi|58258883|ref|XP_566854.1| mitochondrion protein [Cryptococcus neoformans var. neoformans
           JEC21]
 gi|58258885|ref|XP_566855.1| mitochondrion protein [Cryptococcus neoformans var. neoformans
           JEC21]
 gi|134106877|ref|XP_777980.1| hypothetical protein CNBA4490 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|74687618|sp|Q5KP03|SDHF2_CRYNE RecName: Full=Succinate dehydrogenase assembly factor 2,
           mitochondrial; Short=SDH assembly factor 2; AltName:
           Full=Early meiotic induction protein 5; AltName:
           Full=Succinate dehydrogenase subunit 5, mitochondrial;
           Flags: Precursor
 gi|50260680|gb|EAL23333.1| hypothetical protein CNBA4490 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|57222991|gb|AAW41035.1| mitochondrion protein, putative [Cryptococcus neoformans var.
           neoformans JEC21]
 gi|57222992|gb|AAW41036.1| mitochondrion protein, putative [Cryptococcus neoformans var.
           neoformans JEC21]
          Length = 175

 Score = 88.5 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 21/86 (24%), Positives = 43/86 (50%), Gaps = 1/86 (1%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
           ++      +++Y+  +RGT E DLIL +F    +  +   E+   + +++E D ++F W 
Sbjct: 73  EDEKTLRARLIYQTRKRGTLETDLILSTFARDELPNMDFEEMKQFDKLLDEPDWDIFYWS 132

Query: 63  TGMEKPPEYLR-TPIFKKIYDYYSNN 87
                PP   + TP+ +K+  +  N 
Sbjct: 133 VKKRDPPARWKGTPLLEKLQKHAKNE 158


>gi|225559027|gb|EEH07310.1| G-protein comlpex beta subunit CpcB [Ajellomyces capsulatus G186AR]
          Length = 934

 Score = 88.5 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 15/73 (20%), Positives = 37/73 (50%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
           +++     +++Y+  +RG  E DL+L +F    +  ++  +L   +  ++E+D +++ W 
Sbjct: 377 EDIMTMRARLLYQSRKRGILESDLLLSTFASRHLPTMTERQLQEYDKFLDENDWDIYYWA 436

Query: 63  TGMEKPPEYLRTP 75
           T   K P    + 
Sbjct: 437 TQEAKDPSTTDSA 449


>gi|240281951|gb|EER45454.1| TPR domain-containing protein [Ajellomyces capsulatus H143]
          Length = 543

 Score = 88.5 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 15/73 (20%), Positives = 37/73 (50%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
           +++     +++Y+  +RG  E DL+L +F    +  ++  +L   +  ++E+D +++ W 
Sbjct: 377 EDIMTMRARLLYQSRKRGILESDLLLSTFASRHLPTMTERQLQEYDKFLDENDWDIYYWA 436

Query: 63  TGMEKPPEYLRTP 75
           T   K P    + 
Sbjct: 437 TQEAKDPSTTDSA 449


>gi|241949487|ref|XP_002417466.1| meiotic induction transactivator, putative [Candida dubliniensis
           CD36]
 gi|257096770|sp|B9W8P6|SDHF2_CANDC RecName: Full=Succinate dehydrogenase assembly factor 2,
           mitochondrial; Short=SDH assembly factor 2; AltName:
           Full=Early meiotic induction protein 5; AltName:
           Full=Succinate dehydrogenase subunit 5, mitochondrial;
           Flags: Precursor
 gi|223640804|emb|CAX45119.1| meiotic induction transactivator, putative [Candida dubliniensis
           CD36]
          Length = 155

 Score = 88.5 bits (219), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 22/95 (23%), Positives = 49/95 (51%), Gaps = 5/95 (5%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
           + + ++  +++Y+  +RG  E DL+L  F D ++  ++  EL   + +++E D +++ W 
Sbjct: 48  ETIEVKRARLLYQSRKRGILESDLLLSRFADKYLKTMTMEELDEYDKLLDEADWDIYYWA 107

Query: 63  TGM---EKPPEYL-RTPIFKKIYDYYSNNLDRKNM 93
           T        P+    + I K+I    +NN ++  M
Sbjct: 108 TKNYKITPLPDKWKDSKILKEIQ-KIANNEEKVIM 141


>gi|312220770|emb|CBY00711.1| similar to TPR repeat protein [Leptosphaeria maculans]
          Length = 318

 Score = 88.5 bits (219), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 20/73 (27%), Positives = 38/73 (52%), Gaps = 1/73 (1%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
           ++ N    +++Y+  +RGT E DL+L +F D  +  +S   L   +  ++E+D +++ W 
Sbjct: 145 EDANTMRARLLYQSRKRGTLESDLLLSTFADAHLSTMSVTVLEQYDLFLDENDWDIYYWA 204

Query: 63  TGMEKPPEYLRTP 75
           T  E  P    T 
Sbjct: 205 T-QEPTPTSHETA 216


>gi|254568218|ref|XP_002491219.1| Essential Hsp90p co-chaperone [Pichia pastoris GS115]
 gi|257096794|sp|C4R0B5|SDHF2_PICPG RecName: Full=Succinate dehydrogenase assembly factor 2,
           mitochondrial; Short=SDH assembly factor 2; AltName:
           Full=Early meiotic induction protein 5; AltName:
           Full=Succinate dehydrogenase subunit 5, mitochondrial;
           Flags: Precursor
 gi|238031016|emb|CAY68939.1| Essential Hsp90p co-chaperone [Pichia pastoris GS115]
 gi|328352260|emb|CCA38659.1| Uncharacterized protein C12B10.06c [Pichia pastoris CBS 7435]
          Length = 190

 Score = 88.5 bits (219), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 21/92 (22%), Positives = 46/92 (50%), Gaps = 4/92 (4%)

Query: 2   KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
            ++ +++ R++VY+  +RG  E DL+L  F   ++  +S  E+   + ++ E D +++ W
Sbjct: 87  NESEDVKRRRLVYQSRKRGILETDLLLSRFAKRYLPTMSVEEMEEYDDLLNELDWDIYYW 146

Query: 62  FT---GMEKPPEYL-RTPIFKKIYDYYSNNLD 89
                 +   PE    + I  K+ +  +NN  
Sbjct: 147 AVKNYEVTPLPEKWKDSKILAKLQEMSANNEG 178


>gi|321249321|ref|XP_003191419.1| mitochondrion protein [Cryptococcus gattii WM276]
 gi|317457886|gb|ADV19632.1| mitochondrion protein, putative [Cryptococcus gattii WM276]
          Length = 175

 Score = 88.5 bits (219), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 21/86 (24%), Positives = 43/86 (50%), Gaps = 1/86 (1%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
           ++      +++Y+  +RGT E DLIL +F    + ++   E+   + +++E D ++F W 
Sbjct: 73  EDEKTLRARLIYQTRKRGTLETDLILSTFARDELPKMDFKEMKQFDKLLDEPDWDIFYWS 132

Query: 63  TGMEKPPEYLRT-PIFKKIYDYYSNN 87
               +PP      PI +K+  +  N 
Sbjct: 133 VEKREPPARWNGSPILEKLKKHAKNE 158


>gi|119499940|ref|XP_001266727.1| TPR repeat protein [Neosartorya fischeri NRRL 181]
 gi|119414892|gb|EAW24830.1| TPR repeat protein [Neosartorya fischeri NRRL 181]
          Length = 295

 Score = 88.5 bits (219), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 17/73 (23%), Positives = 40/73 (54%), Gaps = 2/73 (2%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
           ++      +++Y+  +RG  E DL+L +F D ++ +++  +L   +  ++E+D +++ W 
Sbjct: 143 EDPATMRARLLYQSRKRGILESDLLLSTFADVYLKDMTPEQLQEYDRFLDENDWDIYYWA 202

Query: 63  TGMEKPPEYLRTP 75
           T  + PP     P
Sbjct: 203 T--QDPPSSTDGP 213


>gi|254451743|ref|ZP_05065180.1| conserved hypothetical protein [Octadecabacter antarcticus 238]
 gi|198266149|gb|EDY90419.1| conserved hypothetical protein [Octadecabacter antarcticus 238]
          Length = 78

 Score = 88.5 bits (219), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 20/69 (28%), Positives = 36/69 (52%), Gaps = 1/69 (1%)

Query: 14 YRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPEYLR 73
           R  RRG +EMDLIL  F    + +L + +L + + ++ E+D +L++W +G    P    
Sbjct: 1  MRSIRRGIKEMDLILTGFSKAHLAQLGAAQLAVYDRMLNENDHDLYQWVSGQSDEPPEYS 60

Query: 74 TPIFKKIYD 82
            +   I +
Sbjct: 61 G-LMDMIRE 68


>gi|195332394|ref|XP_002032883.1| GM20711 [Drosophila sechellia]
 gi|195581493|ref|XP_002080568.1| GD10178 [Drosophila simulans]
 gi|257096753|sp|B4HRL4|SDF2A_DROSE RecName: Full=Succinate dehydrogenase assembly factor 2-A,
           mitochondrial; Short=SDH assembly factor 2-A; AltName:
           Full=Succinate dehydrogenase subunit 5-A, mitochondrial;
           Flags: Precursor
 gi|257096754|sp|B4QFP7|SDF2A_DROSI RecName: Full=Succinate dehydrogenase assembly factor 2-A,
           mitochondrial; Short=SDH assembly factor 2-A; AltName:
           Full=Succinate dehydrogenase subunit 5-A, mitochondrial;
           Flags: Precursor
 gi|194124853|gb|EDW46896.1| GM20711 [Drosophila sechellia]
 gi|194192577|gb|EDX06153.1| GD10178 [Drosophila simulans]
          Length = 163

 Score = 88.5 bits (219), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 17/87 (19%), Positives = 43/87 (49%), Gaps = 2/87 (2%)

Query: 2   KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIE--EDDSNLF 59
            + +  + ++++Y+  +RG  E DL+L +F    +   S+ +    + +I    +D +++
Sbjct: 63  NEPLETRKQRLLYQSRKRGMLENDLLLSTFAAKHLQNFSAEQTAQYDQLINGVSNDWDIY 122

Query: 60  KWFTGMEKPPEYLRTPIFKKIYDYYSN 86
            W T ++  P+   T I   + ++  N
Sbjct: 123 YWATEVKPTPKEYDTEIMGLLKEHVKN 149


>gi|326478048|gb|EGE02058.1| hypothetical protein TEQG_01098 [Trichophyton equinum CBS 127.97]
          Length = 259

 Score = 88.2 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 16/73 (21%), Positives = 42/73 (57%), Gaps = 2/73 (2%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
           ++ + +  +++Y+  +RGT E DL+L +F   ++ +++  +L   +  ++E+D +++ W 
Sbjct: 106 EDNSTKRARLLYQSRKRGTLESDLLLSTFASTYLGKMTGSQLDEYDRFLDENDWDIYYWA 165

Query: 63  TGMEKPPEYLRTP 75
           T  ++PP      
Sbjct: 166 T--QEPPSESEAA 176


>gi|255070871|ref|XP_002507517.1| hypothetical protein MICPUN_113604 [Micromonas sp. RCC299]
 gi|226522792|gb|ACO68775.1| hypothetical protein MICPUN_113604 [Micromonas sp. RCC299]
          Length = 157

 Score = 88.2 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 24/84 (28%), Positives = 46/84 (54%), Gaps = 1/84 (1%)

Query: 9   CRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKP 68
             K++YR  +RG  E+D+++G++ +  +   S         I++E++  LF+W T  E+P
Sbjct: 53  LNKLIYRAKQRGFLELDILIGTWAECNLSSRSQGFWAEFSEILDEENPELFRWLTCQEQP 112

Query: 69  PEYL-RTPIFKKIYDYYSNNLDRK 91
           P  + R   F  ++ Y S+ + RK
Sbjct: 113 PPRMTRNRAFISLHAYTSSLMRRK 136


>gi|326470793|gb|EGD94802.1| hypothetical protein TESG_02307 [Trichophyton tonsurans CBS 112818]
          Length = 258

 Score = 88.2 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 16/73 (21%), Positives = 42/73 (57%), Gaps = 2/73 (2%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
           ++ + +  +++Y+  +RGT E DL+L +F   ++ +++  +L   +  ++E+D +++ W 
Sbjct: 105 EDNSTKRARLLYQSRKRGTLESDLLLSTFASTYLGKMTGSQLDEYDRFLDENDWDIYYWA 164

Query: 63  TGMEKPPEYLRTP 75
           T  ++PP      
Sbjct: 165 T--QEPPSESEAA 175


>gi|68464673|ref|XP_723414.1| hypothetical protein CaO19.4727 [Candida albicans SC5314]
 gi|46445447|gb|EAL04715.1| hypothetical protein CaO19.4727 [Candida albicans SC5314]
 gi|238878710|gb|EEQ42348.1| conserved hypothetical protein [Candida albicans WO-1]
          Length = 155

 Score = 88.2 bits (218), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 20/90 (22%), Positives = 46/90 (51%), Gaps = 4/90 (4%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
           + + ++  +++Y+  +RG  E DL+L  F D ++  ++  EL   + +++E D +++ W 
Sbjct: 48  ETIEVKRARLLYQSRKRGILESDLLLSRFADKYLKTMTMEELDEYDKLLDEADWDIYYWA 107

Query: 63  TGM---EKPPEYL-RTPIFKKIYDYYSNNL 88
           T        P+    + I K+I    +N+ 
Sbjct: 108 TKNYKITPLPDKWKDSKILKEIQKIANNDE 137


>gi|302675735|ref|XP_003027551.1| hypothetical protein SCHCODRAFT_40518 [Schizophyllum commune
          H4-8]
 gi|300101238|gb|EFI92648.1| hypothetical protein SCHCODRAFT_40518 [Schizophyllum commune
          H4-8]
          Length = 103

 Score = 88.2 bits (218), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 22/86 (25%), Positives = 47/86 (54%), Gaps = 1/86 (1%)

Query: 3  KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
          +++     ++VY+  +RGT E DL+L +F    +  ++  E+   + +++E D +++ W 
Sbjct: 8  ESVEKMRARLVYQSRKRGTLESDLLLSTFARDNLSTMTEDEMREYDKLLDEPDWDIYYWA 67

Query: 63 TGMEKPPEYLR-TPIFKKIYDYYSNN 87
          TG   PPE  + + + KK+  +  N 
Sbjct: 68 TGKRTPPERWQESQLLKKLAVHAKNE 93


>gi|154273517|ref|XP_001537610.1| conserved hypothetical protein [Ajellomyces capsulatus NAm1]
 gi|150415218|gb|EDN10571.1| conserved hypothetical protein [Ajellomyces capsulatus NAm1]
          Length = 308

 Score = 88.2 bits (218), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 15/73 (20%), Positives = 37/73 (50%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
           +++     +++Y+  +RG  E DL+L +F    +  ++  +L   +  ++E+D +++ W 
Sbjct: 142 EDIMTMRARLLYQSRKRGILESDLLLSTFASRHLPTMTERQLQEYDKFLDENDWDIYYWA 201

Query: 63  TGMEKPPEYLRTP 75
           T   K P    + 
Sbjct: 202 TQEAKDPSMTDSA 214


>gi|70993332|ref|XP_751513.1| TPR repeat protein [Aspergillus fumigatus Af293]
 gi|66849147|gb|EAL89475.1| TPR repeat protein [Aspergillus fumigatus Af293]
 gi|159125553|gb|EDP50670.1| TPR repeat protein [Aspergillus fumigatus A1163]
          Length = 295

 Score = 88.2 bits (218), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 17/73 (23%), Positives = 41/73 (56%), Gaps = 2/73 (2%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
           ++      +++Y+  +RG  E DL+L +F D ++ +++  +L   +  ++E+D +++ W 
Sbjct: 143 EDPATMRARLLYQSRKRGILESDLLLSTFADVYLKDMTPEQLQEYDRFLDENDWDIYYWA 202

Query: 63  TGMEKPPEYLRTP 75
           T  + PP    +P
Sbjct: 203 T--QDPPSATDSP 213


>gi|45190803|ref|NP_985057.1| AER200Cp [Ashbya gossypii ATCC 10895]
 gi|74693456|sp|Q756Q4|SDHF2_ASHGO RecName: Full=Succinate dehydrogenase assembly factor 2,
           mitochondrial; Short=SDH assembly factor 2; AltName:
           Full=Early meiotic induction protein 5; AltName:
           Full=Succinate dehydrogenase subunit 5, mitochondrial;
           Flags: Precursor
 gi|44983845|gb|AAS52881.1| AER200Cp [Ashbya gossypii ATCC 10895]
          Length = 160

 Score = 88.2 bits (218), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 22/90 (24%), Positives = 44/90 (48%), Gaps = 4/90 (4%)

Query: 2   KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
            + +  Q  ++VY+  +RG  E DL+L  F   ++  +++ EL   + ++ E D +++ W
Sbjct: 58  NETLEQQRARLVYQSRKRGILETDLLLSGFAAKYLKHMTAEELNEYDELLNELDWDIYYW 117

Query: 62  FTG---MEKPPEYLR-TPIFKKIYDYYSNN 87
            T        PE  + + I +K+  Y  N 
Sbjct: 118 ATKNSDASPLPEKWQHSKILRKLQAYSENK 147


>gi|68465050|ref|XP_723224.1| hypothetical protein CaO19.12190 [Candida albicans SC5314]
 gi|46445250|gb|EAL04519.1| hypothetical protein CaO19.12190 [Candida albicans SC5314]
          Length = 155

 Score = 88.2 bits (218), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 20/90 (22%), Positives = 46/90 (51%), Gaps = 4/90 (4%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
           + + ++  +++Y+  +RG  E DL+L  F D ++  ++  EL   + +++E D +++ W 
Sbjct: 48  ETIEVKRARLLYQSRKRGILESDLLLSRFADKYLKTMTMEELDEYDKLLDEADWDIYYWA 107

Query: 63  TGM---EKPPEYL-RTPIFKKIYDYYSNNL 88
           T        P+    + I K+I    +N+ 
Sbjct: 108 TKNYKITPLPDKWKDSKILKEIQKIANNDE 137


>gi|194863553|ref|XP_001970497.1| GG10665 [Drosophila erecta]
 gi|257096749|sp|B3N8S9|SDF2A_DROER RecName: Full=Succinate dehydrogenase assembly factor 2-A,
           mitochondrial; Short=SDH assembly factor 2-A; AltName:
           Full=Succinate dehydrogenase subunit 5-A, mitochondrial;
           Flags: Precursor
 gi|190662364|gb|EDV59556.1| GG10665 [Drosophila erecta]
          Length = 162

 Score = 87.8 bits (217), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 17/87 (19%), Positives = 43/87 (49%), Gaps = 2/87 (2%)

Query: 2   KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIE--EDDSNLF 59
            + +  + ++++Y+  +RG  E DL+L +F    +   S+ +    + +I    +D +++
Sbjct: 62  NEPLQTRKQRLLYQSRKRGMLENDLLLSTFAAKHLQSFSAEQTAQYDQLINGVSNDWDIY 121

Query: 60  KWFTGMEKPPEYLRTPIFKKIYDYYSN 86
            W T ++  P+   T I   + ++  N
Sbjct: 122 YWATDVKPTPKEYDTEIMGLLKEHVKN 148


>gi|67527801|ref|XP_661768.1| hypothetical protein AN4164.2 [Aspergillus nidulans FGSC A4]
 gi|40740235|gb|EAA59425.1| hypothetical protein AN4164.2 [Aspergillus nidulans FGSC A4]
 gi|259481239|tpe|CBF74574.1| TPA: TPR repeat protein (AFU_orthologue; AFUA_4G13180) [Aspergillus
           nidulans FGSC A4]
          Length = 296

 Score = 87.8 bits (217), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 16/69 (23%), Positives = 41/69 (59%), Gaps = 2/69 (2%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
           ++++    +++Y+  +RG  E DL+L +F D ++ +++  +L   +  ++E+D +++ W 
Sbjct: 141 EDISTMRARLLYQSRKRGILESDLLLSTFADVYLADMNKEQLQEYDRFLDENDWDIYYWA 200

Query: 63  TGMEKPPEY 71
           T  + PP  
Sbjct: 201 T--QDPPAE 207


>gi|115389748|ref|XP_001212379.1| conserved hypothetical protein [Aspergillus terreus NIH2624]
 gi|121740191|sp|Q0CSY3|SDHF2_ASPTN RecName: Full=Succinate dehydrogenase assembly factor 2,
           mitochondrial; Short=SDH assembly factor 2; AltName:
           Full=Early meiotic induction protein 5; AltName:
           Full=Succinate dehydrogenase subunit 5, mitochondrial;
           Flags: Precursor
 gi|114194775|gb|EAU36475.1| conserved hypothetical protein [Aspergillus terreus NIH2624]
          Length = 295

 Score = 87.8 bits (217), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 16/69 (23%), Positives = 39/69 (56%), Gaps = 2/69 (2%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
           ++      +++Y+  +RG  E DL+L +F D ++ +++  +L   +  ++E+D +++ W 
Sbjct: 144 EDTTTMRARLLYQSRKRGILESDLLLSTFADVYLAKMNHEQLQEYDRFLDENDWDIYYWA 203

Query: 63  TGMEKPPEY 71
           T  +  PE 
Sbjct: 204 T--QDAPEE 210


>gi|307104767|gb|EFN53019.1| hypothetical protein CHLNCDRAFT_137510 [Chlorella variabilis]
          Length = 141

 Score = 87.8 bits (217), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 24/94 (25%), Positives = 48/94 (51%), Gaps = 4/94 (4%)

Query: 1  MKKNMNLQCR---KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSN 57
          M      Q R   +++YR  +RG  E+DL++G + +  + ++S  ++   E ++ +++ +
Sbjct: 1  MAAQKTAQPRLVNRLLYRSRQRGFLELDLLVGMWAEKELPQMSVEQMREFEVVLGQENPD 60

Query: 58 LFKWFTGMEKPPEYLR-TPIFKKIYDYYSNNLDR 90
          +FKW T   + PE LR    F  +  +     DR
Sbjct: 61 MFKWLTAQAEAPEELRHNRTFAALQAHVQALRDR 94


>gi|195024675|ref|XP_001985919.1| GH20828 [Drosophila grimshawi]
 gi|257096772|sp|B4J5U3|SDHF2_DROGR RecName: Full=Succinate dehydrogenase assembly factor 2,
           mitochondrial; Short=SDH assembly factor 2; AltName:
           Full=Succinate dehydrogenase subunit 5, mitochondrial;
           Flags: Precursor
 gi|193901919|gb|EDW00786.1| GH20828 [Drosophila grimshawi]
          Length = 147

 Score = 87.8 bits (217), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 18/87 (20%), Positives = 45/87 (51%), Gaps = 2/87 (2%)

Query: 2   KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIE--EDDSNLF 59
            + + ++ ++++Y+  +RG  E DL+L +F   ++ +    E  + + +I    +D +++
Sbjct: 45  NEPLGMRKQRLLYQSRKRGMLENDLLLSTFAHKYLKDFDEDETAIYDELINGVSNDWDIY 104

Query: 60  KWFTGMEKPPEYLRTPIFKKIYDYYSN 86
            W TG++  P    T I + +  +  N
Sbjct: 105 YWATGVKPTPPQYETDIMELLKQHVKN 131


>gi|170071902|ref|XP_001870041.1| conserved hypothetical protein [Culex quinquefasciatus]
 gi|257096771|sp|B0XK69|SDHF2_CULQU RecName: Full=Succinate dehydrogenase assembly factor 2,
           mitochondrial; Short=SDH assembly factor 2; AltName:
           Full=Succinate dehydrogenase subunit 5, mitochondrial;
           Flags: Precursor
 gi|167867993|gb|EDS31376.1| conserved hypothetical protein [Culex quinquefasciatus]
          Length = 159

 Score = 87.8 bits (217), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 19/87 (21%), Positives = 45/87 (51%), Gaps = 2/87 (2%)

Query: 2   KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEE--DDSNLF 59
            + + LQ  +++Y+  +RG  E  L+L +F   ++  L + +  + +++I    +D ++F
Sbjct: 60  NEPLKLQKSRLLYQSRKRGMLENGLLLSTFAAKYLESLDARQTKLYDTLINMPTNDWDIF 119

Query: 60  KWFTGMEKPPEYLRTPIFKKIYDYYSN 86
            W TG++  P+     I   + ++  N
Sbjct: 120 YWATGVKPTPQEYDNEIMNMLKEHVKN 146


>gi|46137249|ref|XP_390316.1| hypothetical protein FG10140.1 [Gibberella zeae PH-1]
          Length = 217

 Score = 87.4 bits (216), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 22/82 (26%), Positives = 41/82 (50%), Gaps = 4/82 (4%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
           ++   +  ++VY+  +RGT E DL+L +F    +  LS   L   + I++E+D +++ W 
Sbjct: 61  EDDATKRARLVYQSRKRGTLESDLLLSTFASAHLASLSPELLDQYDRILDENDWDIYYWA 120

Query: 63  TGMEKP----PEYLRTPIFKKI 80
           T  E+     P    +P    I
Sbjct: 121 TQKEELSSTNPSSADSPSTSNI 142


>gi|209880044|ref|XP_002141462.1| TPR repeat-containing protein [Cryptosporidium muris RN66]
 gi|209557068|gb|EEA07113.1| TPR repeat-containing protein [Cryptosporidium muris RN66]
          Length = 124

 Score = 87.4 bits (216), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 23/82 (28%), Positives = 45/82 (54%)

Query: 6   NLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGM 65
           N Q +K+ +RC   G +E+D+I  +F D+++ ELS ++L   + ++  +  +L+ W TG 
Sbjct: 38  NTQRQKLRHRCCNTGLKELDIIFKNFSDNYLDELSCIQLKEFDLLLRNETLDLYDWLTGK 97

Query: 66  EKPPEYLRTPIFKKIYDYYSNN 87
              P  ++      +  Y +NN
Sbjct: 98  RSTPSEIKNLTTWNLLTYKTNN 119


>gi|84687909|ref|ZP_01015776.1| TPR repeat family protein [Maritimibacter alkaliphilus HTCC2654]
 gi|84664103|gb|EAQ10600.1| TPR repeat family protein [Rhodobacterales bacterium HTCC2654]
          Length = 86

 Score = 87.4 bits (216), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 24/87 (27%), Positives = 49/87 (56%), Gaps = 1/87 (1%)

Query: 1  MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
          M +    + +++  R WRRGT+EMD+ILG + D  +  + + +L + ++++ E+D +L++
Sbjct: 1  MNETAENRLKRMNMRSWRRGTKEMDMILGPYSDDRLATMDAADLDLYDALLLENDQDLYQ 60

Query: 61 WFTGMEKPPEYLRTPIFKKIYDYYSNN 87
          W +G    PE     +   I D+ +  
Sbjct: 61 WVSGQVPAPERFAG-LIATIADHAAAK 86


>gi|254455903|ref|ZP_05069332.1| conserved hypothetical protein [Candidatus Pelagibacter sp.
          HTCC7211]
 gi|207082905|gb|EDZ60331.1| conserved hypothetical protein [Candidatus Pelagibacter sp.
          HTCC7211]
          Length = 89

 Score = 87.4 bits (216), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 31/89 (34%), Positives = 54/89 (60%)

Query: 1  MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
          M  N++   +KI+YR   RGT+EMD +LG+F   +I +L+  EL  LE +++ DD++L+ 
Sbjct: 1  MNFNIDQLKKKIIYRSNYRGTKEMDKLLGAFTKKYINQLNQDELIDLEKLLDIDDTSLYN 60

Query: 61 WFTGMEKPPEYLRTPIFKKIYDYYSNNLD 89
          +F G++   +   T + K   ++  NN D
Sbjct: 61 FFNGIDNEIKIDETNVLKLFKNFKYNNED 89


>gi|212535072|ref|XP_002147692.1| TPR repeat protein [Penicillium marneffei ATCC 18224]
 gi|210070091|gb|EEA24181.1| TPR repeat protein [Penicillium marneffei ATCC 18224]
          Length = 267

 Score = 87.4 bits (216), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 17/69 (24%), Positives = 38/69 (55%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
           ++ +    +++Y+  +RG  E DL+L +F D ++  +S  +L   +  ++E+D +++ W 
Sbjct: 104 EDTSTMRARLLYQSRKRGILETDLLLSTFADVYLGNMSKEQLQQYDKFLDENDWDIYYWA 163

Query: 63  TGMEKPPEY 71
           T   K  E 
Sbjct: 164 TQEPKAAEE 172


>gi|324519048|gb|ADY47274.1| Succinate dehydrogenase assembly factor 2 [Ascaris suum]
          Length = 145

 Score = 87.0 bits (215), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 25/88 (28%), Positives = 49/88 (55%), Gaps = 3/88 (3%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEED--DSNLFK 60
           +       +++Y+  +RG  E D+I+G F    + ++S  EL   +SII  D  + +LF 
Sbjct: 53  EETETLRARLLYQSKKRGILENDIIIGGFAQEALADMSREELLEYDSIINGDHMEWDLFY 112

Query: 61  WFTGMEKPPEYLR-TPIFKKIYDYYSNN 87
           + +G ++PP+ L+ + IF++I +Y    
Sbjct: 113 FMSGKKEPPKELQESAIFRRIQEYIKKK 140


>gi|300023170|ref|YP_003755781.1| hypothetical protein Hden_1653 [Hyphomicrobium denitrificans ATCC
          51888]
 gi|299524991|gb|ADJ23460.1| protein of unknown function DUF339 [Hyphomicrobium denitrificans
          ATCC 51888]
          Length = 90

 Score = 87.0 bits (215), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 21/85 (24%), Positives = 37/85 (43%), Gaps = 1/85 (1%)

Query: 1  MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
          M  +++++ R+  YR   RGT+EMDL++G + D  I   S   +   E  +   D  L  
Sbjct: 1  MADDLDVRRRRASYRAHHRGTKEMDLLVGRYADVRIPAWSEEAVQHFERFLNLPDPLLQA 60

Query: 61 WFTGMEKPPEYLRTPIFKKIYDYYS 85
          W    E      +  +   I  ++ 
Sbjct: 61 WIFSGEPESGEFQ-DLLNDIRVFHR 84


>gi|156383928|ref|XP_001633084.1| predicted protein [Nematostella vectensis]
 gi|156220149|gb|EDO41021.1| predicted protein [Nematostella vectensis]
          Length = 124

 Score = 87.0 bits (215), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 20/87 (22%), Positives = 42/87 (48%), Gaps = 2/87 (2%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEE--DDSNLFK 60
           +   ++  +++Y+  +RG  E  L+L +F D  + E     L   + +I +  +D +L+ 
Sbjct: 17  ETTEMKRARLLYQSRKRGMLENGLLLSTFADRHLDEFDDDLLQQYDYLINQPTNDWDLYY 76

Query: 61  WFTGMEKPPEYLRTPIFKKIYDYYSNN 87
           W T  +  P+   +P+   I D+  N 
Sbjct: 77  WITENKPTPDEYNSPVMDMIKDFAKNE 103


>gi|167515466|ref|XP_001742074.1| hypothetical protein [Monosiga brevicollis MX1]
 gi|163778698|gb|EDQ92312.1| predicted protein [Monosiga brevicollis MX1]
          Length = 172

 Score = 87.0 bits (215), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 26/88 (29%), Positives = 48/88 (54%), Gaps = 3/88 (3%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDD--SNLFK 60
           +N +    ++VY+  +RG +E DLI  +F   ++ +LS  ++  L+ I+ E D   ++F 
Sbjct: 67  ENDDQLRARLVYQARKRGIKENDLIFSTFCHKYLDQLSRPQMEQLDIILNEHDNEWDMFN 126

Query: 61  WFTGMEKPPEYLRT-PIFKKIYDYYSNN 87
           W +G    PEYL+   +F  + D+  N 
Sbjct: 127 WLSGTRPAPEYLKELELFGALVDHTQNR 154


>gi|229365946|gb|ACQ57953.1| EMI5 homolog, mitochondrial precursor [Anoplopoma fimbria]
          Length = 163

 Score = 87.0 bits (215), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 16/94 (17%), Positives = 45/94 (47%), Gaps = 2/94 (2%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEE--DDSNLFK 60
           +  +++ R+++Y   +RG  E  ++L  F   ++  ++  +L   + +I E  +D +++ 
Sbjct: 58  EPTDIKKRRLLYESRKRGMLENCILLSLFAKRYLNTMNENQLLQYDRLINEPSNDWDIYY 117

Query: 61  WFTGMEKPPEYLRTPIFKKIYDYYSNNLDRKNML 94
           W T  +  P+  +  I   + ++  N    + + 
Sbjct: 118 WATEAQPTPDVYQGEIMDMLKEFTKNRNQEQRLD 151


>gi|315054925|ref|XP_003176837.1| early meiotic induction protein 5 [Arthroderma gypseum CBS 118893]
 gi|311338683|gb|EFQ97885.1| early meiotic induction protein 5 [Arthroderma gypseum CBS 118893]
          Length = 261

 Score = 87.0 bits (215), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 16/69 (23%), Positives = 42/69 (60%), Gaps = 2/69 (2%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
           ++ + +  +++Y+  +RGT E DL+L +F   ++ +++  +L   +  ++E+D +++ W 
Sbjct: 108 EDNSTKRARLLYQSRKRGTLESDLLLSTFASTYLGKMTGSQLDEYDRFLDENDWDIYYWA 167

Query: 63  TGMEKPPEY 71
           T  ++PP  
Sbjct: 168 T--QEPPSE 174


>gi|258567462|ref|XP_002584475.1| early meiotic induction protein 5 [Uncinocarpus reesii 1704]
 gi|237905921|gb|EEP80322.1| early meiotic induction protein 5 [Uncinocarpus reesii 1704]
          Length = 574

 Score = 87.0 bits (215), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 17/67 (25%), Positives = 36/67 (53%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
           +++     +++Y+  +RGT E DL+L +F    +  +S  EL   +  ++E+D +++ W 
Sbjct: 415 EDVATMRARLLYQSRKRGTLESDLLLSTFAATNLSTMSKSELEEYDRFLDENDWDIYYWA 474

Query: 63  TGMEKPP 69
           T     P
Sbjct: 475 TQEPPTP 481


>gi|242791990|ref|XP_002481862.1| TPR repeat protein [Talaromyces stipitatus ATCC 10500]
 gi|218718450|gb|EED17870.1| TPR repeat protein [Talaromyces stipitatus ATCC 10500]
          Length = 303

 Score = 87.0 bits (215), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 16/65 (24%), Positives = 37/65 (56%), Gaps = 1/65 (1%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
           ++ +    +++Y+  +RG  E DL+L +F D ++  +S  +L   +  ++E+D +++ W 
Sbjct: 140 EDTSTMRARLLYQSRKRGILETDLLLSTFADVYLGNMSKEQLQQYDKFLDENDWDIYYWA 199

Query: 63  TGMEK 67
           T  E 
Sbjct: 200 T-QEP 203


>gi|329850835|ref|ZP_08265680.1| pyridoxine 5'-phosphate synthase [Asticcacaulis biprosthecum C19]
 gi|328841150|gb|EGF90721.1| pyridoxine 5'-phosphate synthase [Asticcacaulis biprosthecum C19]
          Length = 341

 Score = 86.6 bits (214), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 23/85 (27%), Positives = 42/85 (49%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
             ++ + +  +YR   RG REMD+I+ SF    +  L   +L M E I+E  D +L++  
Sbjct: 252 DGLDARRQACLYRANYRGFREMDIIMSSFAQAVVPALVDPDLFMFEHILEMPDHDLYERI 311

Query: 63  TGMEKPPEYLRTPIFKKIYDYYSNN 87
               +P + L   +   + D+Y  +
Sbjct: 312 RSTNEPEQGLHIELLTNLRDHYKQS 336


>gi|321478706|gb|EFX89663.1| hypothetical protein DAPPUDRAFT_40617 [Daphnia pulex]
          Length = 108

 Score = 86.6 bits (214), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 20/88 (22%), Positives = 46/88 (52%), Gaps = 2/88 (2%)

Query: 2  KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEE--DDSNLF 59
           ++  L+  +++Y+  +RG  E  LIL +F   ++  +S  ++++ + +I    +D +++
Sbjct: 9  NESSTLKKARLMYQSRKRGMLENGLILSTFASRYLDGMSDDQMSLYDRLINLPSNDWDIY 68

Query: 60 KWFTGMEKPPEYLRTPIFKKIYDYYSNN 87
           W TG+ + PE     I   + D+  N 
Sbjct: 69 YWATGVRETPEEFNNEIMNLLKDHVKNK 96


>gi|225682489|gb|EEH20773.1| endoplasmic reticulum vesicle protein [Paracoccidioides
           brasiliensis Pb03]
          Length = 415

 Score = 86.6 bits (214), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 15/73 (20%), Positives = 39/73 (53%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
           ++++    +++Y+  +RGT E DL+L +F    +  +++ +L   +  ++E+D +++ W 
Sbjct: 252 EDVSTMRARLLYQSRKRGTLESDLLLSTFASKNLPTMTAQQLEEFDKFLDENDWDIYYWA 311

Query: 63  TGMEKPPEYLRTP 75
           T   + P      
Sbjct: 312 TQEAEDPSATDKA 324


>gi|195442244|ref|XP_002068868.1| GK18008 [Drosophila willistoni]
 gi|257096765|sp|B4N665|SDF2B_DROWI RecName: Full=Succinate dehydrogenase assembly factor 2-B,
           mitochondrial; Short=SDH assembly factor 2-B; AltName:
           Full=Succinate dehydrogenase subunit 5-B, mitochondrial;
           Flags: Precursor
 gi|194164953|gb|EDW79854.1| GK18008 [Drosophila willistoni]
          Length = 156

 Score = 86.6 bits (214), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 17/93 (18%), Positives = 45/93 (48%), Gaps = 2/93 (2%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIE--EDDSNLFK 60
           + +  + ++++Y+  +RG  E DL+L +FV  ++ + ++ +    + +I    +D ++F 
Sbjct: 59  EPLETRKQRLLYQSRKRGMLENDLLLSTFVAKYLRDFNADQTAQYDKLINGVSNDWDIFY 118

Query: 61  WFTGMEKPPEYLRTPIFKKIYDYYSNNLDRKNM 93
           W T  +  P      I + +  +  N    + +
Sbjct: 119 WATETKATPAEYDNEIMQMLKQHVKNEERVQRI 151


>gi|121708553|ref|XP_001272170.1| TPR repeat protein [Aspergillus clavatus NRRL 1]
 gi|119400318|gb|EAW10744.1| TPR repeat protein [Aspergillus clavatus NRRL 1]
          Length = 300

 Score = 86.6 bits (214), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 15/65 (23%), Positives = 36/65 (55%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
           ++      +++Y+  +RG  E DL+L +F D ++ +++  EL   +  ++E+D +++ W 
Sbjct: 145 EDPATMRARLLYQSRKRGILESDLLLSTFADVYLADMTPEELQQYDRFLDENDWDIYYWA 204

Query: 63  TGMEK 67
           T    
Sbjct: 205 TQDAP 209


>gi|296283912|ref|ZP_06861910.1| hypothetical protein CbatJ_09826 [Citromicrobium bathyomarinum
          JL354]
          Length = 91

 Score = 86.6 bits (214), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 17/80 (21%), Positives = 35/80 (43%)

Query: 2  KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
            +   +  +  +R W RGTRE D ++G + D +  E    +L   E++++ DD  +  W
Sbjct: 3  SPSFESRLARAKFRAWHRGTREADYMIGGYFDRYHAEWGEEDLVWFETLLDYDDVEIMAW 62

Query: 62 FTGMEKPPEYLRTPIFKKIY 81
              +  P  ++      + 
Sbjct: 63 ALKTQPIPPEMQGERIAIMQ 82


>gi|50555804|ref|XP_505310.1| YALI0F11957p [Yarrowia lipolytica]
 gi|74632669|sp|Q6C202|SDHF2_YARLI RecName: Full=Succinate dehydrogenase assembly factor 2,
           mitochondrial; Short=SDH assembly factor 2; AltName:
           Full=Early meiotic induction protein 5; AltName:
           Full=Succinate dehydrogenase subunit 5, mitochondrial;
           Flags: Precursor
 gi|49651180|emb|CAG78117.1| YALI0F11957p [Yarrowia lipolytica]
          Length = 145

 Score = 86.2 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 19/91 (20%), Positives = 47/91 (51%), Gaps = 4/91 (4%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
           +    +  +++Y+  +RG  E DL+L  +   ++ +++  EL   + +++E D ++F W 
Sbjct: 47  EETETKRARLLYQSRKRGILETDLLLSRYAKLYLKDMTREELEEYDKLLDEPDWDIFYWA 106

Query: 63  T---GMEKPPEYL-RTPIFKKIYDYYSNNLD 89
           T    ++  PE   ++P+ +K+ +   N   
Sbjct: 107 TRNDNIKPCPERWAKSPVMEKLRELAENKER 137


>gi|149725296|ref|XP_001502167.1| PREDICTED: similar to Protein EMI5 homolog, mitochondrial [Equus
           caballus]
          Length = 166

 Score = 86.2 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 16/87 (18%), Positives = 41/87 (47%), Gaps = 2/87 (2%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEE--DDSNLFK 60
           +++  +  +++Y   +RG  E  ++L  F    +  ++  +L + + +I E  +D +++ 
Sbjct: 61  ESIETKRARLLYESRKRGMLENCILLSLFAKEHLHHMTEKQLNLYDRLINEPSNDWDIYY 120

Query: 61  WFTGMEKPPEYLRTPIFKKIYDYYSNN 87
           W T  +  PE     +   + D+  N 
Sbjct: 121 WATEAKPAPEIFENEVMALLRDFAKNK 147


>gi|195431339|ref|XP_002063700.1| GK15773 [Drosophila willistoni]
 gi|257096755|sp|B4MRE7|SDF2A_DROWI RecName: Full=Succinate dehydrogenase assembly factor 2-A,
           mitochondrial; Short=SDH assembly factor 2-A; AltName:
           Full=Succinate dehydrogenase subunit 5-A, mitochondrial;
           Flags: Precursor
 gi|194159785|gb|EDW74686.1| GK15773 [Drosophila willistoni]
          Length = 157

 Score = 86.2 bits (213), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 17/92 (18%), Positives = 46/92 (50%), Gaps = 2/92 (2%)

Query: 2   KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIE--EDDSNLF 59
            + + ++ +++VY+  +RG  E DL+L +F   ++   +  +  + + +I    +D +++
Sbjct: 58  NEPLEIRKQRLVYQSRKRGMLENDLLLSTFAAKYLKNFNEEQTAIYDQLINGVSNDWDIY 117

Query: 60  KWFTGMEKPPEYLRTPIFKKIYDYYSNNLDRK 91
            W T ++  P    T I + + ++  N    +
Sbjct: 118 YWATDVKTTPAEYNTEIMQLLKEHVKNTERVQ 149


>gi|195381775|ref|XP_002049620.1| GJ20655 [Drosophila virilis]
 gi|194144417|gb|EDW60813.1| GJ20655 [Drosophila virilis]
          Length = 319

 Score = 85.8 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 19/86 (22%), Positives = 45/86 (52%), Gaps = 2/86 (2%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIE--EDDSNLFK 60
           + +  + ++++Y+  +RG  E DL+L +F   ++    + +  + + +I    +D +++ 
Sbjct: 216 EPLAKRKQRLLYQSRKRGMLENDLLLSTFAHKYLKNFDAKQTAIYDELINGVSNDWDIYY 275

Query: 61  WFTGMEKPPEYLRTPIFKKIYDYYSN 86
           W TG++  PE   T I K +  +  N
Sbjct: 276 WATGVKPTPEQYETEIMKLLKQHVKN 301


>gi|148709410|gb|EDL41356.1| RIKEN cDNA 0610038F07, isoform CRA_a [Mus musculus]
          Length = 170

 Score = 85.8 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 15/87 (17%), Positives = 43/87 (49%), Gaps = 2/87 (2%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEE--DDSNLFK 60
           +++  +  +++Y   +RG  E  ++L  F   ++  ++  +L + + +I E  +D +++ 
Sbjct: 65  ESIETKRARLLYESRKRGMLENCILLSLFAKEYLHNMTEKQLNLYDRLINEPSNDWDIYY 124

Query: 61  WFTGMEKPPEYLRTPIFKKIYDYYSNN 87
           W T  +  PE     + + + ++  N 
Sbjct: 125 WATEAKPAPEIFENEVMELLREFAKNK 151


>gi|31560262|ref|NP_079609.2| succinate dehydrogenase assembly factor 2, mitochondrial precursor
           [Mus musculus]
 gi|81899056|sp|Q8C6I2|SDHF2_MOUSE RecName: Full=Succinate dehydrogenase assembly factor 2,
           mitochondrial; Short=SDH assembly factor 2; AltName:
           Full=Succinate dehydrogenase subunit 5, mitochondrial;
           Flags: Precursor
 gi|26344385|dbj|BAC35843.1| unnamed protein product [Mus musculus]
 gi|55391437|gb|AAH85277.1| RIKEN cDNA 0610038F07 gene [Mus musculus]
 gi|74144558|dbj|BAE36113.1| unnamed protein product [Mus musculus]
 gi|74191022|dbj|BAE39352.1| unnamed protein product [Mus musculus]
          Length = 164

 Score = 85.8 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 15/87 (17%), Positives = 43/87 (49%), Gaps = 2/87 (2%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEE--DDSNLFK 60
           +++  +  +++Y   +RG  E  ++L  F   ++  ++  +L + + +I E  +D +++ 
Sbjct: 59  ESIETKRARLLYESRKRGMLENCILLSLFAKEYLHNMTEKQLNLYDRLINEPSNDWDIYY 118

Query: 61  WFTGMEKPPEYLRTPIFKKIYDYYSNN 87
           W T  +  PE     + + + ++  N 
Sbjct: 119 WATEAKPAPEIFENEVMELLREFAKNK 145


>gi|148285179|ref|YP_001249269.1| hypothetical protein OTBS_2179 [Orientia tsutsugamushi str.
          Boryong]
 gi|146740618|emb|CAM81274.1| hypothetical protein OTBS_2179 [Orientia tsutsugamushi str.
          Boryong]
          Length = 87

 Score = 85.8 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 22/83 (26%), Positives = 43/83 (51%), Gaps = 1/83 (1%)

Query: 1  MKKNMNLQC-RKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLF 59
          M K+   +  ++++YR   RG +E DL+L  F+   +  LS  EL     I++ DD +++
Sbjct: 1  MNKDEKQRIIKRLIYRATYRGCKESDLLLSQFLSKHLEFLSDKELLDFALILDCDDKDIY 60

Query: 60 KWFTGMEKPPEYLRTPIFKKIYD 82
          +W T  +  P++L   +   +  
Sbjct: 61 EWTTNKKPSPKHLNKKLISMLKS 83


>gi|325920383|ref|ZP_08182314.1| hypothetical protein XGA_1262 [Xanthomonas gardneri ATCC 19865]
 gi|325549130|gb|EGD20053.1| hypothetical protein XGA_1262 [Xanthomonas gardneri ATCC 19865]
          Length = 115

 Score = 85.8 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 21/79 (26%), Positives = 39/79 (49%), Gaps = 1/79 (1%)

Query: 4   NMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFT 63
           +     +K+ +RC RRG RE+D + G ++D    + S  E  +   +++ +D  L++WF 
Sbjct: 35  DEETLLKKLRWRC-RRGMRELDQLFGRYLDQRWAQASEPERAVFLQLLDCEDDKLWRWFM 93

Query: 64  GMEKPPEYLRTPIFKKIYD 82
           G E  P+     +   I  
Sbjct: 94  GYEACPDADNAALIADIRA 112


>gi|238504186|ref|XP_002383325.1| TPR repeat protein [Aspergillus flavus NRRL3357]
 gi|317138204|ref|XP_003189025.1| succinate dehydrogenase assembly factor 2 [Aspergillus oryzae
           RIB40]
 gi|257096768|sp|B8NT06|SDHF2_ASPFN RecName: Full=Succinate dehydrogenase assembly factor 2,
           mitochondrial; Short=SDH assembly factor 2; AltName:
           Full=Early meiotic induction protein 5; AltName:
           Full=Succinate dehydrogenase subunit 5, mitochondrial;
           Flags: Precursor
 gi|220690796|gb|EED47145.1| TPR repeat protein [Aspergillus flavus NRRL3357]
          Length = 292

 Score = 85.8 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 16/69 (23%), Positives = 41/69 (59%), Gaps = 1/69 (1%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
           ++++    +++Y+  +RG  E DL+L +F D ++ +++  +L   +  ++E+D +++ W 
Sbjct: 141 EDVSTIRARLLYQSRKRGILESDLLLSTFADVYLSKMNKEQLQEYDRFLDENDWDIYYWA 200

Query: 63  TGMEKPPEY 71
           T  + P E 
Sbjct: 201 T-QDPPTED 208


>gi|291409590|ref|XP_002721067.1| PREDICTED: succinate dehydrogenase complex assembly factor 2
           [Oryctolagus cuniculus]
          Length = 166

 Score = 85.8 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 16/87 (18%), Positives = 41/87 (47%), Gaps = 2/87 (2%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEE--DDSNLFK 60
           +++  +  +++Y   +RG  E  ++L  F    +  ++  +L + + +I E  +D +++ 
Sbjct: 61  ESIETKRARLLYESRKRGMLENCILLSLFAKEHLHHMTEKQLNLYDRLINEPSNDWDIYY 120

Query: 61  WFTGMEKPPEYLRTPIFKKIYDYYSNN 87
           W T  +  PE     +   + D+  N 
Sbjct: 121 WATEAKPAPEIFENEVMALLRDFAKNK 147


>gi|21242818|ref|NP_642400.1| hypothetical protein XAC2079 [Xanthomonas axonopodis pv. citri str.
           306]
 gi|81175073|sp|Q8PKT3|Y2079_XANAC RecName: Full=UPF0350 protein XAC2079
 gi|21108304|gb|AAM36936.1| conserved hypothetical protein [Xanthomonas axonopodis pv. citri
           str. 306]
          Length = 109

 Score = 85.8 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 20/79 (25%), Positives = 38/79 (48%), Gaps = 1/79 (1%)

Query: 4   NMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFT 63
           +     +K+ +RC RRG RE+D + G ++D    +    E  +   +++ +D  L++WF 
Sbjct: 29  DEQTLLKKLRWRC-RRGMRELDQLFGRYLDQRWAQAPDAERAVFLQLLDCEDDKLWRWFM 87

Query: 64  GMEKPPEYLRTPIFKKIYD 82
           G E  P+     +   I  
Sbjct: 88  GYEACPDAANAALIADIRA 106


>gi|322698313|gb|EFY90084.1| TPR repeat protein [Metarhizium acridum CQMa 102]
          Length = 221

 Score = 85.8 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 17/65 (26%), Positives = 38/65 (58%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
           +N + +  +++Y+  +RGT E DL+L +F    +  +S   L   +++++E+D +++ W 
Sbjct: 67  ENDDTKRARLLYQSRKRGTLESDLLLSTFAKAHLPSMSGGLLAQYDALLDENDWDIYYWA 126

Query: 63  TGMEK 67
           T  E 
Sbjct: 127 TQREP 131


>gi|322501057|emb|CBZ36134.1| unnamed protein product [Leishmania donovani BPK282A1]
          Length = 301

 Score = 85.8 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 25/96 (26%), Positives = 48/96 (50%), Gaps = 3/96 (3%)

Query: 2   KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
           ++++  + R+++Y+   RG  EMDLI G F    +  L +  L   + ++++ DS LF+W
Sbjct: 207 EESVECKRRRLIYQSRYRGMVEMDLIFGHFARCKLETLDASMLDEYDVLLKQLDSELFRW 266

Query: 62  FTGMEKPPEYLRTP-IFKKIYDYYSNNLDRKNMLGS 96
                  PE +     F ++  +     +R  +LGS
Sbjct: 267 LVMGVDAPEGVAKLRCFDELRRFIK--EERTELLGS 300


>gi|12850820|dbj|BAB28863.1| unnamed protein product [Mus musculus]
          Length = 164

 Score = 85.8 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 15/87 (17%), Positives = 43/87 (49%), Gaps = 2/87 (2%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEE--DDSNLFK 60
           +++  +  +++Y   +RG  E  ++L  F   ++  ++  +L + + +I E  +D +++ 
Sbjct: 59  ESIETKRARLLYESRKRGMLENCILLSLFAKEYLHNMTEKQLNLYDRLINEPSNDWDIYY 118

Query: 61  WFTGMEKPPEYLRTPIFKKIYDYYSNN 87
           W T  +  PE     + + + ++  N 
Sbjct: 119 WATEAKPAPEIFENEVMELLREFAKNK 145


>gi|146093692|ref|XP_001466957.1| hypothetical protein [Leishmania infantum JPCM5]
 gi|134071321|emb|CAM70007.1| conserved hypothetical protein [Leishmania infantum JPCM5]
          Length = 233

 Score = 85.8 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 25/96 (26%), Positives = 48/96 (50%), Gaps = 3/96 (3%)

Query: 2   KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
           ++++  + R+++Y+   RG  EMDLI G F    +  L +  L   + ++++ DS LF+W
Sbjct: 139 EESVECKRRRLIYQSRYRGMVEMDLIFGHFARCKLETLDASMLDEYDVLLKQLDSELFRW 198

Query: 62  FTGMEKPPEYLRTP-IFKKIYDYYSNNLDRKNMLGS 96
                  PE +     F ++  +     +R  +LGS
Sbjct: 199 LVMGVDAPEGVAKLRCFDELRRFIK--EERTELLGS 232


>gi|154341601|ref|XP_001566752.1| hypothetical protein [Leishmania braziliensis MHOM/BR/75/M2904]
 gi|134064077|emb|CAM40268.1| conserved hypothetical protein [Leishmania braziliensis
           MHOM/BR/75/M2904]
          Length = 226

 Score = 85.8 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 24/94 (25%), Positives = 45/94 (47%), Gaps = 3/94 (3%)

Query: 2   KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
            +++  + R+++Y+   RG  EMDLI G F    +  L +  L   + ++++ DS LF W
Sbjct: 132 NESVESKRRRLIYQSRYRGMVEMDLIFGHFARCKLETLDAAMLNEYDILLKQLDSELFCW 191

Query: 62  FTGMEKPPEYLRTP-IFKKIYDYYSNNLDRKNML 94
                  PE +     F ++  +   N +R  +L
Sbjct: 192 LVMGVDAPEEVSKLRCFDELRRFI--NEERAELL 223


>gi|296826364|ref|XP_002850964.1| early meiotic induction protein 5 [Arthroderma otae CBS 113480]
 gi|238838518|gb|EEQ28180.1| early meiotic induction protein 5 [Arthroderma otae CBS 113480]
          Length = 264

 Score = 85.8 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 15/65 (23%), Positives = 39/65 (60%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
           ++ + +  +++Y+  +RGT E DL+L +F   ++ +++S +L   +  ++E+D +++ W 
Sbjct: 113 EDDSTKRARLLYQSRKRGTLESDLLLSTFASTYLGKMTSSQLDEYDRFLDENDWDIYYWA 172

Query: 63  TGMEK 67
           T    
Sbjct: 173 TQEAP 177


>gi|85102955|ref|XP_961429.1| hypothetical protein NCU01343 [Neurospora crassa OR74A]
 gi|11595613|emb|CAC18233.1| conserved hypothetical protein [Neurospora crassa]
 gi|28922974|gb|EAA32193.1| conserved hypothetical protein [Neurospora crassa OR74A]
          Length = 221

 Score = 85.5 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 16/67 (23%), Positives = 35/67 (52%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
           ++      +++Y+  +RGT E DLIL +F    +  ++  +L   +  ++E+D +++ W 
Sbjct: 71  EDPATMRARLLYQSRKRGTLESDLILSTFAAAHLGSMTPEQLKQYDLFLDENDWDIYYWA 130

Query: 63  TGMEKPP 69
           T     P
Sbjct: 131 TQEPPLP 137


>gi|156044082|ref|XP_001588597.1| hypothetical protein SS1G_10144 [Sclerotinia sclerotiorum 1980]
 gi|154694533|gb|EDN94271.1| hypothetical protein SS1G_10144 [Sclerotinia sclerotiorum 1980
           UF-70]
          Length = 331

 Score = 85.5 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 16/73 (21%), Positives = 39/73 (53%), Gaps = 1/73 (1%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
           ++      +++Y+  +RGT E DL++ +F D  +  +++ ++   +  ++E+D +++ W 
Sbjct: 139 EHEEKMRARLLYQSRKRGTLESDLLMSTFADAHLPTMTAAQMVQYDQFLDENDWDIYYWV 198

Query: 63  TGMEKPPEYLRTP 75
           T  E  P    T 
Sbjct: 199 T-QEPSPTSRETA 210


>gi|50422655|ref|XP_459903.1| DEHA2E13750p [Debaryomyces hansenii CBS767]
 gi|74601961|sp|Q6BPG7|SDHF2_DEBHA RecName: Full=Succinate dehydrogenase assembly factor 2,
           mitochondrial; Short=SDH assembly factor 2; AltName:
           Full=Early meiotic induction protein 5; AltName:
           Full=Succinate dehydrogenase subunit 5, mitochondrial;
           Flags: Precursor
 gi|49655571|emb|CAG88145.1| DEHA2E13750p [Debaryomyces hansenii]
          Length = 142

 Score = 85.5 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 19/92 (20%), Positives = 47/92 (51%), Gaps = 3/92 (3%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
           ++++++  ++VY+  +RG  E DL+L  F   ++   S  EL   + +++E D +++ W 
Sbjct: 44  ESIDVKRARLVYQSRKRGILESDLLLSRFAKRYLSGFSQEELDEYDKLLDEPDWDIYYWA 103

Query: 63  TG---MEKPPEYLRTPIFKKIYDYYSNNLDRK 91
           T    +   P+  +     K+    + N +++
Sbjct: 104 TKNYDVTPLPDKWKNSKILKLLQEDAENKEKE 135


>gi|71666559|ref|XP_820237.1| hypothetical protein [Trypanosoma cruzi strain CL Brener]
 gi|70885574|gb|EAN98386.1| hypothetical protein, conserved [Trypanosoma cruzi]
          Length = 145

 Score = 85.5 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 26/90 (28%), Positives = 48/90 (53%), Gaps = 1/90 (1%)

Query: 2   KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
            +  + + R+++Y+   RG  EMD+ILG+F  H +  +   +L   ++I+   DS+LFKW
Sbjct: 50  NEPDDAKRRRLIYQSAYRGMAEMDIILGAFSRHSLEGMPREQLDEYDTILRHFDSDLFKW 109

Query: 62  FTGMEKPPEYLRT-PIFKKIYDYYSNNLDR 90
               EKPP  +     +K + ++     +R
Sbjct: 110 LVMNEKPPASVAGMSTYKVLQEFVKGGRER 139


>gi|312079044|ref|XP_003142004.1| TM2 domain-containing protein [Loa loa]
 gi|307762836|gb|EFO22070.1| TM2 domain-containing protein [Loa loa]
          Length = 357

 Score = 85.5 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 20/91 (21%), Positives = 46/91 (50%), Gaps = 3/91 (3%)

Query: 2   KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIE--EDDSNLF 59
            +N+  +  +++Y+  +RG  E D++LG F D  + ++S  +L   + II     + +L+
Sbjct: 47  NENIETKRSRLLYQSKKRGILENDILLGGFADQMLQKMSLQQLMRYDEIINGKHMEWDLY 106

Query: 60  KWFTGMEKPPEYL-RTPIFKKIYDYYSNNLD 89
            +  G +  PE L    +F+ + ++     +
Sbjct: 107 YYLAGRKNLPEDLKDCEVFQLLLNFVKKRTE 137


>gi|311247522|ref|XP_003122684.1| PREDICTED: LOW QUALITY PROTEIN: succinate dehydrogenase assembly
           factor 2, mitochondrial-like [Sus scrofa]
          Length = 166

 Score = 85.5 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 16/87 (18%), Positives = 42/87 (48%), Gaps = 2/87 (2%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEE--DDSNLFK 60
           +++  +  +++Y   +RG  E  ++L  F    + +++  +L + + +I E  +D +++ 
Sbjct: 61  ESIETKRARLLYESRKRGMLENCILLSLFAKEHLHQMTEKQLNLYDRLINEPSNDWDIYY 120

Query: 61  WFTGMEKPPEYLRTPIFKKIYDYYSNN 87
           W T  +  PE     +   + D+  N 
Sbjct: 121 WATEAKPAPEIFENEVLALLRDFAKNK 147


>gi|257096767|sp|B1P1W2|SDHF2_ARTSF RecName: Full=Succinate dehydrogenase assembly factor 2,
           mitochondrial; Short=SDH assembly factor 2; AltName:
           Full=Succinate dehydrogenase subunit 5, mitochondrial;
           Flags: Precursor
 gi|169931085|gb|ACB05780.1| hypothetical protein [Artemia franciscana]
          Length = 137

 Score = 85.5 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 16/83 (19%), Positives = 42/83 (50%), Gaps = 2/83 (2%)

Query: 2   KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEE--DDSNLF 59
            + + ++  +++Y+  +RG  E  L+L +F   F+  ++ ++L   + +I    +D +++
Sbjct: 54  NEPVEIKRARLLYQSRKRGMLENCLLLSTFAKKFLHSMTPLQLDQYDRLINLPSNDWDIY 113

Query: 60  KWFTGMEKPPEYLRTPIFKKIYD 82
            W  G++  PE   T +   +  
Sbjct: 114 NWSVGVKPTPEEFETEVMDMLKS 136


>gi|56756461|gb|AAW26403.1| SJCHGC09209 protein [Schistosoma japonicum]
          Length = 148

 Score = 85.5 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 16/82 (19%), Positives = 43/82 (52%), Gaps = 2/82 (2%)

Query: 2   KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDD--SNLF 59
            +  +++  +++Y+  +RG  E  ++L +F   ++  ++  +L   + +I   D   +L+
Sbjct: 62  TETDDIRRARLLYQSRKRGNLENGILLSTFAAQYLNTMTHEQLIAYDDLINLPDNEWDLY 121

Query: 60  KWFTGMEKPPEYLRTPIFKKIY 81
            W T  ++ PEY +T + + + 
Sbjct: 122 YWITKAKQAPEYFQTDVLQLLQ 143


>gi|56605818|ref|NP_001008372.1| succinate dehydrogenase assembly factor 2, mitochondrial precursor
           [Rattus norvegicus]
 gi|81883340|sp|Q5RJQ7|SDHF2_RAT RecName: Full=Succinate dehydrogenase assembly factor 2,
           mitochondrial; Short=SDH assembly factor 2; AltName:
           Full=Succinate dehydrogenase subunit 5, mitochondrial;
           Flags: Precursor
 gi|55778356|gb|AAH86542.1| Similar to hypothetical protein FLJ20487 [Rattus norvegicus]
 gi|149062393|gb|EDM12816.1| similar to hypothetical protein FLJ20487 [Rattus norvegicus]
          Length = 164

 Score = 85.5 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 15/87 (17%), Positives = 43/87 (49%), Gaps = 2/87 (2%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEE--DDSNLFK 60
           +++  +  +++Y   +RG  E  ++L  F   ++  ++  +L + + +I E  +D +++ 
Sbjct: 59  ESIETKRARLLYESRKRGMLENCILLSLFAKEYLHNMTEKQLNLYDRLINEPSNDWDIYY 118

Query: 61  WFTGMEKPPEYLRTPIFKKIYDYYSNN 87
           W T  +  PE     + + + ++  N 
Sbjct: 119 WATEAKPAPEIFENEVMELLREFTKNK 145


>gi|257096802|sp|A5DJ67|SDHF2_PICGU RecName: Full=Succinate dehydrogenase assembly factor 2,
           mitochondrial; Short=SDH assembly factor 2; AltName:
           Full=Early meiotic induction protein 5; AltName:
           Full=Succinate dehydrogenase subunit 5, mitochondrial;
           Flags: Precursor
 gi|190347014|gb|EDK39220.2| hypothetical protein PGUG_03318 [Meyerozyma guilliermondii ATCC
           6260]
          Length = 135

 Score = 85.5 bits (211), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 22/94 (23%), Positives = 44/94 (46%), Gaps = 3/94 (3%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
           +    +  ++VY+  +RG  E DL+L  F    +  LS  +L   + +++E D +++ W 
Sbjct: 37  ETRETKKARLVYQSRKRGILESDLLLSRFAKKHLDSLSDSQLDEYDQLLDEPDWDIYYWA 96

Query: 63  TG---MEKPPEYLRTPIFKKIYDYYSNNLDRKNM 93
           T    +   P+  +     K+    + N DR+ M
Sbjct: 97  TKNYDVTPLPDRWKDSEILKMLQKDAQNEDREIM 130


>gi|197099760|ref|NP_001126882.1| succinate dehydrogenase assembly factor 2, mitochondrial precursor
           [Pongo abelii]
 gi|75041021|sp|Q5R4W7|SDHF2_PONAB RecName: Full=Succinate dehydrogenase assembly factor 2,
           mitochondrial; Short=SDH assembly factor 2; AltName:
           Full=Succinate dehydrogenase subunit 5, mitochondrial;
           Flags: Precursor
 gi|55733028|emb|CAH93199.1| hypothetical protein [Pongo abelii]
          Length = 166

 Score = 85.5 bits (211), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 16/87 (18%), Positives = 41/87 (47%), Gaps = 2/87 (2%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEE--DDSNLFK 60
           +++  +  +++Y   +RG  E  ++L  F    +  ++  +L + + +I E  +D +++ 
Sbjct: 61  ESIETKRARLLYESRKRGMLENCILLSLFAKEHLQHMTEKQLNLYDRLINEPSNDWDIYY 120

Query: 61  WFTGMEKPPEYLRTPIFKKIYDYYSNN 87
           W T  +  PE     +   + D+  N 
Sbjct: 121 WATEAKPAPEVFENEVMALLRDFAKNK 147


>gi|157872307|ref|XP_001684702.1| hypothetical protein [Leishmania major strain Friedlin]
 gi|68127772|emb|CAJ06126.1| conserved hypothetical protein [Leishmania major strain Friedlin]
          Length = 232

 Score = 85.1 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 26/96 (27%), Positives = 48/96 (50%), Gaps = 3/96 (3%)

Query: 2   KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
           K+++  + R+++Y+   RG  EMDLI G F    +  L +  L   + ++++ DS LF+W
Sbjct: 138 KESVECKRRRLIYQSRYRGMVEMDLIFGHFARCKLETLDASMLDEYDMLLKQLDSELFRW 197

Query: 62  FTGMEKPPEYLRTP-IFKKIYDYYSNNLDRKNMLGS 96
                  PE +     F ++  +     +R  +LGS
Sbjct: 198 LVMGVDAPEGVAKLRCFGELRRFIK--EERTALLGS 231


>gi|322710170|gb|EFZ01745.1| early meiotic induction protein 5 [Metarhizium anisopliae ARSEF 23]
          Length = 214

 Score = 85.1 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 17/65 (26%), Positives = 38/65 (58%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
           +N + +  +++Y+  +RGT E DL+L +F    +  +S   L   +++++E+D +++ W 
Sbjct: 66  ENDDTKRARLLYQSRKRGTLESDLLLSTFAKAHLPSMSGGLLAQYDALLDENDWDIYYWA 125

Query: 63  TGMEK 67
           T  E 
Sbjct: 126 TQREP 130


>gi|320591871|gb|EFX04310.1| tpr repeat protein [Grosmannia clavigera kw1407]
          Length = 250

 Score = 85.1 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 14/61 (22%), Positives = 36/61 (59%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
           ++   +  +++Y+  +RGT E DL+L +F    +  +++ +L   +  ++E+D +++ W 
Sbjct: 84  EDPTTKRARLLYQSRKRGTLESDLLLSTFAAQHLGSMTAAQLDEYDRFLDENDWDIYYWV 143

Query: 63  T 63
           T
Sbjct: 144 T 144


>gi|224050591|ref|XP_002192086.1| PREDICTED: hypothetical protein [Taeniopygia guttata]
          Length = 154

 Score = 85.1 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 16/87 (18%), Positives = 40/87 (45%), Gaps = 2/87 (2%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEE--DDSNLFK 60
           + ++ +  +++Y   +RG  E  ++L  F    +  +S  +L   + +I E  +D +++ 
Sbjct: 49  EPVDTKRARLLYESRKRGMLENCILLSLFAKENLARMSEEQLNRYDRLINEPSNDWDIYY 108

Query: 61  WFTGMEKPPEYLRTPIFKKIYDYYSNN 87
           W T  +  P    T +   + ++  N 
Sbjct: 109 WATEAKPTPTEFDTDVMAMLREFAKNR 135


>gi|119174260|ref|XP_001239491.1| hypothetical protein CIMG_09112 [Coccidioides immitis RS]
 gi|303314149|ref|XP_003067083.1| hypothetical protein CPC735_015360 [Coccidioides posadasii C735
           delta SOWgp]
 gi|240106751|gb|EER24938.1| hypothetical protein CPC735_015360 [Coccidioides posadasii C735
           delta SOWgp]
          Length = 251

 Score = 85.1 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 16/67 (23%), Positives = 36/67 (53%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
           +++     +++Y+  +RGT E DL+L +F    +  +S  +L   +  ++E+D +++ W 
Sbjct: 96  EDVATMRARLLYQSRKRGTLESDLLLSTFAATNLSTMSKSQLEEYDRFLDENDWDIYYWA 155

Query: 63  TGMEKPP 69
           T     P
Sbjct: 156 TQEPPAP 162


>gi|146415935|ref|XP_001483937.1| hypothetical protein PGUG_03318 [Meyerozyma guilliermondii ATCC
           6260]
          Length = 135

 Score = 85.1 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 22/94 (23%), Positives = 44/94 (46%), Gaps = 3/94 (3%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
           +    +  ++VY+  +RG  E DL+L  F    +  LS  +L   + +++E D +++ W 
Sbjct: 37  ETRETKKARLVYQSRKRGILESDLLLSRFAKKHLDSLSDSQLDEYDQLLDEPDWDIYYWA 96

Query: 63  TG---MEKPPEYLRTPIFKKIYDYYSNNLDRKNM 93
           T    +   P+  +     K+    + N DR+ M
Sbjct: 97  TKNYDVTPLPDRWKDSEILKMLQKDAQNEDREIM 130


>gi|126333586|ref|XP_001379522.1| PREDICTED: hypothetical protein [Monodelphis domestica]
          Length = 164

 Score = 84.7 bits (209), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 16/87 (18%), Positives = 41/87 (47%), Gaps = 2/87 (2%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEE--DDSNLFK 60
           + +  +  +++Y   +RG  E  ++L  F    + +++  +L + + +I E  +D +++ 
Sbjct: 59  EPIETKRARLLYESRKRGMLENCILLSLFAKENLHQMTERQLNLYDRLINEPSNDWDIYY 118

Query: 61  WFTGMEKPPEYLRTPIFKKIYDYYSNN 87
           W T  +  PE     +   + D+  N 
Sbjct: 119 WATEAKPAPEIFENEVMAMLRDFAKNK 145


>gi|8923450|ref|NP_060311.1| succinate dehydrogenase assembly factor 2, mitochondrial precursor
           [Homo sapiens]
 gi|74734683|sp|Q9NX18|SDHF2_HUMAN RecName: Full=Succinate dehydrogenase assembly factor 2,
           mitochondrial; Short=SDH assembly factor 2; AltName:
           Full=Succinate dehydrogenase subunit 5, mitochondrial;
           Short=hSDH5; Flags: Precursor
 gi|7020622|dbj|BAA91204.1| unnamed protein product [Homo sapiens]
 gi|12803061|gb|AAH02331.1| Chromosome 11 open reading frame 79 [Homo sapiens]
 gi|119594357|gb|EAW73951.1| hCG2017012, isoform CRA_e [Homo sapiens]
 gi|325464371|gb|ADZ15956.1| chromosome 11 open reading frame 79 [synthetic construct]
          Length = 166

 Score = 84.7 bits (209), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 16/87 (18%), Positives = 41/87 (47%), Gaps = 2/87 (2%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEE--DDSNLFK 60
           +++  +  +++Y   +RG  E  ++L  F    +  ++  +L + + +I E  +D +++ 
Sbjct: 61  ESIETKRARLLYESRKRGMLENCILLSLFAKEHLQHMTEKQLNLYDRLINEPSNDWDIYY 120

Query: 61  WFTGMEKPPEYLRTPIFKKIYDYYSNN 87
           W T  +  PE     +   + D+  N 
Sbjct: 121 WATEAKPAPEIFENEVMALLRDFAKNK 147


>gi|154299367|ref|XP_001550103.1| hypothetical protein BC1G_11169 [Botryotinia fuckeliana B05.10]
 gi|150857434|gb|EDN32626.1| hypothetical protein BC1G_11169 [Botryotinia fuckeliana B05.10]
          Length = 331

 Score = 84.7 bits (209), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 16/73 (21%), Positives = 39/73 (53%), Gaps = 1/73 (1%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
           ++      +++Y+  +RGT E DL++ +F D  +  +++ ++   +  ++E+D +++ W 
Sbjct: 139 EHEEKMRARLLYQSRKRGTLESDLLMSTFADAHLPNMTAAQMVQYDQFLDENDWDIYYWV 198

Query: 63  TGMEKPPEYLRTP 75
           T  E  P    T 
Sbjct: 199 T-QEPSPTSRETA 210


>gi|156543712|ref|XP_001605735.1| PREDICTED: similar to ENSANGP00000014095, partial [Nasonia
           vitripennis]
          Length = 111

 Score = 84.7 bits (209), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 15/94 (15%), Positives = 42/94 (44%), Gaps = 2/94 (2%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEE--DDSNLFK 60
           +N++++  +++Y+  +RG  E  L+L +F   ++   +  +L   + +I    +D ++F 
Sbjct: 13  ENVSVKKARLLYQSRKRGMLENGLLLSTFAKKYLDHFNEEQLKQYDRLINLPSNDWDIFY 72

Query: 61  WFTGMEKPPEYLRTPIFKKIYDYYSNNLDRKNML 94
           W   ++  P      +   +  +  N      + 
Sbjct: 73  WAAEVKPVPPEFENEVMDLLKKHIKNEHREARIT 106


>gi|73983849|ref|XP_533273.2| PREDICTED: similar to CG14757-PA [Canis familiaris]
          Length = 165

 Score = 84.7 bits (209), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 16/87 (18%), Positives = 42/87 (48%), Gaps = 2/87 (2%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEE--DDSNLFK 60
           +++  +  +++Y   +RG  E  ++L  F   ++  ++  +L + + +I E  +D +++ 
Sbjct: 60  ESIETKRARLLYESRKRGMLENCILLSLFAKEYLHHMTEKQLNLYDRLINEPSNDWDIYY 119

Query: 61  WFTGMEKPPEYLRTPIFKKIYDYYSNN 87
           W T  +  PE     +   + D+  N 
Sbjct: 120 WATEAKPAPEIFENEVMALLRDFAKNK 146


>gi|296218446|ref|XP_002755456.1| PREDICTED: succinate dehydrogenase assembly factor 2,
           mitochondrial-like [Callithrix jacchus]
          Length = 171

 Score = 84.7 bits (209), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 16/87 (18%), Positives = 42/87 (48%), Gaps = 2/87 (2%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEE--DDSNLFK 60
           +++ ++  +++Y   +RG  E  ++L  F    +  ++  +L + + +I E  +D +++ 
Sbjct: 66  ESIEIKRARLLYESRKRGMLENCILLSLFAKEHLQHMTEKQLNLYDRLINEPSNDWDIYY 125

Query: 61  WFTGMEKPPEYLRTPIFKKIYDYYSNN 87
           W T  +  PE     +   + D+  N 
Sbjct: 126 WATEAKPAPEIFENEVMALLRDFAKNK 152


>gi|322823537|gb|EFZ29268.1| hypothetical protein TCSYLVIO_4481 [Trypanosoma cruzi]
          Length = 145

 Score = 84.7 bits (209), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 26/90 (28%), Positives = 48/90 (53%), Gaps = 1/90 (1%)

Query: 2   KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
            +  + + R+++Y+   RG  EMD+ILG+F  H +  +   +L   ++I+   DS+LFKW
Sbjct: 50  NEPDDAKRRRLIYQSAYRGMVEMDIILGAFSRHSLEGMPREQLDEYDTILRHFDSDLFKW 109

Query: 62  FTGMEKPPEYLRT-PIFKKIYDYYSNNLDR 90
               EKPP  +     +K + ++     +R
Sbjct: 110 LVMDEKPPASVAGMSTYKVLQEFVKGGRER 139


>gi|149247217|ref|XP_001528030.1| early meiotic induction protein 5, mitochondrial precursor
           [Lodderomyces elongisporus NRRL YB-4239]
 gi|257096774|sp|A5DT64|SDHF2_LODEL RecName: Full=Succinate dehydrogenase assembly factor 2,
           mitochondrial; Short=SDH assembly factor 2; AltName:
           Full=Early meiotic induction protein 5; AltName:
           Full=Succinate dehydrogenase subunit 5, mitochondrial;
           Flags: Precursor
 gi|146447984|gb|EDK42372.1| early meiotic induction protein 5, mitochondrial precursor
           [Lodderomyces elongisporus NRRL YB-4239]
          Length = 164

 Score = 84.7 bits (209), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 19/91 (20%), Positives = 45/91 (49%), Gaps = 3/91 (3%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
           + ++++  ++VY+  +RG  E DL+L  F   ++ +++  EL   + +++E D +++ W 
Sbjct: 47  ETIDVKRARLVYQSRKRGILESDLLLSRFAKKYLKQMTMEELDEYDKLLDEADWDIYYWA 106

Query: 63  TG---MEKPPEYLRTPIFKKIYDYYSNNLDR 90
           T        P+        K+    + N +R
Sbjct: 107 TKNYDTTPLPKKWEDSKILKLLQKEAENEER 137


>gi|195123470|ref|XP_002006229.1| GI20928 [Drosophila mojavensis]
 gi|257096760|sp|B4KPG8|SDF2B_DROMO RecName: Full=Succinate dehydrogenase assembly factor 2-B,
           mitochondrial; Short=SDH assembly factor 2-B; AltName:
           Full=Succinate dehydrogenase subunit 5-B, mitochondrial;
           Flags: Precursor
 gi|193911297|gb|EDW10164.1| GI20928 [Drosophila mojavensis]
          Length = 157

 Score = 84.7 bits (209), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 18/86 (20%), Positives = 48/86 (55%), Gaps = 2/86 (2%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIE--EDDSNLFK 60
           + +  + ++++Y+  +RG  E DL+L +F   ++ + ++ +  + + +I    +D +++ 
Sbjct: 54  EPLETRKQRLMYQSRKRGMLENDLLLSTFAHKYLKDFNAEQTALYDDLINGVSNDWDIYY 113

Query: 61  WFTGMEKPPEYLRTPIFKKIYDYYSN 86
           W TG+++ P+   T I K +  +  N
Sbjct: 114 WATGVKQTPKEYDTEIMKLLKLHVDN 139


>gi|302565244|ref|NP_001180621.1| succinate dehydrogenase assembly factor 2, mitochondrial [Macaca
           mulatta]
          Length = 166

 Score = 84.3 bits (208), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 16/87 (18%), Positives = 41/87 (47%), Gaps = 2/87 (2%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEE--DDSNLFK 60
           +++  +  +++Y   +RG  E  ++L  F    +  ++  +L + + +I E  +D +++ 
Sbjct: 61  ESIETKRARLLYESRKRGMLENCILLSLFAKEHLQHMTEKQLNLYDRLINEPSNDWDIYY 120

Query: 61  WFTGMEKPPEYLRTPIFKKIYDYYSNN 87
           W T  +  PE     +   + D+  N 
Sbjct: 121 WATEAKPAPEIFENEVMALLRDFAKNK 147


>gi|189184481|ref|YP_001938266.1| hypothetical protein OTT_1574 [Orientia tsutsugamushi str. Ikeda]
 gi|189181252|dbj|BAG41032.1| hypothetical protein OTT_1574 [Orientia tsutsugamushi str. Ikeda]
          Length = 102

 Score = 84.3 bits (208), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 22/83 (26%), Positives = 42/83 (50%), Gaps = 1/83 (1%)

Query: 1  MKKNMNLQC-RKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLF 59
          M K+   +  ++++YR   RG +E DL+L  F+   +  LS  EL     I++ DD +++
Sbjct: 16 MNKDEQQRIIKRLIYRATYRGCKESDLLLSKFLSKHLEFLSDKELLDFALILDCDDKDIY 75

Query: 60 KWFTGMEKPPEYLRTPIFKKIYD 82
          +W T     P++L   +   +  
Sbjct: 76 EWTTNKNPSPKHLNKKLISMLKS 98


>gi|332249898|ref|XP_003274091.1| PREDICTED: succinate dehydrogenase assembly factor 2,
           mitochondrial-like [Nomascus leucogenys]
          Length = 166

 Score = 84.3 bits (208), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 16/87 (18%), Positives = 41/87 (47%), Gaps = 2/87 (2%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEE--DDSNLFK 60
           +++  +  +++Y   +RG  E  ++L  F    +  ++  +L + + +I E  +D +++ 
Sbjct: 61  ESIETKRARLLYESRKRGMLENCILLSLFAKEHLQRMTEKQLNLYDRLINEPSNDWDIYY 120

Query: 61  WFTGMEKPPEYLRTPIFKKIYDYYSNN 87
           W T  +  PE     +   + D+  N 
Sbjct: 121 WATEAKPAPEIFENEVMALLRDFAKNK 147


>gi|320581059|gb|EFW95281.1| Succinate dehydrogenase assembly factor 2 [Pichia angusta DL-1]
          Length = 120

 Score = 84.3 bits (208), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 20/91 (21%), Positives = 47/91 (51%), Gaps = 4/91 (4%)

Query: 1   MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
           + ++   + R+++Y+  +RG  E DL+L  F D ++  ++  EL   + +++E D +++ 
Sbjct: 19  INESTETKRRRLLYQSRKRGILESDLLLSRFADKYLDTMTPSELEEYDKLLDEPDWDIYY 78

Query: 61  WFTG---MEKPPEYL-RTPIFKKIYDYYSNN 87
           W T    +   P+    + I K++ +   N 
Sbjct: 79  WATKNYDVTPLPDKWKNSKILKQLQELSENK 109


>gi|301781696|ref|XP_002926262.1| PREDICTED: succinate dehydrogenase assembly factor 2,
           mitochondrial-like [Ailuropoda melanoleuca]
          Length = 154

 Score = 84.3 bits (208), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 16/87 (18%), Positives = 42/87 (48%), Gaps = 2/87 (2%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEE--DDSNLFK 60
           +++  +  +++Y   +RG  E  ++L  F   ++  ++  +L + + +I E  +D +++ 
Sbjct: 49  ESIETKRARLLYESRKRGMLENCILLSLFAKEYLHHMTEKQLNLYDRLINEPSNDWDIYY 108

Query: 61  WFTGMEKPPEYLRTPIFKKIYDYYSNN 87
           W T  +  PE     +   + D+  N 
Sbjct: 109 WATEAKPAPEIFENEVMALLRDFAKNK 135


>gi|281345361|gb|EFB20945.1| hypothetical protein PANDA_015894 [Ailuropoda melanoleuca]
          Length = 153

 Score = 84.3 bits (208), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 16/87 (18%), Positives = 42/87 (48%), Gaps = 2/87 (2%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEE--DDSNLFK 60
           +++  +  +++Y   +RG  E  ++L  F   ++  ++  +L + + +I E  +D +++ 
Sbjct: 49  ESIETKRARLLYESRKRGMLENCILLSLFAKEYLHHMTEKQLNLYDRLINEPSNDWDIYY 108

Query: 61  WFTGMEKPPEYLRTPIFKKIYDYYSNN 87
           W T  +  PE     +   + D+  N 
Sbjct: 109 WATEAKPAPEIFENEVMALLRDFAKNK 135


>gi|116180004|ref|XP_001219851.1| hypothetical protein CHGG_00630 [Chaetomium globosum CBS 148.51]
 gi|88184927|gb|EAQ92395.1| hypothetical protein CHGG_00630 [Chaetomium globosum CBS 148.51]
          Length = 229

 Score = 84.3 bits (208), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 18/68 (26%), Positives = 38/68 (55%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
           ++      ++VY+  +RGT E DL+L +F    +  ++  +L   +  ++E+D +++ W 
Sbjct: 59  EDPETMRARLVYQSRKRGTLESDLLLSTFASARLARMTPAQLAEYDRFLDENDWDIYYWA 118

Query: 63  TGMEKPPE 70
           T  E+ PE
Sbjct: 119 TQQEQKPE 126


>gi|171691895|ref|XP_001910872.1| hypothetical protein [Podospora anserina S mat+]
 gi|170945896|emb|CAP72697.1| unnamed protein product [Podospora anserina S mat+]
          Length = 259

 Score = 84.3 bits (208), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 16/74 (21%), Positives = 39/74 (52%), Gaps = 8/74 (10%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
           +  ++   +++Y+  +RGT E DL+L +F    + +++  +L+  +  ++E+D +++ W 
Sbjct: 65  EEPDVMRARLLYQSRKRGTLESDLLLSTFAASHLPKMTPAQLSEYDRFLDENDWDIYYWA 124

Query: 63  T--------GMEKP 68
           T        G   P
Sbjct: 125 TQPNVSLPSGQTPP 138


>gi|116004309|ref|NP_001070513.1| succinate dehydrogenase assembly factor 2, mitochondrial precursor
           [Bos taurus]
 gi|122140757|sp|Q3ZBC2|SDHF2_BOVIN RecName: Full=Succinate dehydrogenase assembly factor 2,
           mitochondrial; Short=SDH assembly factor 2; AltName:
           Full=Succinate dehydrogenase subunit 5, mitochondrial;
           Flags: Precursor
 gi|73587426|gb|AAI03447.1| Hypothetical protein MGC128747 [Bos taurus]
 gi|296471664|gb|DAA13779.1| succinate dehydrogenase assembly factor 2, mitochondrial precursor
           [Bos taurus]
          Length = 166

 Score = 84.3 bits (208), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 16/87 (18%), Positives = 41/87 (47%), Gaps = 2/87 (2%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEE--DDSNLFK 60
           +++  +  +++Y   +RG  E  ++L  F    +  ++  +L + + +I E  +D +++ 
Sbjct: 61  ESIETKRARLLYESRKRGMLENCILLSLFAKEHLQHMTEKQLNLYDRLINEPSNDWDIYY 120

Query: 61  WFTGMEKPPEYLRTPIFKKIYDYYSNN 87
           W T  +  PE     +   + D+  N 
Sbjct: 121 WATEAKPAPEIFENEVMTLLRDFAKNK 147


>gi|262370548|ref|ZP_06063873.1| conserved hypothetical protein [Acinetobacter johnsonii SH046]
 gi|262314348|gb|EEY95390.1| conserved hypothetical protein [Acinetobacter johnsonii SH046]
          Length = 85

 Score = 83.9 bits (207), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 25/86 (29%), Positives = 48/86 (55%), Gaps = 1/86 (1%)

Query: 1  MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
          M + M+L+ RK++YR  RRG +E+D+    +V ++ L+    E  M  +++E++D +L  
Sbjct: 1  MTEEMSLEERKVIYRA-RRGLKEIDVYFDPYVKNYYLQADPAEKAMFAALVEQEDPDLLD 59

Query: 61 WFTGMEKPPEYLRTPIFKKIYDYYSN 86
          WF  + +PP      + +K+  Y   
Sbjct: 60 WFMEVSEPPHPEMKTLIQKLKHYVHG 85


>gi|71649137|ref|XP_813320.1| hypothetical protein [Trypanosoma cruzi strain CL Brener]
 gi|70878192|gb|EAN91469.1| hypothetical protein, conserved [Trypanosoma cruzi]
          Length = 145

 Score = 83.9 bits (207), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 26/90 (28%), Positives = 48/90 (53%), Gaps = 1/90 (1%)

Query: 2   KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
            +  + + R+++Y+   RG  EMD+ILG+F  H +  +   +L   ++I+   DS+LFKW
Sbjct: 50  NEPDDAKRRRLIYQSAYRGMVEMDIILGAFSRHSLEGMPREQLDEYDTILRHFDSDLFKW 109

Query: 62  FTGMEKPPEYLRT-PIFKKIYDYYSNNLDR 90
               EKPP  +     +K + ++     +R
Sbjct: 110 LVMDEKPPASVACMSTYKVLQEFVKGGRER 139


>gi|296116130|ref|ZP_06834748.1| hypothetical protein GXY_10049 [Gluconacetobacter hansenii ATCC
          23769]
 gi|295977236|gb|EFG83996.1| hypothetical protein GXY_10049 [Gluconacetobacter hansenii ATCC
          23769]
          Length = 103

 Score = 83.9 bits (207), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 21/67 (31%), Positives = 35/67 (52%)

Query: 16 CWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPEYLRTP 75
             RGT E D+++G FV   +  +S  EL  LE +++  D++L  W +G    P  + TP
Sbjct: 22 AMHRGTHETDVLIGGFVAPRLEGMSEAELDALEEVMDLPDADLADWLSGRRPIPAEVDTP 81

Query: 76 IFKKIYD 82
          + + I  
Sbjct: 82 MMRAILA 88


>gi|301616462|ref|XP_002937676.1| PREDICTED: succinate dehydrogenase assembly factor 2,
           mitochondrial-like [Xenopus (Silurana) tropicalis]
          Length = 153

 Score = 83.9 bits (207), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 16/89 (17%), Positives = 43/89 (48%), Gaps = 2/89 (2%)

Query: 1   MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEE--DDSNL 58
           + +   ++  ++VY   +RG  E  ++L  F   ++  ++  +L+  + +I    +D +L
Sbjct: 46  LNETPEIKRARLVYESRKRGMLENCILLSLFAKKYLSSMTDTQLSQYDRLINMPSNDWDL 105

Query: 59  FKWFTGMEKPPEYLRTPIFKKIYDYYSNN 87
           + W TG ++ P+     +   + ++  N 
Sbjct: 106 YYWATGAQETPKEFNNEVMDLLKEFAKNK 134


>gi|289617735|emb|CBI61458.1| unnamed protein product [Sordaria macrospora]
          Length = 219

 Score = 83.9 bits (207), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 16/67 (23%), Positives = 35/67 (52%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
           ++      +++Y+  +RGT E DLIL +F    +  ++  +L   +  ++E+D +++ W 
Sbjct: 73  EDPATMRARLLYQSRKRGTLESDLILSTFAQSHLQSMTPEQLKQYDLFLDENDWDIYYWA 132

Query: 63  TGMEKPP 69
           T     P
Sbjct: 133 TQEPPLP 139


>gi|291228396|ref|XP_002734153.1| PREDICTED: succinate dehydrogenase complex assembly factor 2-like
           [Saccoglossus kowalevskii]
          Length = 154

 Score = 83.5 bits (206), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 18/87 (20%), Positives = 42/87 (48%), Gaps = 2/87 (2%)

Query: 2   KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEE--DDSNLF 59
            + +     ++VY+  +RG  E  L+L SF   ++   +  +L + +++I +  +D +++
Sbjct: 53  NETIEKTRARLVYQSRKRGMLENGLLLSSFAARYLKTFNEKQLKLYDNLINKPSNDWDIY 112

Query: 60  KWFTGMEKPPEYLRTPIFKKIYDYYSN 86
            W    +  PE   T I   + ++  N
Sbjct: 113 YWAVENKPTPEEYNTEIMDLLKEFAKN 139


>gi|213404718|ref|XP_002173131.1| early meiotic induction protein [Schizosaccharomyces japonicus
           yFS275]
 gi|257096791|sp|B6JZ70|SDHF2_SCHJY RecName: Full=Succinate dehydrogenase assembly factor 2,
           mitochondrial; Short=SDH assembly factor 2; AltName:
           Full=Early meiotic induction protein 5; AltName:
           Full=Succinate dehydrogenase subunit 5, mitochondrial;
           Flags: Precursor
 gi|212001178|gb|EEB06838.1| early meiotic induction protein [Schizosaccharomyces japonicus
           yFS275]
          Length = 143

 Score = 83.5 bits (206), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 22/87 (25%), Positives = 45/87 (51%), Gaps = 1/87 (1%)

Query: 2   KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
           K+   L   ++VY+  +RG  E DLIL  F   ++ + +   L   ++++ E D ++  W
Sbjct: 47  KETEKLLRSRLVYQSRKRGILETDLILSGFAKEYLSKYNVELLKEYDNLLNEADWDILYW 106

Query: 62  FTGMEKPPEYL-RTPIFKKIYDYYSNN 87
            TG  + PE+   + + + + +Y S+ 
Sbjct: 107 CTGERQAPEHWLNSRVLRDLKEYLSSK 133


>gi|255727997|ref|XP_002548924.1| conserved hypothetical protein [Candida tropicalis MYA-3404]
 gi|240133240|gb|EER32796.1| conserved hypothetical protein [Candida tropicalis MYA-3404]
          Length = 151

 Score = 83.5 bits (206), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 18/89 (20%), Positives = 44/89 (49%), Gaps = 4/89 (4%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
           + + ++  +++Y+  +RG  E DL++  + D  +  ++  EL   + +++E D +++ W 
Sbjct: 48  ETLEVKRARLLYQSRKRGILESDLLMSRYADARLNSMTMEELDEYDKLLDEADWDIYYWA 107

Query: 63  TG---MEKPPEYL-RTPIFKKIYDYYSNN 87
           T    +   P+    + I K+I     N 
Sbjct: 108 TKNYTVTPLPDKWKDSKILKEIQKLAENE 136


>gi|325917576|ref|ZP_08179776.1| hypothetical protein XVE_3784 [Xanthomonas vesicatoria ATCC
          35937]
 gi|325536210|gb|EGD08006.1| hypothetical protein XVE_3784 [Xanthomonas vesicatoria ATCC
          35937]
          Length = 98

 Score = 83.5 bits (206), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 22/79 (27%), Positives = 38/79 (48%), Gaps = 1/79 (1%)

Query: 4  NMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFT 63
          +     +K+ +RC RRG RE+D + G F+D      S  E  +   +++ +D  L++WF 
Sbjct: 18 DEETLLKKLRWRC-RRGMRELDQLFGRFLDQRWAHASEGERAVFLQLLDCEDDKLWRWFM 76

Query: 64 GMEKPPEYLRTPIFKKIYD 82
          G E  P+     +   I  
Sbjct: 77 GYEACPDVANAALIADIRA 95


>gi|328703515|ref|XP_001950307.2| PREDICTED: succinate dehydrogenase assembly factor 2-A,
           mitochondrial-like [Acyrthosiphon pisum]
 gi|239789442|dbj|BAH71346.1| ACYPI004221 [Acyrthosiphon pisum]
          Length = 134

 Score = 83.5 bits (206), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 19/87 (21%), Positives = 41/87 (47%), Gaps = 2/87 (2%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIE--EDDSNLFK 60
             ++L   +++Y+  +RG  E  +I  SF D ++   +  EL   +++I    D+ +L+ 
Sbjct: 47  SELDLMRSRLIYQSRKRGILENCIIFTSFADKYLKTFNCEELQKYDALINSKFDEWDLYA 106

Query: 61  WFTGMEKPPEYLRTPIFKKIYDYYSNN 87
           W  G +  P+     I K + ++    
Sbjct: 107 WSIGSKPAPQEFDNDILKLLKNHVQKR 133


>gi|322493503|emb|CBZ28791.1| conserved hypothetical protein [Leishmania mexicana
           MHOM/GT/2001/U1103]
          Length = 235

 Score = 83.1 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 26/96 (27%), Positives = 50/96 (52%), Gaps = 3/96 (3%)

Query: 2   KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
           K+++  + R+++Y+   RG  EMDLI G F    +  L +  L   ++++++ DS LF+W
Sbjct: 141 KESVECKRRRLIYQSRYRGMVEMDLIFGHFARCKLETLDASMLDEYDTLLKQLDSELFRW 200

Query: 62  FTGMEKPPEYL-RTPIFKKIYDYYSNNLDRKNMLGS 96
                  PE + +   F ++  +     +R  +LGS
Sbjct: 201 LVMGVDAPEGMTKLRCFDELRRFIK--EERTELLGS 234


>gi|297267713|ref|XP_001082231.2| PREDICTED: succinate dehydrogenase assembly factor 2, mitochondrial
           isoform 2 [Macaca mulatta]
          Length = 165

 Score = 83.1 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 16/87 (18%), Positives = 41/87 (47%), Gaps = 2/87 (2%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEE--DDSNLFK 60
           +++  +  +++Y   +RG  E  ++L  F    +  ++  +L + + +I E  +D +++ 
Sbjct: 60  ESIETKRARLLYESRKRGMLENCILLSLFAKEHLQHMTEKQLNLYDRLINEPSNDWDIYY 119

Query: 61  WFTGMEKPPEYLRTPIFKKIYDYYSNN 87
           W T  +  PE     +   + D+  N 
Sbjct: 120 WATEAKPAPEIFENEVMALLRDFAKNK 146


>gi|17537623|ref|NP_496607.1| hypothetical protein Y57A10A.29 [Caenorhabditis elegans]
 gi|75023741|sp|Q9NA72|SDHF2_CAEEL RecName: Full=Succinate dehydrogenase assembly factor 2,
           mitochondrial; Short=SDH assembly factor 2; AltName:
           Full=Succinate dehydrogenase subunit 5, mitochondrial;
           Flags: Precursor
 gi|5832946|emb|CAB55034.1| C. elegans protein Y57A10A.29, confirmed by transcript evidence
           [Caenorhabditis elegans]
          Length = 119

 Score = 83.1 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 19/93 (20%), Positives = 51/93 (54%), Gaps = 3/93 (3%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEED--DSNLFK 60
           + ++ +  +++Y+  +RG  E D++LG F +  + ++S  EL   + +I  +  + +LF 
Sbjct: 27  EKIDAKRARLLYQSKKRGILENDILLGDFAEQNLKKMSEPELKAYDKLINGEHMEWDLFY 86

Query: 61  WFTGMEKPPEYLRT-PIFKKIYDYYSNNLDRKN 92
           + +  + PPE + +  +++K+  +  +    K+
Sbjct: 87  YLSNKKSPPEDVESCQVYQKVKKFVDDKRVPKS 119


>gi|312113595|ref|YP_004011191.1| hypothetical protein Rvan_0816 [Rhodomicrobium vannielii ATCC
          17100]
 gi|311218724|gb|ADP70092.1| protein of unknown function DUF339 [Rhodomicrobium vannielii ATCC
          17100]
          Length = 83

 Score = 83.1 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 23/83 (27%), Positives = 43/83 (51%), Gaps = 2/83 (2%)

Query: 3  KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
            + L+ ++ VYR   RGT+E+DLILG + +  +  +   +L   E+++   D ++  W 
Sbjct: 2  DGLELRRKRAVYRALHRGTKELDLILGRYAEARVPLMEEAQLASFETVLAAQDPDVDLWI 61

Query: 63 TGMEKPPEYLRTPIFKKIYDYYS 85
             + P E   + I  +I D+Y 
Sbjct: 62 RKGDAPGEL--SAIVAEIRDFYR 82


>gi|323352324|gb|EGA84859.1| Emi5p [Saccharomyces cerevisiae VL3]
          Length = 126

 Score = 83.1 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 15/64 (23%), Positives = 36/64 (56%)

Query: 2   KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
            + ++ +  +++Y+  +RG  E DL+L  F   ++ +++  EL   +S++ E D +++ W
Sbjct: 56  NEPLDKKRARLIYQSRKRGILETDLLLSGFAAKYLKKMNEEELEEYDSLLNELDWDIYYW 115

Query: 62  FTGM 65
            T  
Sbjct: 116 ATKK 119


>gi|323307074|gb|EGA60357.1| Emi5p [Saccharomyces cerevisiae FostersO]
          Length = 129

 Score = 83.1 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 15/64 (23%), Positives = 36/64 (56%)

Query: 2   KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
            + ++ +  +++Y+  +RG  E DL+L  F   ++ +++  EL   +S++ E D +++ W
Sbjct: 59  NEPLDKKRARLIYQSRKRGILETDLLLSGFAAKYLKKMNEEELEEYDSLLNELDWDIYYW 118

Query: 62  FTGM 65
            T  
Sbjct: 119 ATKK 122


>gi|9929929|dbj|BAB12121.1| hypothetical protein [Macaca fascicularis]
          Length = 154

 Score = 83.1 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 16/87 (18%), Positives = 41/87 (47%), Gaps = 2/87 (2%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEE--DDSNLFK 60
           +++  +  +++Y   +RG  E  ++L  F    +  ++  +L + + +I E  +D +++ 
Sbjct: 49  ESIETKRARLLYESRKRGMLENCILLSLFAKEHLQHMTEKQLNLYDRLINEPSNDWDIYY 108

Query: 61  WFTGMEKPPEYLRTPIFKKIYDYYSNN 87
           W T  +  PE     +   + D+  N 
Sbjct: 109 WATEAKPAPEIFENEVMALLRDFAKNK 135


>gi|320037327|gb|EFW19264.1| TPR repeat protein [Coccidioides posadasii str. Silveira]
          Length = 201

 Score = 82.8 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 16/67 (23%), Positives = 36/67 (53%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
           +++     +++Y+  +RGT E DL+L +F    +  +S  +L   +  ++E+D +++ W 
Sbjct: 46  EDVATMRARLLYQSRKRGTLESDLLLSTFAATNLSTMSKSQLEEYDRFLDENDWDIYYWA 105

Query: 63  TGMEKPP 69
           T     P
Sbjct: 106 TQEPPAP 112


>gi|20987204|gb|AAH29630.1| 0610038F07Rik protein [Mus musculus]
          Length = 108

 Score = 82.8 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 15/87 (17%), Positives = 43/87 (49%), Gaps = 2/87 (2%)

Query: 3  KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEE--DDSNLFK 60
          +++  +  +++Y   +RG  E  ++L  F   ++  ++  +L + + +I E  +D +++ 
Sbjct: 3  ESIETKRARLLYESRKRGMLENCILLSLFAKEYLHNMTEKQLNLYDRLINEPSNDWDIYY 62

Query: 61 WFTGMEKPPEYLRTPIFKKIYDYYSNN 87
          W T  +  PE     + + + ++  N 
Sbjct: 63 WATEAKPAPEIFENEVMELLREFAKNK 89


>gi|50086186|ref|YP_047696.1| hypothetical protein ACIAD3189 [Acinetobacter sp. ADP1]
 gi|81175081|sp|Q6F7U1|Y3189_ACIAD RecName: Full=UPF0350 protein ACIAD3189
 gi|49532162|emb|CAG69874.1| conserved hypothetical protein [Acinetobacter sp. ADP1]
          Length = 85

 Score = 82.8 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 22/86 (25%), Positives = 46/86 (53%), Gaps = 1/86 (1%)

Query: 1  MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
          M + + L+ RK++YR  RRG +E+D+    +V ++ L   + E  +   ++ ++D +L  
Sbjct: 1  MSEELTLEERKVIYRA-RRGLKEIDVYFDPYVKNYYLTAPASEKALFAELVAQEDPDLLD 59

Query: 61 WFTGMEKPPEYLRTPIFKKIYDYYSN 86
          WF  + +PP+     + +K+  Y   
Sbjct: 60 WFMEVSEPPQVELKQLIQKLKHYVHG 85


>gi|268533196|ref|XP_002631726.1| Hypothetical protein CBG20928 [Caenorhabditis briggsae]
 gi|257096769|sp|A8XYZ2|SDHF2_CAEBR RecName: Full=Succinate dehydrogenase assembly factor 2,
           mitochondrial; Short=SDH assembly factor 2; AltName:
           Full=Succinate dehydrogenase subunit 5, mitochondrial;
           Flags: Precursor
 gi|187023179|emb|CAP37859.1| hypothetical protein CBG_20928 [Caenorhabditis briggsae AF16]
          Length = 122

 Score = 82.4 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 18/85 (21%), Positives = 48/85 (56%), Gaps = 3/85 (3%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEED--DSNLFK 60
           + ++ +  +++Y+  +RG  E D++LG+F +  + ++S  EL   + +I  +  + +LF 
Sbjct: 30  EQLDAKRARLLYQSKKRGILENDILLGNFAEENLKKMSEPELKAYDKLINGEHMEWDLFY 89

Query: 61  WFTGMEKPPEYLR-TPIFKKIYDYY 84
           + +  + PPE +    +++K+  + 
Sbjct: 90  YLSNKKTPPEDVEKCSVYQKVKKFV 114


>gi|149639766|ref|XP_001505276.1| PREDICTED: hypothetical protein [Ornithorhynchus anatinus]
          Length = 160

 Score = 82.4 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 16/87 (18%), Positives = 41/87 (47%), Gaps = 2/87 (2%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEE--DDSNLFK 60
           +++  +  +++Y   +RG  E  ++L  F    +  ++  +L + + +I E  +D +++ 
Sbjct: 55  ESLETKRARLLYESRKRGMLENCILLSLFAKENLQHMTERQLNLYDRLINEPSNDWDIYY 114

Query: 61  WFTGMEKPPEYLRTPIFKKIYDYYSNN 87
           W T  +  PE     +   + D+  N 
Sbjct: 115 WATEAKPAPEIFENEVMDLLRDFAKNK 141


>gi|326919935|ref|XP_003206232.1| PREDICTED: succinate dehydrogenase assembly factor 2,
           mitochondrial-like [Meleagris gallopavo]
          Length = 168

 Score = 82.4 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 14/88 (15%), Positives = 37/88 (42%), Gaps = 2/88 (2%)

Query: 2   KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEE--DDSNLF 59
            + +  +  +++Y   +RG  E  ++L  F    +  +   +L + + +I E  +D +++
Sbjct: 53  NEPLPTKRARLLYESRKRGMLENCILLSLFAKENLSRMDERQLNLYDRLINEPSNDWDIY 112

Query: 60  KWFTGMEKPPEYLRTPIFKKIYDYYSNN 87
            W T  +  P      +   + +   N 
Sbjct: 113 YWATEAKPTPAVFDNEVMAMLKELAKNK 140


>gi|118111401|ref|XP_423694.2| PREDICTED: hypothetical protein, partial [Gallus gallus]
          Length = 154

 Score = 82.4 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 14/88 (15%), Positives = 37/88 (42%), Gaps = 2/88 (2%)

Query: 2   KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEE--DDSNLF 59
            + +  +  +++Y   +RG  E  ++L  F    +  +   +L + + +I E  +D +++
Sbjct: 48  NEPLPTKRARLLYESRKRGMLENCILLSLFAKENLSRMDERQLNLYDRLINEPSNDWDIY 107

Query: 60  KWFTGMEKPPEYLRTPIFKKIYDYYSNN 87
            W T  +  P      +   + +   N 
Sbjct: 108 YWATEAKPTPAVFDNEVMAMLKELAKNK 135


>gi|255947182|ref|XP_002564358.1| Pc22g03150 [Penicillium chrysogenum Wisconsin 54-1255]
 gi|257096775|sp|B6HRA4|SDHF2_PENCW RecName: Full=Succinate dehydrogenase assembly factor 2,
           mitochondrial; Short=SDH assembly factor 2; AltName:
           Full=Early meiotic induction protein 5; AltName:
           Full=Succinate dehydrogenase subunit 5, mitochondrial;
           Flags: Precursor
 gi|211591375|emb|CAP97603.1| Pc22g03150 [Penicillium chrysogenum Wisconsin 54-1255]
          Length = 310

 Score = 82.4 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 15/65 (23%), Positives = 38/65 (58%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
           + +  +  +++Y+  +RG  E DL+L +F D ++ +++  +L   +S ++E+D +++ W 
Sbjct: 140 EELATKRARLLYQSRKRGILESDLLLSTFADVYLGKMNYDQLVEYDSFLDENDWDIYYWA 199

Query: 63  TGMEK 67
           T    
Sbjct: 200 TQDSP 204


>gi|58581929|ref|YP_200945.1| hypothetical protein XOO2306 [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|75435398|sp|Q5H0G1|Y2306_XANOR RecName: Full=UPF0350 protein XOO2306
 gi|58426523|gb|AAW75560.1| conserved hypothetical protein [Xanthomonas oryzae pv. oryzae
           KACC10331]
          Length = 107

 Score = 82.0 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 20/79 (25%), Positives = 39/79 (49%), Gaps = 1/79 (1%)

Query: 4   NMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFT 63
           +   + +K+ +RC RRG RE+D + G ++D    +    E  +   +++ +D  L++WF 
Sbjct: 27  DEQTRLKKLRWRC-RRGMRELDQLFGRYLDQRWAQAPDAERAVFLQLLDCEDDKLWRWFM 85

Query: 64  GMEKPPEYLRTPIFKKIYD 82
           G E  P+     +   I  
Sbjct: 86  GYEACPDVANAALIADIRA 104


>gi|308198174|ref|XP_001387124.2| predicted protein [Scheffersomyces stipitis CBS 6054]
 gi|257096795|sp|A3GHR8|SDHF2_PICST RecName: Full=Succinate dehydrogenase assembly factor 2,
           mitochondrial; Short=SDH assembly factor 2; AltName:
           Full=Early meiotic induction protein 5; AltName:
           Full=Succinate dehydrogenase subunit 5, mitochondrial;
           Flags: Precursor
 gi|149389066|gb|EAZ63101.2| predicted protein [Pichia stipitis CBS 6054]
          Length = 149

 Score = 82.0 bits (202), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 20/89 (22%), Positives = 45/89 (50%), Gaps = 4/89 (4%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
           + M ++  +++Y+  +RG  E DL+L  F   ++ E +  EL   + +++E D +++ W 
Sbjct: 46  ETMEIKRARLIYQSRKRGILESDLLLSRFAKKYLNEFTEAELDEYDRLLDEPDWDIYYWA 105

Query: 63  TG---MEKPPEYL-RTPIFKKIYDYYSNN 87
           T    +   P+    + I K + +   N+
Sbjct: 106 TKNYDVTPLPDKWKDSKILKMLQEDAKND 134


>gi|84623841|ref|YP_451213.1| hypothetical protein XOO_2184 [Xanthomonas oryzae pv. oryzae MAFF
          311018]
 gi|188576496|ref|YP_001913425.1| TPR repeat region superfamily [Xanthomonas oryzae pv. oryzae
          PXO99A]
 gi|84367781|dbj|BAE68939.1| conserved hypothetical protein [Xanthomonas oryzae pv. oryzae
          MAFF 311018]
 gi|188520948|gb|ACD58893.1| TPR repeat region superfamily [Xanthomonas oryzae pv. oryzae
          PXO99A]
          Length = 82

 Score = 81.6 bits (201), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 20/79 (25%), Positives = 39/79 (49%), Gaps = 1/79 (1%)

Query: 4  NMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFT 63
          +   + +K+ +RC RRG RE+D + G ++D    +    E  +   +++ +D  L++WF 
Sbjct: 2  DEQTRLKKLRWRC-RRGMRELDQLFGRYLDQRWAQAPDAERAVFLQLLDCEDDKLWRWFM 60

Query: 64 GMEKPPEYLRTPIFKKIYD 82
          G E  P+     +   I  
Sbjct: 61 GYEACPDVANAALIADIRA 79


>gi|312371840|gb|EFR19926.1| hypothetical protein AND_21583 [Anopheles darlingi]
          Length = 152

 Score = 81.2 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 21/95 (22%), Positives = 43/95 (45%), Gaps = 3/95 (3%)

Query: 2   KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEE--DDSNLF 59
           KKN  LQ +K  +   +RG  E  L+L +F   ++  +   +  + + +I    +D ++F
Sbjct: 50  KKNEPLQLQKSRF-SRKRGMLENGLLLSTFAAKYLHGMDPQQTKLYDRLINLPSNDWDIF 108

Query: 60  KWFTGMEKPPEYLRTPIFKKIYDYYSNNLDRKNML 94
            W TG++  P+     +   +  +  NN   +   
Sbjct: 109 YWATGVKPTPKEYDNEVMDLLKAHVKNNEREQRFT 143


>gi|322801999|gb|EFZ22536.1| hypothetical protein SINV_05965 [Solenopsis invicta]
          Length = 161

 Score = 81.2 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 18/86 (20%), Positives = 41/86 (47%), Gaps = 3/86 (3%)

Query: 11  KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEE--DDSNLFKWFTGMEKP 68
           ++ Y+  +RG  E  L+L +F + ++      +L + + +I    +D ++F W TG++  
Sbjct: 72  RLTYQSRKRGMLENGLLLSTFANKYLNTFDDKQLRLYDRLINLPSNDWDIFYWATGVKPT 131

Query: 69  PEYLRTPIFKKIYDYYSNNLDRKNML 94
           P      +   +  +   N DR+  +
Sbjct: 132 PREFDNEVMDLLKKHIQ-NEDRQARI 156


>gi|164656893|ref|XP_001729573.1| hypothetical protein MGL_3117 [Malassezia globosa CBS 7966]
 gi|159103466|gb|EDP42359.1| hypothetical protein MGL_3117 [Malassezia globosa CBS 7966]
          Length = 184

 Score = 81.2 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 21/73 (28%), Positives = 37/73 (50%)

Query: 2   KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
            ++      ++ Y+C +RGT E DL+L +F    +  L   EL  L+ +++E D ++F W
Sbjct: 74  NEDRPRLLARLQYQCRKRGTLETDLLLSTFAHEELRRLPDDELHELDRLLDEPDWDIFYW 133

Query: 62  FTGMEKPPEYLRT 74
            T  +  PE    
Sbjct: 134 CTDRKPVPERWHA 146


>gi|323335642|gb|EGA76925.1| Emi5p [Saccharomyces cerevisiae Vin13]
          Length = 126

 Score = 81.2 bits (200), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 14/60 (23%), Positives = 35/60 (58%)

Query: 2   KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
            + ++ +  +++Y+  +RG  E DL+L  F   ++ +++  EL   +S++ E D +++ W
Sbjct: 56  NEPLDKKRARLIYQSRKRGILETDLLLSGFAAKYLKKMNEEELEEYDSLLNELDWDIYYW 115


>gi|221487116|gb|EEE25362.1| conserved hypothetical protein [Toxoplasma gondii GT1]
          Length = 215

 Score = 80.4 bits (198), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 23/88 (26%), Positives = 47/88 (53%), Gaps = 5/88 (5%)

Query: 6   NLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGM 65
           + + ++++YR  +RG  E+DL+LG++ D  +  +S+ E+  LE I+  ++  LF    G 
Sbjct: 109 SERLKRLMYRAKQRGWVELDLLLGAYCDENVPSMSTEEVEELEKILAAENVVLFDCLVGK 168

Query: 66  E-----KPPEYLRTPIFKKIYDYYSNNL 88
           +      PPE+     ++K+  +    L
Sbjct: 169 DWKRAPAPPEFGHLSQWRKLSAFVEARL 196


>gi|255319784|ref|ZP_05360989.1| TPR repeat-containing domain protein [Acinetobacter
          radioresistens SK82]
 gi|262380318|ref|ZP_06073472.1| UPF0350 protein [Acinetobacter radioresistens SH164]
 gi|255303103|gb|EET82315.1| TPR repeat-containing domain protein [Acinetobacter
          radioresistens SK82]
 gi|262297764|gb|EEY85679.1| UPF0350 protein [Acinetobacter radioresistens SH164]
          Length = 85

 Score = 80.4 bits (198), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 23/86 (26%), Positives = 43/86 (50%), Gaps = 1/86 (1%)

Query: 1  MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
          M + M L+ RK++YR  RRG +E+D+    +V  + L+  + E      ++ ++D +L  
Sbjct: 1  MSEEMTLEERKVIYRA-RRGLKEIDVYFDPYVKQYYLQADAEEKATFAELVAQEDPDLLD 59

Query: 61 WFTGMEKPPEYLRTPIFKKIYDYYSN 86
          WF  + +PP      +  K+  Y   
Sbjct: 60 WFMEVSEPPRPEMKQLIIKLKHYVHG 85


>gi|310793704|gb|EFQ29165.1| hypothetical protein GLRG_04309 [Glomerella graminicola M1.001]
          Length = 231

 Score = 80.4 bits (198), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 14/69 (20%), Positives = 38/69 (55%), Gaps = 1/69 (1%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
           ++      +++Y+  +RGT E DL++ +F +  +  ++  ++   +  ++E+D +++ W 
Sbjct: 67  EDERTMRARLLYQSRKRGTLESDLLMSTFANEHLPHMTKAQMQQYDLFLDENDWDIYYWA 126

Query: 63  TGMEKPPEY 71
           T  E+ P  
Sbjct: 127 T-QEEAPSN 134


>gi|19115550|ref|NP_594638.1| DUF339 family protein [Schizosaccharomyces pombe 972h-]
 gi|1723550|sp|Q10440|SDHF2_SCHPO RecName: Full=Succinate dehydrogenase assembly factor 2,
           mitochondrial; Short=SDH assembly factor 2; AltName:
           Full=Early meiotic induction protein 5; AltName:
           Full=Succinate dehydrogenase subunit 5, mitochondrial;
           Flags: Precursor
 gi|1262419|emb|CAA94696.1| DUF339 family protein [Schizosaccharomyces pombe]
          Length = 139

 Score = 80.1 bits (197), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 19/89 (21%), Positives = 43/89 (48%), Gaps = 1/89 (1%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
           +  +    ++ Y+  +RG  E DL+L +F    I +     L   + +++E D ++  W 
Sbjct: 43  ETRDAMLARLKYQSRKRGILETDLLLSNFAKDQIDKYPVSLLREYDQLLDEPDWDILYWC 102

Query: 63  TGMEKPPEYLR-TPIFKKIYDYYSNNLDR 90
           +G  + PE  + + +FK++  Y  +  + 
Sbjct: 103 SGEREAPEKWKSSQVFKELSKYCRSQRNH 131


>gi|56696155|ref|YP_166511.1| TPR repeat-containing protein [Ruegeria pomeroyi DSS-3]
 gi|56677892|gb|AAV94558.1| TPR repeat family protein [Ruegeria pomeroyi DSS-3]
          Length = 85

 Score = 80.1 bits (197), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 23/80 (28%), Positives = 45/80 (56%), Gaps = 1/80 (1%)

Query: 1  MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
          M ++   + +++  R  RRG +EMDLIL ++ D  I  + +  L + ++++ E+D +L++
Sbjct: 1  MSESRETRIKRMRMRSMRRGIKEMDLILSAYADRSIEAMDAGALDLYDALLHENDQDLYQ 60

Query: 61 WFTGMEKPPEYLRTPIFKKI 80
          W TG    P+  R  +   I
Sbjct: 61 WVTGQVSAPDRYR-DLIADI 79


>gi|308495654|ref|XP_003110015.1| hypothetical protein CRE_06477 [Caenorhabditis remanei]
 gi|308244852|gb|EFO88804.1| hypothetical protein CRE_06477 [Caenorhabditis remanei]
          Length = 123

 Score = 80.1 bits (197), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 17/85 (20%), Positives = 48/85 (56%), Gaps = 3/85 (3%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEED--DSNLFK 60
           + ++ +  +++Y+  +RG  E D++LG F +  + +++  EL   + +I  +  + +LF 
Sbjct: 30  EQIDAKRARLLYQSKKRGILENDILLGDFAEGNLKKMNETELKAYDKLINGEHMEWDLFY 89

Query: 61  WFTGMEKPPEYLRT-PIFKKIYDYY 84
           + +  + PPE + +  +++K+  + 
Sbjct: 90  YLSNKKTPPEDVESCQVYQKVKKFV 114


>gi|78047802|ref|YP_363977.1| hypothetical protein XCV2246 [Xanthomonas campestris pv.
          vesicatoria str. 85-10]
 gi|325928372|ref|ZP_08189567.1| hypothetical protein XPE_3623 [Xanthomonas perforans 91-118]
 gi|78036232|emb|CAJ23923.1| conserved hypothetical protein [Xanthomonas campestris pv.
          vesicatoria str. 85-10]
 gi|325541248|gb|EGD12795.1| hypothetical protein XPE_3623 [Xanthomonas perforans 91-118]
          Length = 82

 Score = 79.7 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 20/79 (25%), Positives = 38/79 (48%), Gaps = 1/79 (1%)

Query: 4  NMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFT 63
          +     +K+ +RC RRG RE+D + G ++D    +    E  +   +++ +D  L++WF 
Sbjct: 2  DEQTLLKKLRWRC-RRGMRELDQLFGRYLDQRWAQAPDAERAVFLQLLDCEDDKLWRWFM 60

Query: 64 GMEKPPEYLRTPIFKKIYD 82
          G E  P+     +   I  
Sbjct: 61 GYEACPDAANAALIADIRA 79


>gi|237831473|ref|XP_002365034.1| hypothetical protein TGME49_058100 [Toxoplasma gondii ME49]
 gi|211962698|gb|EEA97893.1| hypothetical protein TGME49_058100 [Toxoplasma gondii ME49]
          Length = 144

 Score = 79.7 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 23/88 (26%), Positives = 47/88 (53%), Gaps = 5/88 (5%)

Query: 6   NLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGM 65
           + + ++++YR  +RG  E+DL+LG++ D  +  +S+ E+  LE I+  ++  LF    G 
Sbjct: 38  SERLKRLMYRAKQRGWVELDLLLGAYCDENVPSMSTEEVEELEKILAAENVVLFDCLVGK 97

Query: 66  E-----KPPEYLRTPIFKKIYDYYSNNL 88
           +      PPE+     ++K+  +    L
Sbjct: 98  DWKRAPAPPEFGHLSQWRKLSAFVEARL 125


>gi|294651602|ref|ZP_06728907.1| conserved hypothetical protein [Acinetobacter haemolyticus ATCC
          19194]
 gi|292822511|gb|EFF81409.1| conserved hypothetical protein [Acinetobacter haemolyticus ATCC
          19194]
          Length = 85

 Score = 79.7 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 22/86 (25%), Positives = 43/86 (50%), Gaps = 1/86 (1%)

Query: 1  MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
          M + + L+ RK++YR  RRG +E+D+    +V +  L   + E  +   +++++D +L  
Sbjct: 1  MSEELTLEERKVIYRA-RRGLKEIDVYFDPYVKNCYLTADAAEKALFAELVDQEDPDLLD 59

Query: 61 WFTGMEKPPEYLRTPIFKKIYDYYSN 86
          WF  + +PP         K+  Y   
Sbjct: 60 WFMEVGEPPRPELKAFISKLKQYVHG 85


>gi|260549811|ref|ZP_05824027.1| UPF0350 protein [Acinetobacter sp. RUH2624]
 gi|260407061|gb|EEX00538.1| UPF0350 protein [Acinetobacter sp. RUH2624]
          Length = 85

 Score = 79.7 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 25/86 (29%), Positives = 44/86 (51%), Gaps = 1/86 (1%)

Query: 1  MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
          M + M L+ RK+VYR  RRG +E+D+    +V ++ L+    E  +   ++E++D +L  
Sbjct: 1  MSEEMTLEERKVVYRA-RRGLKEIDVYFDPYVKNYYLKADPAEKALFAELVEQEDPDLLD 59

Query: 61 WFTGMEKPPEYLRTPIFKKIYDYYSN 86
          WF  + +PP         K+  Y   
Sbjct: 60 WFMEVSEPPRTELRDFIHKLKHYVHG 85


>gi|289665887|ref|ZP_06487468.1| hypothetical protein XcampvN_23122 [Xanthomonas campestris pv.
          vasculorum NCPPB702]
          Length = 101

 Score = 79.3 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 20/79 (25%), Positives = 37/79 (46%), Gaps = 1/79 (1%)

Query: 4  NMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFT 63
          +     +K+ +RC RRG RE+D + G ++D         E  +   +++ +D  L++WF 
Sbjct: 21 DEQTLLKKLRWRC-RRGMRELDQLFGRYLDQRWARAPEAERAVFLQLLDCEDDKLWRWFM 79

Query: 64 GMEKPPEYLRTPIFKKIYD 82
          G E  P+     +   I  
Sbjct: 80 GYEACPDAANAALIADIRA 98


>gi|169632379|ref|YP_001706115.1| hypothetical protein ABSDF0452 [Acinetobacter baumannii SDF]
 gi|169794623|ref|YP_001712416.1| hypothetical protein ABAYE0437 [Acinetobacter baumannii AYE]
 gi|184159569|ref|YP_001847908.1| hypothetical protein ACICU_03249 [Acinetobacter baumannii ACICU]
 gi|213158806|ref|YP_002320804.1| hypothetical protein AB57_3501 [Acinetobacter baumannii AB0057]
 gi|215482212|ref|YP_002324394.1| hypothetical protein ABBFA_000461 [Acinetobacter baumannii
          AB307-0294]
 gi|239503205|ref|ZP_04662515.1| hypothetical protein AbauAB_12923 [Acinetobacter baumannii AB900]
 gi|260557056|ref|ZP_05829273.1| UPF0350 protein [Acinetobacter baumannii ATCC 19606]
 gi|301348161|ref|ZP_07228902.1| hypothetical protein AbauAB0_17986 [Acinetobacter baumannii
          AB056]
 gi|301513379|ref|ZP_07238616.1| hypothetical protein AbauAB05_17401 [Acinetobacter baumannii
          AB058]
 gi|301595213|ref|ZP_07240221.1| hypothetical protein AbauAB059_05366 [Acinetobacter baumannii
          AB059]
 gi|332853168|ref|ZP_08434605.1| TPR repeat region [Acinetobacter baumannii 6013150]
 gi|332868586|ref|ZP_08438242.1| TPR repeat region [Acinetobacter baumannii 6013113]
 gi|332876054|ref|ZP_08443838.1| TPR repeat region [Acinetobacter baumannii 6014059]
 gi|169147550|emb|CAM85411.1| conserved hypothetical protein [Acinetobacter baumannii AYE]
 gi|169151171|emb|CAO99843.1| conserved hypothetical protein [Acinetobacter baumannii]
 gi|183211163|gb|ACC58561.1| hypothetical protein ACICU_03249 [Acinetobacter baumannii ACICU]
 gi|193078458|gb|ABO13449.2| hypothetical protein A1S_3052 [Acinetobacter baumannii ATCC
          17978]
 gi|213057966|gb|ACJ42868.1| conserved hypothetical protein [Acinetobacter baumannii AB0057]
 gi|213989108|gb|ACJ59407.1| conserved hypothetical protein [Acinetobacter baumannii
          AB307-0294]
 gi|260409662|gb|EEX02963.1| UPF0350 protein [Acinetobacter baumannii ATCC 19606]
 gi|322509479|gb|ADX04933.1| Putative uncharacterized protein [Acinetobacter baumannii 1656-2]
 gi|323519500|gb|ADX93881.1| hypothetical protein ABTW07_3464 [Acinetobacter baumannii
          TCDC-AB0715]
 gi|332728837|gb|EGJ60196.1| TPR repeat region [Acinetobacter baumannii 6013150]
 gi|332733263|gb|EGJ64457.1| TPR repeat region [Acinetobacter baumannii 6013113]
 gi|332735672|gb|EGJ66715.1| TPR repeat region [Acinetobacter baumannii 6014059]
          Length = 85

 Score = 78.9 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 24/86 (27%), Positives = 44/86 (51%), Gaps = 1/86 (1%)

Query: 1  MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
          M + M L+ RK++YR  RRG +E+D+    +V ++ L+    E  +   ++E++D +L  
Sbjct: 1  MSEEMTLEERKVIYRA-RRGLKEIDVYFDPYVKNYYLKADPAEKALFAELVEQEDPDLLD 59

Query: 61 WFTGMEKPPEYLRTPIFKKIYDYYSN 86
          WF  + +PP         K+  Y   
Sbjct: 60 WFMEVSEPPRTELRDFIYKLKHYVHG 85


>gi|262373490|ref|ZP_06066768.1| conserved hypothetical protein [Acinetobacter junii SH205]
 gi|262311243|gb|EEY92329.1| conserved hypothetical protein [Acinetobacter junii SH205]
          Length = 85

 Score = 78.9 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 23/86 (26%), Positives = 41/86 (47%), Gaps = 1/86 (1%)

Query: 1  MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
          M   M L+ RK++YR  RRG +E+D+    +V  + L     E  +   +++++D +L  
Sbjct: 1  MSDEMTLEERKVIYRA-RRGLKEIDVYFDPYVKQYYLTADPTEKALFAELVDQEDPDLLD 59

Query: 61 WFTGMEKPPEYLRTPIFKKIYDYYSN 86
          WF  + +PP         K+  Y   
Sbjct: 60 WFMEVGEPPREELKAFILKLKKYVHG 85


>gi|308048441|ref|YP_003912007.1| hypothetical protein Fbal_0722 [Ferrimonas balearica DSM 9799]
 gi|307630631|gb|ADN74933.1| protein of unknown function DUF339 [Ferrimonas balearica DSM
          9799]
          Length = 89

 Score = 78.5 bits (193), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 23/82 (28%), Positives = 39/82 (47%), Gaps = 1/82 (1%)

Query: 1  MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
          M        +++ +   RRG  E+D++L  FV+   L LS  +    E +++EDD +LF 
Sbjct: 5  MTTEEFEVIKRLKW-ACRRGMLELDVLLEPFVERHFLGLSPAQQQAFERLLKEDDPDLFA 63

Query: 61 WFTGMEKPPEYLRTPIFKKIYD 82
          WF G    P+     +   I +
Sbjct: 64 WFMGHAPCPDPELADMVALILE 85


>gi|170595000|ref|XP_001902208.1| TM2 domain containing protein [Brugia malayi]
 gi|158590242|gb|EDP28944.1| TM2 domain containing protein [Brugia malayi]
          Length = 336

 Score = 78.5 bits (193), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 18/75 (24%), Positives = 43/75 (57%), Gaps = 2/75 (2%)

Query: 2   KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEED--DSNLF 59
            +N+  +  +++Y+  +RG  E D++LG F +  + ++S  +L   + II  +  + +L+
Sbjct: 47  NENIETKRSRLLYQSKKRGILENDILLGEFANQMLQKMSIQQLMRYDEIINGEYMEWDLY 106

Query: 60  KWFTGMEKPPEYLRT 74
            + +G +  PE L++
Sbjct: 107 YYMSGRKDLPEDLKS 121


>gi|299768695|ref|YP_003730721.1| hypothetical protein AOLE_02235 [Acinetobacter sp. DR1]
 gi|298698783|gb|ADI89348.1| hypothetical protein AOLE_02235 [Acinetobacter sp. DR1]
          Length = 85

 Score = 78.5 bits (193), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 24/86 (27%), Positives = 42/86 (48%), Gaps = 1/86 (1%)

Query: 1  MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
          M   M L+ RK++YR  RRG +E+D+    +V ++ L     E  +   ++E++D +L  
Sbjct: 1  MSDEMTLEERKVIYRA-RRGLKEIDVYFDPYVKNYYLTADPAEKALFAELVEQEDPDLLD 59

Query: 61 WFTGMEKPPEYLRTPIFKKIYDYYSN 86
          WF  + +PP         K+  Y   
Sbjct: 60 WFMEVSEPPRTELREFIYKLKQYVHG 85


>gi|190573780|ref|YP_001971625.1| putative TPR repeat-containing protein [Stenotrophomonas
          maltophilia K279a]
 gi|254521879|ref|ZP_05133934.1| conserved hypothetical protein [Stenotrophomonas sp. SKA14]
 gi|190011702|emb|CAQ45321.1| putative TPR repeat protein [Stenotrophomonas maltophilia K279a]
 gi|219719470|gb|EED37995.1| conserved hypothetical protein [Stenotrophomonas sp. SKA14]
          Length = 82

 Score = 78.5 bits (193), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 42/77 (54%), Gaps = 1/77 (1%)

Query: 6  NLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGM 65
          ++  +K+ +RC RRG RE+D + G ++DH      + E  +   +++ +D  L++WF G 
Sbjct: 4  DVLLKKLRWRC-RRGMRELDQLFGRYLDHEWSTAPTEEREVFLFLLDCEDDKLWRWFMGY 62

Query: 66 EKPPEYLRTPIFKKIYD 82
          E  P     P+ +KI  
Sbjct: 63 EACPHAHAIPLMQKILA 79


>gi|289669023|ref|ZP_06490098.1| hypothetical protein XcampmN_11137 [Xanthomonas campestris pv.
          musacearum NCPPB4381]
          Length = 82

 Score = 78.5 bits (193), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 20/79 (25%), Positives = 37/79 (46%), Gaps = 1/79 (1%)

Query: 4  NMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFT 63
          +     +K+ +RC RRG RE+D + G ++D         E  +   +++ +D  L++WF 
Sbjct: 2  DEQTLLKKLRWRC-RRGMRELDQLFGRYLDQRWARAPEAERAVFLQLLDCEDDKLWRWFM 60

Query: 64 GMEKPPEYLRTPIFKKIYD 82
          G E  P+     +   I  
Sbjct: 61 GYEACPDAANAALIADIRA 79


>gi|226953903|ref|ZP_03824367.1| conserved hypothetical protein [Acinetobacter sp. ATCC 27244]
 gi|226835386|gb|EEH67769.1| conserved hypothetical protein [Acinetobacter sp. ATCC 27244]
          Length = 85

 Score = 78.5 bits (193), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 22/86 (25%), Positives = 43/86 (50%), Gaps = 1/86 (1%)

Query: 1  MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
          M + + L+ RK++YR  RRG +E+D+    +V +  L   + E  +   +++++D +L  
Sbjct: 1  MSEELTLEERKVIYRA-RRGLKEIDVYFDPYVKNCYLTADATEKALFAELVDQEDPDLLD 59

Query: 61 WFTGMEKPPEYLRTPIFKKIYDYYSN 86
          WF  + +PP         K+  Y   
Sbjct: 60 WFMEVGEPPRPELKAFISKLKQYVHG 85


>gi|21231572|ref|NP_637489.1| hypothetical protein XCC2128 [Xanthomonas campestris pv.
          campestris str. ATCC 33913]
 gi|66768307|ref|YP_243069.1| hypothetical protein XC_1986 [Xanthomonas campestris pv.
          campestris str. 8004]
 gi|188991446|ref|YP_001903456.1| hypothetical protein xccb100_2051 [Xanthomonas campestris pv.
          campestris str. B100]
 gi|81175071|sp|Q4UV74|Y1986_XANC8 RecName: Full=UPF0350 protein XC_1986
 gi|81175074|sp|Q8P8V6|Y2128_XANCP RecName: Full=UPF0350 protein XCC2128
 gi|21113258|gb|AAM41413.1| conserved hypothetical protein [Xanthomonas campestris pv.
          campestris str. ATCC 33913]
 gi|66573639|gb|AAY49049.1| conserved hypothetical protein [Xanthomonas campestris pv.
          campestris str. 8004]
 gi|167733206|emb|CAP51404.1| Conserved hypothetical protein [Xanthomonas campestris pv.
          campestris]
          Length = 86

 Score = 78.5 bits (193), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 20/79 (25%), Positives = 40/79 (50%), Gaps = 1/79 (1%)

Query: 4  NMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFT 63
          + +   +K+ +RC RRG RE+D + G ++D    +  + E  +   +++ +D  L++WF 
Sbjct: 6  DEDTLLKKLRWRC-RRGMRELDQLFGRYLDRRWAQAPAAERAVFLQLLDCEDDKLWRWFM 64

Query: 64 GMEKPPEYLRTPIFKKIYD 82
          G E  P+     +   I  
Sbjct: 65 GYEACPDADNAALIADIRA 83


>gi|293610853|ref|ZP_06693153.1| hypothetical protein HMPREF0013_03011 [Acinetobacter sp. SH024]
 gi|292827197|gb|EFF85562.1| hypothetical protein HMPREF0013_03011 [Acinetobacter sp. SH024]
          Length = 85

 Score = 78.1 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 23/86 (26%), Positives = 43/86 (50%), Gaps = 1/86 (1%)

Query: 1  MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
          M   M L+ RK++YR  RRG +E+D+    +V ++ L+    E  +   +++++D +L  
Sbjct: 1  MSDEMTLEERKVIYRA-RRGLKEIDVYFDPYVKNYYLKADPAEKALFAELVDQEDPDLLD 59

Query: 61 WFTGMEKPPEYLRTPIFKKIYDYYSN 86
          WF  + +PP         K+  Y   
Sbjct: 60 WFMEVSEPPRTELREFIYKLKQYVHG 85


>gi|262280196|ref|ZP_06057980.1| conserved hypothetical protein [Acinetobacter calcoaceticus
          RUH2202]
 gi|262257974|gb|EEY76708.1| conserved hypothetical protein [Acinetobacter calcoaceticus
          RUH2202]
          Length = 85

 Score = 78.1 bits (192), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 25/86 (29%), Positives = 44/86 (51%), Gaps = 1/86 (1%)

Query: 1  MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
          M   M L+ RK++YR  RRG +E+D+    +V ++ L+  S E  +   ++E++D +L  
Sbjct: 1  MSDEMTLEERKVIYRA-RRGLKEIDVYFDPYVKNYYLKADSAEKALFAELVEQEDPDLLD 59

Query: 61 WFTGMEKPPEYLRTPIFKKIYDYYSN 86
          WF  + +PP         K+  Y   
Sbjct: 60 WFMEVSEPPRTELREFIHKLKQYVHG 85


>gi|194365317|ref|YP_002027927.1| hypothetical protein Smal_1539 [Stenotrophomonas maltophilia
          R551-3]
 gi|194348121|gb|ACF51244.1| protein of unknown function DUF339 [Stenotrophomonas maltophilia
          R551-3]
          Length = 82

 Score = 78.1 bits (192), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 41/77 (53%), Gaps = 1/77 (1%)

Query: 6  NLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGM 65
          ++  +K+ +RC RRG RE+D + G ++D       + E  +   +++ +D  L++WF G 
Sbjct: 4  DVLLKKLRWRC-RRGMRELDQLFGRYLDREWSTAPTEEREVFLFLLDCEDDKLWRWFMGY 62

Query: 66 EKPPEYLRTPIFKKIYD 82
          E  P     P+ +KI  
Sbjct: 63 EACPHAHAIPLMQKILA 79


>gi|308799237|ref|XP_003074399.1| unnamed protein product [Ostreococcus tauri]
 gi|116000570|emb|CAL50250.1| unnamed protein product [Ostreococcus tauri]
          Length = 148

 Score = 77.8 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 20/89 (22%), Positives = 43/89 (48%), Gaps = 3/89 (3%)

Query: 7   LQCRKIVYRCWRRGTREMDLILGSFVDHFI--LELSSVELTMLESIIEEDDSNLFKWFTG 64
            +  + +YR  +RG  E+D+++G++    +     S   L   + ++  ++  LFKW TG
Sbjct: 36  ARINRALYRARQRGFLELDIVVGAWATRTLDPETASMEFLDAFDEVLRAENPELFKWLTG 95

Query: 65  MEKPPEYL-RTPIFKKIYDYYSNNLDRKN 92
            E+ P  +     +  + ++    LD K+
Sbjct: 96  QERAPRAMAENAAYASLAEHCKKFLDEKS 124


>gi|223998156|ref|XP_002288751.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gi|220975859|gb|EED94187.1| predicted protein [Thalassiosira pseudonana CCMP1335]
          Length = 90

 Score = 77.8 bits (191), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 17/76 (22%), Positives = 42/76 (55%)

Query: 2  KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
          ++ ++++ +++VYR  +RG  E+DL+LG++    +  LS  EL   E  +  +  +++  
Sbjct: 15 ERELDVRKKRLVYRSKQRGWLEVDLLLGTWASENVASLSVDELNDFEQFVNLETIDIYNV 74

Query: 62 FTGMEKPPEYLRTPIF 77
           T     P+ +++ + 
Sbjct: 75 LTLRVDVPKEMQSTVV 90


>gi|221108448|ref|XP_002164786.1| PREDICTED: similar to predicted protein [Hydra magnipapillata]
          Length = 120

 Score = 77.0 bits (189), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 15/84 (17%), Positives = 40/84 (47%), Gaps = 2/84 (2%)

Query: 6   NLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEE--DDSNLFKWFT 63
           ++   +++Y+  +RG  E  ++L +F   ++   +  +L   + II +  +D ++F W  
Sbjct: 17  DVLRSRLLYQSRKRGMSENGILLSTFASFYLNRFTRRQLEEFDKIINKPSNDWDIFYWIL 76

Query: 64  GMEKPPEYLRTPIFKKIYDYYSNN 87
           G ++ P    + +   +  +  N 
Sbjct: 77  GKKETPHEYNSEVMDLLKSFSRNQ 100


>gi|84501610|ref|ZP_00999782.1| hypothetical protein OB2597_15450 [Oceanicola batsensis HTCC2597]
 gi|84390231|gb|EAQ02790.1| hypothetical protein OB2597_15450 [Oceanicola batsensis HTCC2597]
          Length = 94

 Score = 76.2 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 20/67 (29%), Positives = 36/67 (53%), Gaps = 1/67 (1%)

Query: 21 TREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPEYLRTPIFKKI 80
           +EMD++L  F +  +  LS  EL + + I+  +D +L++W TG  +PP  L   +  +I
Sbjct: 22 MKEMDILLMRFAEAHLAALSDPELDIYDEILGRNDQDLYRWITGQAEPPAPL-AQVIARI 80

Query: 81 YDYYSNN 87
               N+
Sbjct: 81 AAAAEND 87


>gi|302504188|ref|XP_003014053.1| hypothetical protein ARB_07773 [Arthroderma benhamiae CBS 112371]
 gi|291177620|gb|EFE33413.1| hypothetical protein ARB_07773 [Arthroderma benhamiae CBS 112371]
          Length = 747

 Score = 76.2 bits (187), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 15/61 (24%), Positives = 34/61 (55%), Gaps = 2/61 (3%)

Query: 15  RCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPEYLRT 74
           +  +RGT E DL+L +F   ++ +++  +L   +  ++E+D +++ W T  ++PP     
Sbjct: 606 QSRKRGTLESDLLLSTFASTYLAKMTGSQLDEYDRFLDENDWDIYYWAT--QEPPSESEA 663

Query: 75  P 75
            
Sbjct: 664 A 664


>gi|114637902|ref|XP_508476.2| PREDICTED: IIIG9 protein [Pan troglodytes]
          Length = 531

 Score = 75.4 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 13/67 (19%), Positives = 35/67 (52%), Gaps = 2/67 (2%)

Query: 3  KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEE--DDSNLFK 60
          +++  +  +++Y   +RG  E  ++L  F    +  ++  +L + + +I E  +D +++ 
Sbjct: 15 ESIETKRARLLYESRKRGMLENCILLSLFAKEHLQHMTEKQLNLYDRLINEPSNDWDIYY 74

Query: 61 WFTGMEK 67
          W TG  +
Sbjct: 75 WATGTGE 81


>gi|330936381|ref|XP_003305369.1| hypothetical protein PTT_18184 [Pyrenophora teres f. teres 0-1]
 gi|311317668|gb|EFQ86555.1| hypothetical protein PTT_18184 [Pyrenophora teres f. teres 0-1]
          Length = 312

 Score = 75.1 bits (184), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 17/63 (26%), Positives = 34/63 (53%), Gaps = 1/63 (1%)

Query: 13  VYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPEYL 72
           +++  +RGT E DL+L +F D  +  +S   +   ++ ++E+D +++ W T  E  P   
Sbjct: 150 MHQSRKRGTLESDLLLSTFADAHLNTMSPSLMQQYDTFLDENDWDIYYWAT-QEPTPTSH 208

Query: 73  RTP 75
            T 
Sbjct: 209 ETA 211


>gi|262377283|ref|ZP_06070507.1| conserved hypothetical protein [Acinetobacter lwoffii SH145]
 gi|262307736|gb|EEY88875.1| conserved hypothetical protein [Acinetobacter lwoffii SH145]
          Length = 85

 Score = 74.7 bits (183), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 25/86 (29%), Positives = 44/86 (51%), Gaps = 1/86 (1%)

Query: 1  MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
          M  +++L+ RK++YR  RRG +E+D+    +V +  L     E  M   ++E++D +L  
Sbjct: 1  MTDDISLEERKVIYRA-RRGLKELDVYFDPYVKNHYLNAEPFEKQMFAELVEQEDPDLLD 59

Query: 61 WFTGMEKPPEYLRTPIFKKIYDYYSN 86
          WF  + +PP        KK+  Y   
Sbjct: 60 WFMEVSEPPRPELKDFIKKLKFYVHG 85


>gi|119774008|ref|YP_926748.1| hypothetical protein Sama_0871 [Shewanella amazonensis SB2B]
 gi|119766508|gb|ABL99078.1| conserved hypothetical protein [Shewanella amazonensis SB2B]
          Length = 79

 Score = 74.7 bits (183), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 17/71 (23%), Positives = 34/71 (47%), Gaps = 1/71 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          ++ +   RRG  E+D++   FV++    LS  +  +   ++  +D  LF WF G E+ P+
Sbjct: 5  RVRW-ACRRGMLELDVLFQPFVENHYEALSDEQKAVFVRLLACEDPELFAWFMGHEQCPD 63

Query: 71 YLRTPIFKKIY 81
               +   + 
Sbjct: 64 SELADMVVTVR 74


>gi|189188108|ref|XP_001930393.1| conserved hypothetical protein [Pyrenophora tritici-repentis
           Pt-1C-BFP]
 gi|187971999|gb|EDU39498.1| conserved hypothetical protein [Pyrenophora tritici-repentis
           Pt-1C-BFP]
          Length = 277

 Score = 74.7 bits (183), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 17/60 (28%), Positives = 31/60 (51%), Gaps = 1/60 (1%)

Query: 16  CWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPEYLRTP 75
             +RGT E DL+L +F D  +  +S   +   ++ ++E+D +++ W T  E  P    T 
Sbjct: 118 SRKRGTLESDLLLSTFADAHLSTMSPSLMQQYDTFLDENDWDIYYWAT-QEPTPTSHETA 176


>gi|325123575|gb|ADY83098.1| hypothetical protein BDGL_002512 [Acinetobacter calcoaceticus
          PHEA-2]
          Length = 81

 Score = 73.9 bits (181), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 22/82 (26%), Positives = 42/82 (51%), Gaps = 1/82 (1%)

Query: 5  MNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTG 64
          M L+ RK++YR  RRG +E+D+    +V ++ L+    E  +   +++++D +L  WF  
Sbjct: 1  MTLEERKVIYRA-RRGLKEIDVYFDPYVKNYYLKADPAEKALFAELVDQEDPDLLDWFME 59

Query: 65 MEKPPEYLRTPIFKKIYDYYSN 86
          + +PP         K+  Y   
Sbjct: 60 VSEPPRTELREFIYKLKQYVHG 81


>gi|126643067|ref|YP_001086051.1| hypothetical protein A1S_3052 [Acinetobacter baumannii ATCC
          17978]
          Length = 81

 Score = 73.9 bits (181), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 23/82 (28%), Positives = 42/82 (51%), Gaps = 1/82 (1%)

Query: 5  MNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTG 64
          M L+ RK++YR  RRG +E+D+    +V ++ L+    E  +   ++E++D +L  WF  
Sbjct: 1  MTLEERKVIYRA-RRGLKEIDVYFDPYVKNYYLKADPAEKALFAELVEQEDPDLLDWFME 59

Query: 65 MEKPPEYLRTPIFKKIYDYYSN 86
          + +PP         K+  Y   
Sbjct: 60 VSEPPRTELRDFIYKLKHYVHG 81


>gi|331227912|ref|XP_003326624.1| hypothetical protein PGTG_07602 [Puccinia graminis f. sp. tritici
           CRL 75-36-700-3]
 gi|331244291|ref|XP_003334786.1| hypothetical protein PGTG_16127 [Puccinia graminis f. sp. tritici
           CRL 75-36-700-3]
 gi|309305614|gb|EFP82205.1| hypothetical protein PGTG_07602 [Puccinia graminis f. sp. tritici
           CRL 75-36-700-3]
 gi|309313776|gb|EFP90367.1| hypothetical protein PGTG_16127 [Puccinia graminis f. sp. tritici
           CRL 75-36-700-3]
          Length = 229

 Score = 73.5 bits (180), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 19/101 (18%), Positives = 50/101 (49%), Gaps = 5/101 (4%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSF--VDHFILELSSVELTMLESIIEEDDSNLFK 60
             ++    ++VY+  +RG  E++L+L +F     ++ +    +LT    ++   D +L+ 
Sbjct: 128 STIDKLRSRLVYQSRKRGIVEIELLLSTFIEAQRWLKDWDLKQLTQYSRLLMLPDWDLYY 187

Query: 61  WFTGMEKPP---EYLRTPIFKKIYDYYSNNLDRKNMLGSLQ 98
           +    ++PP   E+ ++ +  ++  + SN+     ++ SL 
Sbjct: 188 YLVKKQEPPSDSEFFKSDLLDQLRIHTSNSSKTVRIMPSLH 228


>gi|285018592|ref|YP_003376303.1| hypothetical protein XALc_1822 [Xanthomonas albilineans GPE PC73]
 gi|283473810|emb|CBA16312.1| conserved hypothetical protein [Xanthomonas albilineans]
          Length = 82

 Score = 73.1 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 22/79 (27%), Positives = 42/79 (53%), Gaps = 1/79 (1%)

Query: 4  NMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFT 63
          +   + +K+ +RC RRG RE+D + G ++D    +  +VE  +  S+++ +D  L++WF 
Sbjct: 2  DDTTELKKLRWRC-RRGMRELDQLFGRYLDQRWAQAPTVERGVFLSLLDCEDDKLWRWFM 60

Query: 64 GMEKPPEYLRTPIFKKIYD 82
          G E  P+     +   I  
Sbjct: 61 GYEVCPDARAADLIATIRA 79


>gi|157960856|ref|YP_001500890.1| hypothetical protein Spea_1028 [Shewanella pealeana ATCC 700345]
 gi|157845856|gb|ABV86355.1| protein of unknown function DUF339 [Shewanella pealeana ATCC
          700345]
          Length = 79

 Score = 72.7 bits (178), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 18/71 (25%), Positives = 33/71 (46%), Gaps = 1/71 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          ++ +   RRG  E+D++   FV+     +S  +      ++E +D  LF WF G E+ P 
Sbjct: 5  RVKW-ACRRGMLELDVLFQPFVEQQYEAMSIKDKDTFVRLLECEDPELFAWFMGHEQCPN 63

Query: 71 YLRTPIFKKIY 81
               +  K+ 
Sbjct: 64 PAFAEMIIKVR 74


>gi|256821969|ref|YP_003145932.1| hypothetical protein Kkor_0744 [Kangiella koreensis DSM 16069]
 gi|256795508|gb|ACV26164.1| protein of unknown function DUF339 [Kangiella koreensis DSM
          16069]
          Length = 84

 Score = 72.7 bits (178), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 17/83 (20%), Positives = 39/83 (46%), Gaps = 2/83 (2%)

Query: 6  NLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGM 65
          + Q +K+ +   RRG  E+D++L  +++    +    +     + +E+DD +L+ W  G 
Sbjct: 3  DEQLKKLHW-ASRRGMLELDVVLIPYLEEEACQFDDAKSAEYATFLEQDDPDLYAWIMGY 61

Query: 66 EKPPEYLRTPIFKKIYDYYSNNL 88
          E P       +   I ++ +  +
Sbjct: 62 ETPKPEFEGFVIA-IKEFINKKI 83


>gi|114564102|ref|YP_751616.1| hypothetical protein Sfri_2938 [Shewanella frigidimarina NCIMB
          400]
 gi|114335395|gb|ABI72777.1| protein of unknown function DUF339 [Shewanella frigidimarina
          NCIMB 400]
          Length = 83

 Score = 72.0 bits (176), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 18/73 (24%), Positives = 35/73 (47%), Gaps = 1/73 (1%)

Query: 9  CRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKP 68
            ++ +   RRG  E+D++   FV+     ++  +      ++E +D  LF WF G E+ 
Sbjct: 7  IARVRW-ACRRGMLELDVLFQPFVETQYEAMTDNDKNTFIRLLECEDPELFAWFMGHEQC 65

Query: 69 PEYLRTPIFKKIY 81
          P+ L   +  K+ 
Sbjct: 66 PDPLFANMIVKVR 78


>gi|72082242|ref|XP_795603.1| PREDICTED: similar to ENSANGP00000014095, partial
           [Strongylocentrotus purpuratus]
 gi|115656748|ref|XP_001176898.1| PREDICTED: similar to ENSANGP00000014095, partial
           [Strongylocentrotus purpuratus]
          Length = 115

 Score = 72.0 bits (176), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 16/63 (25%), Positives = 34/63 (53%), Gaps = 2/63 (3%)

Query: 2   KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIE--EDDSNLF 59
            ++M L+  ++VY+  +RG  E  +IL +F   ++      +L   +++I   ++D +LF
Sbjct: 52  NESMELKRARLVYQSRKRGMLENGIILSTFAGRYLEGFDEEQLDQYDNLINKPDNDWDLF 111

Query: 60  KWF 62
            W 
Sbjct: 112 YWV 114


>gi|254499307|ref|ZP_05111979.1| conserved hypothetical protein [Legionella drancourtii LLAP12]
 gi|254351462|gb|EET10325.1| conserved hypothetical protein [Legionella drancourtii LLAP12]
          Length = 81

 Score = 72.0 bits (176), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 28/84 (33%), Positives = 45/84 (53%), Gaps = 6/84 (7%)

Query: 5  MNLQCR-KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFT 63
          ++ + + ++ + C RRG  E+DLIL  F+   + +LS+ EL   +S++   D  LF WF 
Sbjct: 2  LDAREKARLTWHC-RRGMLELDLILQRFLKQGLEQLSARELKTFDSLLSCTDPELFAWFM 60

Query: 64 GMEKPPEYLRTPIFKKIYDYYSNN 87
          G E+P        FK+I     NN
Sbjct: 61 GHEEP----ENKEFKEIVAIIRNN 80


>gi|127511978|ref|YP_001093175.1| hypothetical protein Shew_1045 [Shewanella loihica PV-4]
 gi|126637273|gb|ABO22916.1| protein of unknown function DUF339 [Shewanella loihica PV-4]
          Length = 83

 Score = 72.0 bits (176), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 22/81 (27%), Positives = 39/81 (48%), Gaps = 3/81 (3%)

Query: 1  MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
          M + MN    ++ +   RRG  E+D++   FV+    +LS  +  +   ++E +D  LF 
Sbjct: 1  MSEPMN--IARVRW-ACRRGMLELDVLFQPFVETQYEQLSIDDKAVFVRLLECEDPELFA 57

Query: 61 WFTGMEKPPEYLRTPIFKKIY 81
          WF G E  P+     +  K+ 
Sbjct: 58 WFMGHEACPDPQLADMVVKVR 78


>gi|167623008|ref|YP_001673302.1| hypothetical protein Shal_1074 [Shewanella halifaxensis HAW-EB4]
 gi|167353030|gb|ABZ75643.1| protein of unknown function DUF339 [Shewanella halifaxensis
          HAW-EB4]
          Length = 79

 Score = 71.2 bits (174), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 19/74 (25%), Positives = 35/74 (47%), Gaps = 1/74 (1%)

Query: 8  QCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEK 67
          +  ++ +   RRG  E+D++   FV+     +S  +  +L  ++E +D  LF WF G E 
Sbjct: 2  KLSRVKW-ACRRGMLELDVLFQPFVEEHYEAMSVEDKIVLVKLLECEDPELFAWFMGHEV 60

Query: 68 PPEYLRTPIFKKIY 81
           P      +  K+ 
Sbjct: 61 CPTPAFAEMIIKVR 74


>gi|313231888|emb|CBY09000.1| unnamed protein product [Oikopleura dioica]
          Length = 156

 Score = 71.2 bits (174), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 21/95 (22%), Positives = 46/95 (48%), Gaps = 8/95 (8%)

Query: 2   KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIE-------ED 54
           ++N  L+ +++ ++  +RG  E DL+LG+F D ++ + +  ++   + II          
Sbjct: 32  EENEELKRKRLFWQSRKRGITENDLLLGTFADQYLKDFTMEQMLAYDRIINSTVYDPTVT 91

Query: 55  DSNLFKWFTGMEKPPEYLRTPIFKKIYDYYSNNLD 89
           + +L+ WF      PE L   + +   +Y    +D
Sbjct: 92  EWDLYYWFVEERPYPEDLIKDV-ELTAEYAQEKID 125


>gi|332305551|ref|YP_004433402.1| hypothetical protein Glaag_1173 [Glaciecola agarilytica
          4H-3-7+YE-5]
 gi|332172880|gb|AEE22134.1| protein of unknown function DUF339 [Glaciecola agarilytica
          4H-3-7+YE-5]
          Length = 83

 Score = 70.8 bits (173), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 21/81 (25%), Positives = 40/81 (49%), Gaps = 5/81 (6%)

Query: 8  QCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEK 67
          +  ++ +   RRG  E+D+I   FV+    +LS  +    ES++  DD +L+ WF G + 
Sbjct: 6  RYARLKW-ACRRGMLELDVIFMPFVEEGFNDLSEADKLTFESLLTCDDPDLYAWFMGHQP 64

Query: 68 PPEYLRTPIFKKIYDYYSNNL 88
                   +K+I D+  + +
Sbjct: 65 C----HNAQYKRIIDHILSRV 81


>gi|291614296|ref|YP_003524453.1| hypothetical protein Slit_1837 [Sideroxydans lithotrophicus ES-1]
 gi|291584408|gb|ADE12066.1| protein of unknown function DUF339 [Sideroxydans lithotrophicus
           ES-1]
          Length = 107

 Score = 70.8 bits (173), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 16/74 (21%), Positives = 38/74 (51%), Gaps = 1/74 (1%)

Query: 9   CRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKP 68
            R++++RC RRG  E+D++LG F++ +   +   +    + +++  D+ L+   TG    
Sbjct: 34  ERRLLWRC-RRGLLELDIVLGRFIERYYPTMDDGQRVAFDELLDLPDTELWDLITGKTGL 92

Query: 69  PEYLRTPIFKKIYD 82
               +  + + + D
Sbjct: 93  THAHQGVVLEWLKD 106


>gi|302878561|ref|YP_003847125.1| hypothetical protein Galf_1335 [Gallionella capsiferriformans ES-2]
 gi|302581350|gb|ADL55361.1| protein of unknown function DUF339 [Gallionella capsiferriformans
           ES-2]
          Length = 110

 Score = 70.8 bits (173), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 18/74 (24%), Positives = 38/74 (51%), Gaps = 1/74 (1%)

Query: 9   CRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKP 68
            +++ +RC RRG  E+D++ G FVD     L++ E    + +++  D+ L+   +G ++ 
Sbjct: 37  LQRVRWRC-RRGLLELDIVFGRFVDTHYSGLTASERQTFDELLDMPDNPLWDMISGRKET 95

Query: 69  PEYLRTPIFKKIYD 82
               +  +  KI  
Sbjct: 96  ETESQAALLAKIKS 109


>gi|39971437|ref|XP_367109.1| hypothetical protein MGG_07034 [Magnaporthe oryzae 70-15]
 gi|145019495|gb|EDK03723.1| hypothetical protein MGG_07034 [Magnaporthe oryzae 70-15]
          Length = 236

 Score = 70.4 bits (172), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 12/65 (18%), Positives = 33/65 (50%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
           ++      ++  +   RGT E +L+L +F    +  ++  ++   +  ++E+D +++ W 
Sbjct: 78  EDARTMRARLQRQSRGRGTLESELLLSTFAKAHLPTMTVEQMQQYDRFLDENDWDIYYWA 137

Query: 63  TGMEK 67
           T  E+
Sbjct: 138 TQSEE 142


>gi|294139700|ref|YP_003555678.1| hypothetical protein SVI_0929 [Shewanella violacea DSS12]
 gi|293326169|dbj|BAJ00900.1| conserved hypothetical protein [Shewanella violacea DSS12]
          Length = 83

 Score = 69.7 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 23/81 (28%), Positives = 40/81 (49%), Gaps = 3/81 (3%)

Query: 1  MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
          M + M  +  ++ +   RRG  E+D+I   FVD +  +LS     +L  ++E +D  LF 
Sbjct: 1  MSEPM--KISRVRW-ACRRGMLELDVIFQPFVDRYYEQLSVKNKAILVRLLEGEDPELFA 57

Query: 61 WFTGMEKPPEYLRTPIFKKIY 81
          WF G E+ P+     +   + 
Sbjct: 58 WFMGHEQCPDPELAEMVILVR 78


>gi|54294378|ref|YP_126793.1| hypothetical protein lpl1447 [Legionella pneumophila str. Lens]
 gi|296107163|ref|YP_003618863.1| hypothetical protein lpa_02293 [Legionella pneumophila 2300/99
          Alcoy]
 gi|81175064|sp|Q5WWK6|Y1447_LEGPL RecName: Full=UPF0350 protein lpl1447
 gi|53754210|emb|CAH15687.1| hypothetical protein lpl1447 [Legionella pneumophila str. Lens]
 gi|295649064|gb|ADG24911.1| hypothetical protein lpa_02293 [Legionella pneumophila 2300/99
          Alcoy]
          Length = 79

 Score = 69.7 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 21/69 (30%), Positives = 43/69 (62%), Gaps = 2/69 (2%)

Query: 5  MNLQCR-KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFT 63
          M+ + + +++++C RRG  E+DL+L  F+ + I  L+  +L   ++++  +D NL+ W  
Sbjct: 1  MDNREKSRLLWKC-RRGMLELDLVLQKFIANEIDRLTENQLKAFDNLLTHNDPNLYAWLM 59

Query: 64 GMEKPPEYL 72
          G E+P + L
Sbjct: 60 GHEEPEKEL 68


>gi|37805302|gb|AAH60090.1| 0610038F07Rik protein [Mus musculus]
          Length = 134

 Score = 69.7 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 13/64 (20%), Positives = 35/64 (54%), Gaps = 2/64 (3%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEE--DDSNLFK 60
           +++  +  +++Y   +RG  E  ++L  F   ++  ++  +L + + +I E  +D +++ 
Sbjct: 59  ESIETKRARLLYESRKRGMLENCILLSLFAKEYLHNMTEKQLNLYDRLINEPSNDWDIYY 118

Query: 61  WFTG 64
           W TG
Sbjct: 119 WATG 122


>gi|126173430|ref|YP_001049579.1| hypothetical protein Sbal_1192 [Shewanella baltica OS155]
 gi|152999769|ref|YP_001365450.1| hypothetical protein Shew185_1236 [Shewanella baltica OS185]
 gi|125996635|gb|ABN60710.1| protein of unknown function DUF339 [Shewanella baltica OS155]
 gi|151364387|gb|ABS07387.1| protein of unknown function DUF339 [Shewanella baltica OS185]
          Length = 79

 Score = 69.7 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 21/73 (28%), Positives = 38/73 (52%), Gaps = 1/73 (1%)

Query: 9  CRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKP 68
            ++ +   RRG  E+D++   FV++F  E+S  + T+   ++E +D  LF WF G E  
Sbjct: 3  IARVRW-ACRRGMLELDVLFQPFVENFYQEMSDEDKTVFIRLLECEDPELFAWFMGHEVC 61

Query: 69 PEYLRTPIFKKIY 81
          P+     +  K+ 
Sbjct: 62 PDAELARMVVKVR 74


>gi|157374278|ref|YP_001472878.1| hypothetical protein Ssed_1139 [Shewanella sediminis HAW-EB3]
 gi|157316652|gb|ABV35750.1| protein of unknown function DUF339 [Shewanella sediminis HAW-EB3]
          Length = 83

 Score = 69.3 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 20/81 (24%), Positives = 41/81 (50%), Gaps = 3/81 (3%)

Query: 1  MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
          M + M  +  ++ +   RRG  E+D++   FV+    +LS+ +  +   ++E +D  LF 
Sbjct: 1  MSEPM--KIARVRW-ACRRGMLELDVLFQPFVESQYEQLSTKDKNIFVRLLEGEDPELFA 57

Query: 61 WFTGMEKPPEYLRTPIFKKIY 81
          WF G E+ P+     +  ++ 
Sbjct: 58 WFMGHEQCPDPELAEMVIRVR 78


>gi|302342520|ref|YP_003807049.1| hypothetical protein Deba_1087 [Desulfarculus baarsii DSM 2075]
 gi|301639133|gb|ADK84455.1| protein of unknown function DUF339 [Desulfarculus baarsii DSM
          2075]
          Length = 87

 Score = 69.3 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 17/73 (23%), Positives = 35/73 (47%)

Query: 1  MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
          M   M  + +++     RRG  E++L +  F++  +  L+  EL  LE++   +D +L+ 
Sbjct: 1  MSDEMEPRRKRLRMAAGRRGFLEVELAMRPFLERELAGLNENELDQLETLARLEDLDLWA 60

Query: 61 WFTGMEKPPEYLR 73
            +    PP  + 
Sbjct: 61 VISQAAPPPPGVE 73


>gi|148359115|ref|YP_001250322.1| hypothetical protein LPC_1003 [Legionella pneumophila str. Corby]
 gi|148280888|gb|ABQ54976.1| hypothetical protein LPC_1003 [Legionella pneumophila str. Corby]
          Length = 79

 Score = 69.3 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 21/69 (30%), Positives = 43/69 (62%), Gaps = 2/69 (2%)

Query: 5  MNLQCR-KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFT 63
          M+ + + +++++C RRG  E+DL+L  F+ + I  L+  +L   ++++  +D NL+ W  
Sbjct: 1  MDNREKSRLLWKC-RRGMLELDLLLQKFIANEIDRLTENQLKAFDNLLTHNDPNLYAWLM 59

Query: 64 GMEKPPEYL 72
          G E+P + L
Sbjct: 60 GHEEPEKEL 68


>gi|54297491|ref|YP_123860.1| hypothetical protein lpp1536 [Legionella pneumophila str. Paris]
 gi|81175065|sp|Q5X4Y4|Y1536_LEGPA RecName: Full=UPF0350 protein lpp1536
 gi|53751276|emb|CAH12687.1| hypothetical protein lpp1536 [Legionella pneumophila str. Paris]
          Length = 79

 Score = 68.9 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 20/69 (28%), Positives = 43/69 (62%), Gaps = 2/69 (2%)

Query: 5  MNLQCR-KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFT 63
          M+ + + +++++C RRG  E+DL+L  F+ + I  L+  +L   ++++  +D +L+ W  
Sbjct: 1  MDNREKSRLLWKC-RRGMLELDLLLQKFIANEIDRLTENQLKAFDNLLTHNDPSLYAWLM 59

Query: 64 GMEKPPEYL 72
          G E+P + L
Sbjct: 60 GHEEPEKEL 68


>gi|119943856|ref|YP_941536.1| hypothetical protein Ping_0063 [Psychromonas ingrahamii 37]
 gi|119862460|gb|ABM01937.1| protein of unknown function DUF339 [Psychromonas ingrahamii 37]
          Length = 83

 Score = 68.9 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 20/70 (28%), Positives = 35/70 (50%), Gaps = 1/70 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          ++++   RRG  E+D++   FV     +LS  E    E ++  +D +LF WF G +  P+
Sbjct: 9  RLLW-ACRRGMLELDVLFIPFVKEAYDDLSYSEQLTFERLLTNEDPDLFAWFMGHKSCPD 67

Query: 71 YLRTPIFKKI 80
            +  I   I
Sbjct: 68 AEQAKIIDVI 77


>gi|241111416|ref|XP_002399276.1| conserved hypothetical protein [Ixodes scapularis]
 gi|215492942|gb|EEC02583.1| conserved hypothetical protein [Ixodes scapularis]
          Length = 81

 Score = 68.9 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 13/69 (18%), Positives = 33/69 (47%), Gaps = 2/69 (2%)

Query: 21 TREMDLILGSFVDHFILELSSVELTMLESIIEE--DDSNLFKWFTGMEKPPEYLRTPIFK 78
            E DL+L +F   ++ + +  +L   + +I    +D +++ W TG  + P+     +  
Sbjct: 1  MLENDLVLSTFAAKYLDKFTEDQLLQYDRLINLPSNDWDIYYWATGARETPDEFENEVMA 60

Query: 79 KIYDYYSNN 87
           + ++  N+
Sbjct: 61 LLREHVRND 69


>gi|78486366|ref|YP_392291.1| TPR repeat-containing protein [Thiomicrospira crunogena XCL-2]
 gi|78364652|gb|ABB42617.1| TPR repeat family protein [Thiomicrospira crunogena XCL-2]
          Length = 87

 Score = 68.9 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 22/79 (27%), Positives = 42/79 (53%), Gaps = 2/79 (2%)

Query: 4  NMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFT 63
          +++ Q + I   C RRG  E +L+L +++DH   +     L  L +++ E+D +LF W  
Sbjct: 5  DLSTQIKAIRLNC-RRGNSETELLLQAYIDHLAEKSDPEALHELSTLVAENDQDLFHWLM 63

Query: 64 GMEKPPEYLRTPIFKKIYD 82
               P+Y +T + ++I  
Sbjct: 64 TPTDAPQYYQT-LIERIRQ 81


>gi|113971192|ref|YP_734985.1| hypothetical protein Shewmr4_2857 [Shewanella sp. MR-4]
 gi|114048430|ref|YP_738980.1| hypothetical protein Shewmr7_2939 [Shewanella sp. MR-7]
 gi|113885876|gb|ABI39928.1| protein of unknown function DUF339 [Shewanella sp. MR-4]
 gi|113889872|gb|ABI43923.1| protein of unknown function DUF339 [Shewanella sp. MR-7]
          Length = 79

 Score = 68.9 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 18/62 (29%), Positives = 33/62 (53%), Gaps = 1/62 (1%)

Query: 9  CRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKP 68
            ++ +   RRG  E+D++   FV++   +LS  +  +   ++E +D  LF WF G E  
Sbjct: 3  IARVRW-ACRRGMLELDVLFQPFVENVYQDLSDEDKALFIRLLECEDPELFAWFMGHEAC 61

Query: 69 PE 70
          P+
Sbjct: 62 PD 63


>gi|109899464|ref|YP_662719.1| hypothetical protein Patl_3159 [Pseudoalteromonas atlantica T6c]
 gi|109701745|gb|ABG41665.1| protein of unknown function DUF339 [Pseudoalteromonas atlantica
          T6c]
          Length = 83

 Score = 68.5 bits (167), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 20/81 (24%), Positives = 41/81 (50%), Gaps = 5/81 (6%)

Query: 8  QCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEK 67
          +  ++ +   RRG  E+D+I   FV+    +LS  +  + ES++  DD +L+ W  G + 
Sbjct: 6  RYARLKW-ACRRGMLELDVIFMPFVEEGFNDLSEADKVIFESLLTCDDPDLYAWLMGHQA 64

Query: 68 PPEYLRTPIFKKIYDYYSNNL 88
                 P +K++ D+  + +
Sbjct: 65 C----NNPDYKRLIDHILSRV 81


>gi|330828472|ref|YP_004391424.1| TPR repeat-containing protein [Aeromonas veronii B565]
 gi|328803608|gb|AEB48807.1| TPR repeat protein [Aeromonas veronii B565]
          Length = 89

 Score = 68.5 bits (167), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 21/82 (25%), Positives = 35/82 (42%), Gaps = 1/82 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          ++ +   RRG  E+D+I   F +H    LS  +      ++  DD +LFKW  G   P +
Sbjct: 9  RLKW-ACRRGMLELDVIFMPFFEHEFDSLSEADQQTFIRLLASDDPDLFKWCMGHGVPAD 67

Query: 71 YLRTPIFKKIYDYYSNNLDRKN 92
               +   I +      DR+ 
Sbjct: 68 PAFAAMIPMILERNQARHDRQG 89


>gi|160874388|ref|YP_001553704.1| hypothetical protein Sbal195_1269 [Shewanella baltica OS195]
 gi|217974278|ref|YP_002359029.1| hypothetical protein Sbal223_3121 [Shewanella baltica OS223]
 gi|304409354|ref|ZP_07390974.1| protein of unknown function DUF339 [Shewanella baltica OS183]
 gi|307303712|ref|ZP_07583465.1| protein of unknown function DUF339 [Shewanella baltica BA175]
 gi|160859910|gb|ABX48444.1| protein of unknown function DUF339 [Shewanella baltica OS195]
 gi|217499413|gb|ACK47606.1| protein of unknown function DUF339 [Shewanella baltica OS223]
 gi|304351872|gb|EFM16270.1| protein of unknown function DUF339 [Shewanella baltica OS183]
 gi|306912610|gb|EFN43033.1| protein of unknown function DUF339 [Shewanella baltica BA175]
 gi|315266623|gb|ADT93476.1| protein of unknown function DUF339 [Shewanella baltica OS678]
          Length = 82

 Score = 68.5 bits (167), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 21/73 (28%), Positives = 38/73 (52%), Gaps = 1/73 (1%)

Query: 9  CRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKP 68
            ++ +   RRG  E+D++   FV++F  E+S  + T+   ++E +D  LF WF G E  
Sbjct: 6  IARVRW-ACRRGMLELDVLFQPFVENFYQEMSDEDKTVFIRLLECEDPELFAWFMGHEVC 64

Query: 69 PEYLRTPIFKKIY 81
          P+     +  K+ 
Sbjct: 65 PDAELARMVVKVR 77


>gi|126725661|ref|ZP_01741503.1| TPR repeat family protein [Rhodobacterales bacterium HTCC2150]
 gi|126704865|gb|EBA03956.1| TPR repeat family protein [Rhodobacterales bacterium HTCC2150]
          Length = 95

 Score = 68.5 bits (167), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 17/68 (25%), Positives = 36/68 (52%), Gaps = 1/68 (1%)

Query: 20 GTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPEYLRTPIFKK 79
          G +EMD+ILG F D    ++S  ++ + + ++ E+D +L++WF+     P    + +   
Sbjct: 29 GIKEMDMILGPFSDKGFKDMSEADIDLYDQLLWENDQDLYQWFSNQIARPAKY-SDLIAH 87

Query: 80 IYDYYSNN 87
          I   +  +
Sbjct: 88 IMQQHRQD 95


>gi|332992342|gb|AEF02397.1| hypothetical protein ambt_04235 [Alteromonas sp. SN2]
          Length = 85

 Score = 68.1 bits (166), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 19/78 (24%), Positives = 36/78 (46%), Gaps = 1/78 (1%)

Query: 8  QCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEK 67
          +  ++ +   RRG  E+D++L  FVD     L   +  + E ++  DD +LF WF G ++
Sbjct: 6  RRARLKW-ACRRGMLELDVLLMPFVDEAFDSLDYEQQEIFERLLTSDDPDLFAWFMGHQQ 64

Query: 68 PPEYLRTPIFKKIYDYYS 85
            +     +   I +   
Sbjct: 65 CQDPELAGMVSTIVNRVK 82


>gi|328849144|gb|EGF98330.1| hypothetical protein MELLADRAFT_51038 [Melampsora larici-populina
           98AG31]
          Length = 121

 Score = 68.1 bits (166), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 20/101 (19%), Positives = 51/101 (50%), Gaps = 4/101 (3%)

Query: 1   MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVD-HFILELSSVELTMLESIIEEDDSNLF 59
           + +++     ++VY+  +RG  EM+L+L +F+D   + E +  +L   +  ++  D +++
Sbjct: 14  LDESIESLRARLVYQSRKRGIVEMELLLSTFIDGGKLEEWNIEQLQTYDRFLKLPDWDIY 73

Query: 60  KWFTGMEKPP---EYLRTPIFKKIYDYYSNNLDRKNMLGSL 97
            +      PP   E+  + +  ++  + +N   +  M+ SL
Sbjct: 74  YYVIKKLDPPAESEWKDSQLVNQLRIHTANRAKQIRMMPSL 114


>gi|145300370|ref|YP_001143211.1| hypothetical protein ASA_3495 [Aeromonas salmonicida subsp.
          salmonicida A449]
 gi|142853142|gb|ABO91463.1| conserved hypothetical protein [Aeromonas salmonicida subsp.
          salmonicida A449]
          Length = 89

 Score = 68.1 bits (166), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 20/72 (27%), Positives = 33/72 (45%), Gaps = 1/72 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          ++ +   RRG  E+D+I   F +H    LS  +      ++E DD +LFKW  G   P +
Sbjct: 9  RLKW-ACRRGMLELDVIFMPFFEHEFDSLSDEQQQTFIRLLESDDPDLFKWCMGHGVPAD 67

Query: 71 YLRTPIFKKIYD 82
               +   I +
Sbjct: 68 PAFAAMIALILE 79


>gi|307183297|gb|EFN70166.1| Protein EMI5-like protein, mitochondrial [Camponotus floridanus]
          Length = 80

 Score = 68.1 bits (166), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 16/76 (21%), Positives = 36/76 (47%), Gaps = 3/76 (3%)

Query: 21 TREMDLILGSFVDHFILELSSVELTMLESIIEE--DDSNLFKWFTGMEKPPEYLRTPIFK 78
            E  L+L +F   ++   +  +LT+ + +I    +D ++F W TG++  P      +  
Sbjct: 1  MLENGLLLSTFAKKYLNTFNDTQLTLYDQLINLPTNDWDIFYWATGVKPTPPEFNNEVMD 60

Query: 79 KIYDYYSNNLDRKNML 94
           +  +   N DR++ +
Sbjct: 61 LLKKHTR-NEDRQSRI 75


>gi|262404783|ref|ZP_06081338.1| hypothetical protein VOA_002782 [Vibrio sp. RC586]
 gi|262349815|gb|EEY98953.1| hypothetical protein VOA_002782 [Vibrio sp. RC586]
          Length = 86

 Score = 68.1 bits (166), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 20/76 (26%), Positives = 34/76 (44%), Gaps = 1/76 (1%)

Query: 8  QCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEK 67
          Q  +I +   RRG  E+D+++  F +     LS  E     +++E DD +LF W  G  +
Sbjct: 6  QKARIKW-ACRRGMLELDVVIMPFFEECFDSLSESEQDDFVALLESDDPDLFAWVMGHGR 64

Query: 68 PPEYLRTPIFKKIYDY 83
                  +  KI  +
Sbjct: 65 CENLGLAAMVDKIVAH 80


>gi|120599811|ref|YP_964385.1| hypothetical protein Sputw3181_3014 [Shewanella sp. W3-18-1]
 gi|146292253|ref|YP_001182677.1| hypothetical protein Sputcn32_1150 [Shewanella putrefaciens
          CN-32]
 gi|120559904|gb|ABM25831.1| protein of unknown function DUF339 [Shewanella sp. W3-18-1]
 gi|145563943|gb|ABP74878.1| protein of unknown function DUF339 [Shewanella putrefaciens
          CN-32]
          Length = 79

 Score = 67.7 bits (165), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 19/73 (26%), Positives = 36/73 (49%), Gaps = 1/73 (1%)

Query: 9  CRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKP 68
            ++ +   RRG  E+D++   FV++   +LS ++      ++E +D  LF WF G E  
Sbjct: 3  IARVRW-ACRRGMLELDVLFQPFVENIYQDLSDIDKASFIRLLECEDPELFAWFMGHEAC 61

Query: 69 PEYLRTPIFKKIY 81
          P+     +  K+ 
Sbjct: 62 PDAELARMVVKVR 74


>gi|325117486|emb|CBZ53038.1| hypothetical protein NCLIV_028270 [Neospora caninum Liverpool]
          Length = 89

 Score = 67.7 bits (165), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 22/86 (25%), Positives = 41/86 (47%), Gaps = 7/86 (8%)

Query: 13 VYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGME----KP 68
          +YR  +RG  E+DL+LG++ D  +  +S  E+  LE I+  ++  L+    G +      
Sbjct: 1  MYRAKQRGWVELDLLLGAYCDQAVPTMSPGEVEELEQILAAENVVLYDCLIGKDWKRAPA 60

Query: 69 PEYLRTPI--FKKIYDYYSNNLDRKN 92
          P      +  +KK+  +    L + N
Sbjct: 61 PAQF-AELSQWKKLSAFVEARLPQPN 85


>gi|117921474|ref|YP_870666.1| hypothetical protein Shewana3_3035 [Shewanella sp. ANA-3]
 gi|117613806|gb|ABK49260.1| protein of unknown function DUF339 [Shewanella sp. ANA-3]
          Length = 79

 Score = 67.7 bits (165), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 18/73 (24%), Positives = 36/73 (49%), Gaps = 1/73 (1%)

Query: 9  CRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKP 68
            ++ +   RRG  E+D++   FV++   +LS  +  +   ++E +D  LF WF G E  
Sbjct: 3  IARVRW-ACRRGMLELDVLFQPFVENVYQDLSDDDKALFIRLLECEDPELFAWFMGHEAC 61

Query: 69 PEYLRTPIFKKIY 81
          P+     +  ++ 
Sbjct: 62 PDAELARMVVQVR 74


>gi|15642467|ref|NP_232100.1| hypothetical protein VC2471 [Vibrio cholerae O1 biovar El Tor
          str. N16961]
 gi|121590988|ref|ZP_01678307.1| conserved hypothetical protein [Vibrio cholerae 2740-80]
 gi|121729906|ref|ZP_01682331.1| conserved hypothetical protein [Vibrio cholerae V52]
 gi|147673136|ref|YP_001217972.1| hypothetical protein VC0395_A2048 [Vibrio cholerae O395]
 gi|153214520|ref|ZP_01949429.1| conserved hypothetical protein [Vibrio cholerae 1587]
 gi|153820556|ref|ZP_01973223.1| conserved hypothetical protein [Vibrio cholerae NCTC 8457]
 gi|153824241|ref|ZP_01976908.1| conserved hypothetical protein [Vibrio cholerae B33]
 gi|153826903|ref|ZP_01979570.1| conserved hypothetical protein [Vibrio cholerae MZO-2]
 gi|153831097|ref|ZP_01983764.1| conserved hypothetical protein [Vibrio cholerae 623-39]
 gi|183179721|ref|ZP_02957932.1| conserved hypothetical protein [Vibrio cholerae MZO-3]
 gi|227082592|ref|YP_002811143.1| hypothetical protein VCM66_2394 [Vibrio cholerae M66-2]
 gi|229507470|ref|ZP_04396975.1| hypothetical protein VCF_002699 [Vibrio cholerae BX 330286]
 gi|229512335|ref|ZP_04401814.1| hypothetical protein VCE_003747 [Vibrio cholerae B33]
 gi|229514096|ref|ZP_04403558.1| hypothetical protein VCB_001743 [Vibrio cholerae TMA 21]
 gi|229519471|ref|ZP_04408914.1| hypothetical protein VCC_003501 [Vibrio cholerae RC9]
 gi|229521297|ref|ZP_04410717.1| hypothetical protein VIF_001827 [Vibrio cholerae TM 11079-80]
 gi|229524457|ref|ZP_04413862.1| hypothetical protein VCA_002051 [Vibrio cholerae bv. albensis
          VL426]
 gi|229527078|ref|ZP_04416473.1| hypothetical protein VCG_000144 [Vibrio cholerae 12129(1)]
 gi|229606975|ref|YP_002877623.1| hypothetical protein VCD_001884 [Vibrio cholerae MJ-1236]
 gi|254291671|ref|ZP_04962459.1| conserved hypothetical protein [Vibrio cholerae AM-19226]
 gi|254849596|ref|ZP_05238946.1| conserved hypothetical protein [Vibrio cholerae MO10]
 gi|255746859|ref|ZP_05420804.1| hypothetical protein VCH_003256 [Vibrio cholera CIRS 101]
 gi|262162024|ref|ZP_06031040.1| hypothetical protein VIG_003200 [Vibrio cholerae INDRE 91/1]
 gi|262167301|ref|ZP_06035011.1| hypothetical protein VIJ_000462 [Vibrio cholerae RC27]
 gi|262190700|ref|ZP_06048931.1| hypothetical protein VIH_001061 [Vibrio cholerae CT 5369-93]
 gi|297581094|ref|ZP_06943019.1| conserved hypothetical protein [Vibrio cholerae RC385]
 gi|298500173|ref|ZP_07009978.1| conserved hypothetical protein [Vibrio cholerae MAK 757]
 gi|81175076|sp|Q9KPA2|Y2471_VIBCH RecName: Full=UPF0350 protein VC_2471
 gi|9657049|gb|AAF95613.1| conserved hypothetical protein [Vibrio cholerae O1 biovar El Tor
          str. N16961]
 gi|121547165|gb|EAX57294.1| conserved hypothetical protein [Vibrio cholerae 2740-80]
 gi|121628349|gb|EAX60853.1| conserved hypothetical protein [Vibrio cholerae V52]
 gi|124115322|gb|EAY34142.1| conserved hypothetical protein [Vibrio cholerae 1587]
 gi|126508900|gb|EAZ71494.1| conserved hypothetical protein [Vibrio cholerae NCTC 8457]
 gi|126518238|gb|EAZ75463.1| conserved hypothetical protein [Vibrio cholerae B33]
 gi|146315019|gb|ABQ19558.1| conserved hypothetical protein [Vibrio cholerae O395]
 gi|148873418|gb|EDL71553.1| conserved hypothetical protein [Vibrio cholerae 623-39]
 gi|149739266|gb|EDM53528.1| conserved hypothetical protein [Vibrio cholerae MZO-2]
 gi|150422443|gb|EDN14402.1| conserved hypothetical protein [Vibrio cholerae AM-19226]
 gi|183013132|gb|EDT88432.1| conserved hypothetical protein [Vibrio cholerae MZO-3]
 gi|227010480|gb|ACP06692.1| conserved hypothetical protein [Vibrio cholerae M66-2]
 gi|227014363|gb|ACP10573.1| conserved hypothetical protein [Vibrio cholerae O395]
 gi|229335475|gb|EEO00957.1| hypothetical protein VCG_000144 [Vibrio cholerae 12129(1)]
 gi|229338038|gb|EEO03055.1| hypothetical protein VCA_002051 [Vibrio cholerae bv. albensis
          VL426]
 gi|229341829|gb|EEO06831.1| hypothetical protein VIF_001827 [Vibrio cholerae TM 11079-80]
 gi|229344160|gb|EEO09135.1| hypothetical protein VCC_003501 [Vibrio cholerae RC9]
 gi|229349277|gb|EEO14234.1| hypothetical protein VCB_001743 [Vibrio cholerae TMA 21]
 gi|229352300|gb|EEO17241.1| hypothetical protein VCE_003747 [Vibrio cholerae B33]
 gi|229354975|gb|EEO19896.1| hypothetical protein VCF_002699 [Vibrio cholerae BX 330286]
 gi|229369630|gb|ACQ60053.1| hypothetical protein VCD_001884 [Vibrio cholerae MJ-1236]
 gi|254845301|gb|EET23715.1| conserved hypothetical protein [Vibrio cholerae MO10]
 gi|255735261|gb|EET90661.1| hypothetical protein VCH_003256 [Vibrio cholera CIRS 101]
 gi|262024276|gb|EEY42967.1| hypothetical protein VIJ_000462 [Vibrio cholerae RC27]
 gi|262028273|gb|EEY46930.1| hypothetical protein VIG_003200 [Vibrio cholerae INDRE 91/1]
 gi|262033412|gb|EEY51919.1| hypothetical protein VIH_001061 [Vibrio cholerae CT 5369-93]
 gi|297534920|gb|EFH73756.1| conserved hypothetical protein [Vibrio cholerae RC385]
 gi|297540866|gb|EFH76920.1| conserved hypothetical protein [Vibrio cholerae MAK 757]
 gi|327484962|gb|AEA79369.1| conserved hypothetical protein [Vibrio cholerae LMA3894-4]
          Length = 86

 Score = 67.4 bits (164), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 19/76 (25%), Positives = 34/76 (44%), Gaps = 1/76 (1%)

Query: 8  QCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEK 67
          Q  +I +   RRG  E+D+++  F +     L+  E     +++E DD +LF W  G  +
Sbjct: 6  QKARIKW-ACRRGMLELDVVIMPFFEECFDSLTESEQDDFVALLESDDPDLFAWVMGHGR 64

Query: 68 PPEYLRTPIFKKIYDY 83
                  +  KI  +
Sbjct: 65 CENLGLAAMVDKIVAH 80


>gi|30250297|ref|NP_842367.1| hypothetical protein NE2372 [Nitrosomonas europaea ATCC 19718]
 gi|75540026|sp|Q82SG6|Y2372_NITEU RecName: Full=UPF0350 protein NE2372
 gi|30181092|emb|CAD86284.1| conserved hypothetical protein [Nitrosomonas europaea ATCC 19718]
          Length = 77

 Score = 67.4 bits (164), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 20/75 (26%), Positives = 38/75 (50%), Gaps = 1/75 (1%)

Query: 8  QCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEK 67
             ++ +RC RRG  E+D++L  F+D+   +L   +L + E ++   D +L+    G  K
Sbjct: 3  HQARMRWRC-RRGMLELDIVLQRFIDNHYEQLDEHQLELFEMLLSLSDHDLWNIIIGNTK 61

Query: 68 PPEYLRTPIFKKIYD 82
           P     P+ K + +
Sbjct: 62 EPNNQFQPVLKLLQE 76


>gi|332532644|ref|ZP_08408520.1| protein YgfY [Pseudoalteromonas haloplanktis ANT/505]
 gi|332037860|gb|EGI74309.1| protein YgfY [Pseudoalteromonas haloplanktis ANT/505]
          Length = 83

 Score = 67.4 bits (164), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 20/75 (26%), Positives = 37/75 (49%), Gaps = 1/75 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          +I +   RRG  E+D++   FV+     LS+ +  + + ++ E+D +LF WF G E+  +
Sbjct: 9  RIRW-ACRRGMLELDVLFMPFVEEAYDSLSAEQQAIFQRLLTEEDPDLFAWFMGHEECKD 67

Query: 71 YLRTPIFKKIYDYYS 85
               +   I D   
Sbjct: 68 EQLNGMVSLILDRVR 82


>gi|332140421|ref|YP_004426159.1| TPR repeat protein [Alteromonas macleodii str. 'Deep ecotype']
 gi|332141909|ref|YP_004427647.1| TPR repeat protein [Alteromonas macleodii str. 'Deep ecotype']
 gi|327550443|gb|AEA97161.1| TPR repeat protein [Alteromonas macleodii str. 'Deep ecotype']
 gi|327551931|gb|AEA98649.1| TPR repeat protein [Alteromonas macleodii str. 'Deep ecotype']
          Length = 83

 Score = 67.4 bits (164), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 20/79 (25%), Positives = 35/79 (44%), Gaps = 1/79 (1%)

Query: 8  QCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEK 67
          +  ++ +   RRG  E+D++L  FV+     LS  E    E ++  DD +LF W  G +K
Sbjct: 6  RLARLKW-ACRRGMLELDVLLLPFVEEAFDSLSYEEQETFERLLTSDDPDLFAWIMGHQK 64

Query: 68 PPEYLRTPIFKKIYDYYSN 86
            +     +   I +    
Sbjct: 65 CEDPEFAAMVATIVNRVKA 83


>gi|157835280|pdb|2JR5|A Chain A, Solution Structure Of Upf0350 Protein Vc_2471. Northeast
          Structural Genomics Target Vcr36
          Length = 94

 Score = 67.0 bits (163), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 19/76 (25%), Positives = 34/76 (44%), Gaps = 1/76 (1%)

Query: 8  QCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEK 67
          Q  +I +   RRG  E+D+++  F +     L+  E     +++E DD +LF W  G  +
Sbjct: 6  QKARIKW-ACRRGMLELDVVIMPFFEECFDSLTESEQDDFVALLESDDPDLFAWVMGHGR 64

Query: 68 PPEYLRTPIFKKIYDY 83
                  +  KI  +
Sbjct: 65 CENLGLAAMVDKIVAH 80


>gi|319425552|gb|ADV53626.1| protein of unknown function DUF339 [Shewanella putrefaciens 200]
          Length = 82

 Score = 67.0 bits (163), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 19/73 (26%), Positives = 36/73 (49%), Gaps = 1/73 (1%)

Query: 9  CRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKP 68
            ++ +   RRG  E+D++   FV++   +LS ++      ++E +D  LF WF G E  
Sbjct: 6  IARVRW-ACRRGMLELDVLFQPFVENIYQDLSDIDKASFIRLLECEDPELFAWFMGHEAC 64

Query: 69 PEYLRTPIFKKIY 81
          P+     +  K+ 
Sbjct: 65 PDAELARMVVKVR 77


>gi|117621545|ref|YP_855334.1| TPR repeat-containing protein [Aeromonas hydrophila subsp.
          hydrophila ATCC 7966]
 gi|117562952|gb|ABK39900.1| TPR repeat protein [Aeromonas hydrophila subsp. hydrophila ATCC
          7966]
          Length = 89

 Score = 67.0 bits (163), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 21/81 (25%), Positives = 35/81 (43%), Gaps = 1/81 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          ++ +   RRG  E+D+I   F +H    LS  E      ++E +D  LF+W  G   P +
Sbjct: 9  RLKW-ACRRGMLELDVIFMPFFEHEFDGLSEAEQQTFIRLLECEDPELFRWSMGHGVPED 67

Query: 71 YLRTPIFKKIYDYYSNNLDRK 91
               +   I +      DR+
Sbjct: 68 PAFAAMIPLILERNQARHDRQ 88


>gi|56459927|ref|YP_155208.1| hypothetical protein IL0819 [Idiomarina loihiensis L2TR]
 gi|81175091|sp|Q5R0Z7|Y819_IDILO RecName: Full=UPF0350 protein IL0819
 gi|56178937|gb|AAV81659.1| Uncharacterized conserved protein [Idiomarina loihiensis L2TR]
          Length = 90

 Score = 67.0 bits (163), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 21/77 (27%), Positives = 36/77 (46%), Gaps = 1/77 (1%)

Query: 9  CRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKP 68
           R++ +   RRG  E+D++   FVD    ELS  +  +   +I  DD +LF WF G +K 
Sbjct: 14 KRRLRW-ACRRGMLELDVLFEPFVDQAYDELSEEQKAVFRRLITCDDPDLFAWFMGHQKC 72

Query: 69 PEYLRTPIFKKIYDYYS 85
           +     + + +     
Sbjct: 73 EDEELAEMIRFMLSRVK 89


>gi|24372917|ref|NP_716959.1| hypothetical protein SO_1339 [Shewanella oneidensis MR-1]
 gi|81175061|sp|Q8EH90|Y1339_SHEON RecName: Full=UPF0350 protein SO_1339
 gi|24347049|gb|AAN54404.1|AE015578_4 conserved hypothetical protein [Shewanella oneidensis MR-1]
          Length = 82

 Score = 66.6 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 19/62 (30%), Positives = 33/62 (53%), Gaps = 1/62 (1%)

Query: 9  CRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKP 68
            ++ +   RRG  E+D++   FVD+   +LS  +  +   ++E +D  LF WF G E  
Sbjct: 6  IARVRW-ACRRGMLELDVLFQPFVDNVYQDLSDEDKVLFIRLLECEDPELFAWFMGHEVC 64

Query: 69 PE 70
          P+
Sbjct: 65 PD 66


>gi|307195271|gb|EFN77227.1| Protein EMI5-like protein, mitochondrial [Harpegnathos saltator]
          Length = 80

 Score = 66.6 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 13/76 (17%), Positives = 32/76 (42%), Gaps = 2/76 (2%)

Query: 21 TREMDLILGSFVDHFILELSSVELTMLESIIEE--DDSNLFKWFTGMEKPPEYLRTPIFK 78
            E  L+L +F   ++   +  +L + + +I    +D ++F W TG++  P      +  
Sbjct: 1  MLENGLLLSTFAKKYLNTFNDKQLRLYDHLINLPSNDWDIFYWATGVKPTPPEFDNEVMD 60

Query: 79 KIYDYYSNNLDRKNML 94
           +  +  N      ++
Sbjct: 61 LLKKHIQNENREARIM 76


>gi|296112888|ref|YP_003626826.1| hypothetical protein MCR_0664 [Moraxella catarrhalis RH4]
 gi|295920582|gb|ADG60933.1| conserved hypothetical protein [Moraxella catarrhalis RH4]
 gi|326561119|gb|EGE11484.1| hypothetical protein E9G_04719 [Moraxella catarrhalis 7169]
 gi|326564449|gb|EGE14676.1| hypothetical protein E9K_04357 [Moraxella catarrhalis 103P14B1]
 gi|326564575|gb|EGE14800.1| hypothetical protein E9O_06271 [Moraxella catarrhalis 12P80B1]
 gi|326567579|gb|EGE17694.1| hypothetical protein E9Q_06788 [Moraxella catarrhalis BC1]
 gi|326569427|gb|EGE19487.1| hypothetical protein E9U_07301 [Moraxella catarrhalis BC8]
 gi|326575342|gb|EGE25270.1| hypothetical protein E9W_05118 [Moraxella catarrhalis CO72]
 gi|326576573|gb|EGE26480.1| hypothetical protein E9Y_01115 [Moraxella catarrhalis 101P30B1]
          Length = 88

 Score = 66.6 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 21/82 (25%), Positives = 37/82 (45%), Gaps = 1/82 (1%)

Query: 1  MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
          M        R+I+Y+  RRG +E+D  +  +V    L   + E    E+++  +D +L  
Sbjct: 1  MTIQPTDAQRRIIYQA-RRGLKELDFYIDYYVKSHYLSADADEQQAFETLLSYEDPDLLV 59

Query: 61 WFTGMEKPPEYLRTPIFKKIYD 82
          +F G E P E     +  K+  
Sbjct: 60 FFLGQETPSEAGVAALIDKMKS 81


>gi|260771284|ref|ZP_05880211.1| hypothetical protein VFA_004349 [Vibrio furnissii CIP 102972]
 gi|260613881|gb|EEX39073.1| hypothetical protein VFA_004349 [Vibrio furnissii CIP 102972]
 gi|315179109|gb|ADT86023.1| hypothetical protein vfu_A00827 [Vibrio furnissii NCTC 11218]
          Length = 86

 Score = 66.6 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 20/73 (27%), Positives = 33/73 (45%), Gaps = 1/73 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          +I +   RRG  E+D+++  F +     LS  E     S++E DD +LF W  G  +   
Sbjct: 9  RIKW-ACRRGMLELDVVIMPFFEECFDTLSESEQQDFVSLLECDDPDLFTWVMGHGRSEN 67

Query: 71 YLRTPIFKKIYDY 83
               +  KI  +
Sbjct: 68 LGHAAMVDKIVAH 80


>gi|262393262|ref|YP_003285116.1| hypothetical protein VEA_002489 [Vibrio sp. Ex25]
 gi|262336856|gb|ACY50651.1| hypothetical protein VEA_002489 [Vibrio sp. Ex25]
          Length = 86

 Score = 66.6 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 20/73 (27%), Positives = 33/73 (45%), Gaps = 1/73 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          +I +   RRG  E+D+++  F +     LS  E     S++E DD +LF W  G  +   
Sbjct: 9  RIKW-ACRRGMLELDVVIMPFFEECFDTLSEQEQRDFVSLLECDDPDLFTWIMGHGRSEN 67

Query: 71 YLRTPIFKKIYDY 83
               +  KI  +
Sbjct: 68 LGHAAMVDKIVAH 80


>gi|260771931|ref|ZP_05880849.1| hypothetical protein VIB_000370 [Vibrio metschnikovii CIP 69.14]
 gi|260613223|gb|EEX38424.1| hypothetical protein VIB_000370 [Vibrio metschnikovii CIP 69.14]
          Length = 86

 Score = 66.6 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 20/73 (27%), Positives = 33/73 (45%), Gaps = 1/73 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          ++ +   RRG  E+D+++  F +     LS  E     S++E DD +LF W  G  +   
Sbjct: 9  RVKW-ACRRGMLELDVVVMPFFEECFEALSESEQQDFVSLLECDDPDLFTWIMGHGRSEN 67

Query: 71 YLRTPIFKKIYDY 83
               +  KI  Y
Sbjct: 68 LGHAAMVDKIVAY 80


>gi|261211565|ref|ZP_05925853.1| hypothetical protein VCJ_001829 [Vibrio sp. RC341]
 gi|260839520|gb|EEX66146.1| hypothetical protein VCJ_001829 [Vibrio sp. RC341]
          Length = 86

 Score = 66.6 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 19/76 (25%), Positives = 34/76 (44%), Gaps = 1/76 (1%)

Query: 8  QCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEK 67
          Q  +I +   RRG  E+D+++  F +     L+  E     +++E DD +LF W  G  +
Sbjct: 6  QKARIKW-ACRRGMLELDVVIMPFFEECFDSLTESEQNDFVALLESDDPDLFSWIMGHGR 64

Query: 68 PPEYLRTPIFKKIYDY 83
                  +  KI  +
Sbjct: 65 CENLGLAAMVDKIVAH 80


>gi|258622354|ref|ZP_05717379.1| conserved hypothetical protein [Vibrio mimicus VM573]
 gi|258626738|ref|ZP_05721560.1| conserved hypothetical protein [Vibrio mimicus VM603]
 gi|262166510|ref|ZP_06034247.1| hypothetical protein VMA_002969 [Vibrio mimicus VM223]
 gi|262170582|ref|ZP_06038260.1| hypothetical protein VII_001393 [Vibrio mimicus MB-451]
 gi|258580994|gb|EEW05921.1| conserved hypothetical protein [Vibrio mimicus VM603]
 gi|258585370|gb|EEW10094.1| conserved hypothetical protein [Vibrio mimicus VM573]
 gi|261891658|gb|EEY37644.1| hypothetical protein VII_001393 [Vibrio mimicus MB-451]
 gi|262026226|gb|EEY44894.1| hypothetical protein VMA_002969 [Vibrio mimicus VM223]
          Length = 86

 Score = 66.2 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 19/76 (25%), Positives = 35/76 (46%), Gaps = 1/76 (1%)

Query: 8  QCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEK 67
          Q  +I +   RRG  E+D+++  F +     L+  E +   +++E DD +LF W  G  +
Sbjct: 6  QKARIKW-ACRRGMLELDVVIMPFFEECFDSLTESEQSDFVALLESDDPDLFAWVMGHGR 64

Query: 68 PPEYLRTPIFKKIYDY 83
                  +  KI  +
Sbjct: 65 CENLGLAAMVDKIVAH 80


>gi|91227862|ref|ZP_01262035.1| hypothetical protein V12G01_13859 [Vibrio alginolyticus 12G01]
 gi|269965776|ref|ZP_06179873.1| conserved hypothetical protein [Vibrio alginolyticus 40B]
 gi|91188372|gb|EAS74668.1| hypothetical protein V12G01_13859 [Vibrio alginolyticus 12G01]
 gi|269829644|gb|EEZ83881.1| conserved hypothetical protein [Vibrio alginolyticus 40B]
          Length = 86

 Score = 66.2 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 20/73 (27%), Positives = 33/73 (45%), Gaps = 1/73 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          +I +   RRG  E+D+++  F +     LS  E     S++E DD +LF W  G  +   
Sbjct: 9  RIKW-ACRRGMLELDVVIMPFFEECFDTLSEQEQRDFVSLLECDDPDLFTWVMGHGRSEN 67

Query: 71 YLRTPIFKKIYDY 83
               +  KI  +
Sbjct: 68 LGHAAMVDKIVAH 80


>gi|85712968|ref|ZP_01044007.1| hypothetical protein OS145_07434 [Idiomarina baltica OS145]
 gi|85693206|gb|EAQ31165.1| hypothetical protein OS145_07434 [Idiomarina baltica OS145]
          Length = 90

 Score = 66.2 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 20/62 (32%), Positives = 33/62 (53%), Gaps = 1/62 (1%)

Query: 9  CRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKP 68
           R++ +   RRG  E+D++   FVD     LS  +  +   ++  DD +LF WF G +K 
Sbjct: 14 KRRLKW-ACRRGMLELDVLFEPFVDEAYDHLSEEDKAIFRRLVTCDDPDLFAWFMGHKKC 72

Query: 69 PE 70
          P+
Sbjct: 73 PD 74


>gi|239996334|ref|ZP_04716858.1| TPR repeat protein [Alteromonas macleodii ATCC 27126]
          Length = 83

 Score = 66.2 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 19/78 (24%), Positives = 35/78 (44%), Gaps = 1/78 (1%)

Query: 8  QCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEK 67
          +  ++ +   RRG  E+D++L  FV+     LS  +    E ++  DD +LF W  G +K
Sbjct: 6  RLARLKW-ACRRGMLELDVLLLPFVEEAFDSLSYEDQETFERLLTSDDPDLFAWIMGHQK 64

Query: 68 PPEYLRTPIFKKIYDYYS 85
            +     +   I +   
Sbjct: 65 CEDPELAAMVATIVNRVK 82


>gi|270156717|ref|ZP_06185374.1| conserved domain protein [Legionella longbeachae D-4968]
 gi|289164836|ref|YP_003454974.1| hypothetical protein LLO_1502 [Legionella longbeachae NSW150]
 gi|269988742|gb|EEZ94996.1| conserved domain protein [Legionella longbeachae D-4968]
 gi|288858009|emb|CBJ11869.1| hypothetical protein LLO_1502 [Legionella longbeachae NSW150]
          Length = 81

 Score = 66.2 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 37/77 (48%), Gaps = 1/77 (1%)

Query: 6  NLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGM 65
          N +  ++ + C RRG  E+DLIL  F++  +  +S  EL    +++   D  LF W  G 
Sbjct: 4  NQEKARLAWHC-RRGMLELDLILQRFLEKHLDFISRDELEAFNNLLSCTDPELFAWLMGH 62

Query: 66 EKPPEYLRTPIFKKIYD 82
          ++P E     I   I  
Sbjct: 63 DEPQEKELKEIVAIIRS 79


>gi|170725595|ref|YP_001759621.1| hypothetical protein Swoo_1234 [Shewanella woodyi ATCC 51908]
 gi|169810942|gb|ACA85526.1| protein of unknown function DUF339 [Shewanella woodyi ATCC 51908]
          Length = 83

 Score = 65.8 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 20/81 (24%), Positives = 39/81 (48%), Gaps = 3/81 (3%)

Query: 1  MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
          M + MN    ++ +   RRG  E+D++   FV+    ++S  +  +   ++E +D  LF 
Sbjct: 1  MSEPMN--IARVRW-ACRRGMLELDVLFQPFVEKHYEQMSVEDKHIFVRLLEGEDPVLFA 57

Query: 61 WFTGMEKPPEYLRTPIFKKIY 81
          WF G EK  +     +  ++ 
Sbjct: 58 WFMGHEKCADPELAKMVIRVR 78


>gi|91794126|ref|YP_563777.1| hypothetical protein Sden_2775 [Shewanella denitrificans OS217]
 gi|91716128|gb|ABE56054.1| protein of unknown function DUF339 [Shewanella denitrificans
          OS217]
          Length = 82

 Score = 65.8 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 18/73 (24%), Positives = 34/73 (46%), Gaps = 1/73 (1%)

Query: 9  CRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKP 68
            ++ +   RRG  E+D++   FV+    +LS  +      ++  +D  LF WF G E+ 
Sbjct: 6  IARVRW-ACRRGMLELDVLFQPFVEAQYQDLSDQDKLDFIRLLTCEDPELFAWFMGHEQC 64

Query: 69 PEYLRTPIFKKIY 81
          P+     +  K+ 
Sbjct: 65 PDSDLARMVIKVR 77


>gi|118092381|ref|XP_001231365.1| PREDICTED: hypothetical protein, partial [Gallus gallus]
          Length = 116

 Score = 65.4 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 12/64 (18%), Positives = 31/64 (48%), Gaps = 2/64 (3%)

Query: 2   KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEE--DDSNLF 59
            + +  +  +++Y   +RG  E  ++L  F    +  +   +L + + +I E  +D +++
Sbjct: 53  NEPLPTKRARLLYESRKRGMLENCILLSLFAKENLSRMDERQLNLYDRLINEPSNDWDIY 112

Query: 60  KWFT 63
            W T
Sbjct: 113 YWAT 116


>gi|166712283|ref|ZP_02243490.1| hypothetical protein Xoryp_12720 [Xanthomonas oryzae pv.
          oryzicola BLS256]
          Length = 65

 Score = 65.4 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 14/62 (22%), Positives = 28/62 (45%)

Query: 21 TREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPEYLRTPIFKKI 80
           RE+D + G ++D    +    E  +   +++ +D  L++WF G E  P+     +   I
Sbjct: 1  MRELDQLFGRYLDQRWAQAPDAERAVFLQLLDCEDDKLWRWFMGYEACPDVANAALIADI 60

Query: 81 YD 82
            
Sbjct: 61 RA 62


>gi|225023991|ref|ZP_03713183.1| hypothetical protein EIKCOROL_00858 [Eikenella corrodens ATCC
          23834]
 gi|224943016|gb|EEG24225.1| hypothetical protein EIKCOROL_00858 [Eikenella corrodens ATCC
          23834]
          Length = 86

 Score = 65.4 bits (159), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 20/82 (24%), Positives = 33/82 (40%), Gaps = 1/82 (1%)

Query: 1  MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
          M    +   R++ ++  RRG  E+D++L  F+      LS  ELT+   ++   D  LF 
Sbjct: 1  MSTFDDTAKRRLRFQ-TRRGLLELDILLKQFMAAEFDRLSDAELTVFTELLALPDPELFA 59

Query: 61 WFTGMEKPPEYLRTPIFKKIYD 82
             G           +  KI  
Sbjct: 60 QLNGQNPAANAESAALLDKIRS 81


>gi|119471896|ref|ZP_01614204.1| hypothetical protein ATW7_04659 [Alteromonadales bacterium TW-7]
 gi|119445269|gb|EAW26559.1| hypothetical protein ATW7_04659 [Alteromonadales bacterium TW-7]
          Length = 83

 Score = 65.4 bits (159), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 18/75 (24%), Positives = 38/75 (50%), Gaps = 1/75 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          +I +   RRG  E+D++   FV+     L++ +  + + ++ ++D +LF WF G EK  +
Sbjct: 9  RIRW-ACRRGMLELDVLFMPFVEEAYDSLNAEQQAIFQRLLTQEDPDLFAWFMGHEKCKD 67

Query: 71 YLRTPIFKKIYDYYS 85
               + + I +   
Sbjct: 68 EQLNSMVQLILNRVR 82


>gi|197335149|ref|YP_002156895.1| protein VV1_1557 [Vibrio fischeri MJ11]
 gi|197316639|gb|ACH66086.1| protein VV1_1557 [Vibrio fischeri MJ11]
          Length = 86

 Score = 65.4 bits (159), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 21/79 (26%), Positives = 37/79 (46%), Gaps = 1/79 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          ++ +   RRG  E+D+++  F D    EL+  E     S++E DD +LF W  G  +   
Sbjct: 9  RVKW-ACRRGMLELDVVIMPFFDECFEELTEAEQQAFVSLLECDDPDLFTWIMGHGRSDN 67

Query: 71 YLRTPIFKKIYDYYSNNLD 89
               +  KI ++  + L 
Sbjct: 68 LAHASMVDKIVEHNLSKLR 86


>gi|262273720|ref|ZP_06051533.1| DUF339 domain-containing protein [Grimontia hollisae CIP 101886]
 gi|262222135|gb|EEY73447.1| DUF339 domain-containing protein [Grimontia hollisae CIP 101886]
          Length = 86

 Score = 65.0 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 21/79 (26%), Positives = 35/79 (44%), Gaps = 1/79 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          +I +   RRG  E+D+I+  F +     LS  E     +++E DD +LF W  G  +   
Sbjct: 9  RIKW-ACRRGMLELDVIIMPFFEECFDTLSEDEKQDFVALLECDDPDLFTWLMGHGRSEN 67

Query: 71 YLRTPIFKKIYDYYSNNLD 89
               +  KI ++    L 
Sbjct: 68 PALAAMTDKIVEHNRRKLR 86


>gi|307545456|ref|YP_003897935.1| hypothetical protein HELO_2866 [Halomonas elongata DSM 2581]
 gi|307217480|emb|CBV42750.1| K09159 hypothetical protein [Halomonas elongata DSM 2581]
          Length = 214

 Score = 65.0 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 22/79 (27%), Positives = 40/79 (50%), Gaps = 1/79 (1%)

Query: 6   NLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGM 65
           + Q +++ +   RRG  E+DL+L  F++    +L   +     ++I E+D +LF W    
Sbjct: 126 SAQRKRLYWHS-RRGMWELDLLLVPFLEQRYDDLDERDQAAYRALIGEEDQDLFFWLMRR 184

Query: 66  EKPPEYLRTPIFKKIYDYY 84
           + P E  R  I K I ++ 
Sbjct: 185 DWPEEPERRRIVKMIVEHA 203


>gi|312881727|ref|ZP_07741504.1| hypothetical protein VIBC2010_00610 [Vibrio caribbenthicus ATCC
          BAA-2122]
 gi|309370617|gb|EFP98092.1| hypothetical protein VIBC2010_00610 [Vibrio caribbenthicus ATCC
          BAA-2122]
          Length = 86

 Score = 65.0 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 18/78 (23%), Positives = 34/78 (43%), Gaps = 1/78 (1%)

Query: 6  NLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGM 65
            +  +I +   RRG  E+D+++  F +     LS  E     +++E DD +LF W  G 
Sbjct: 4  TEEKARIKW-ACRRGMLELDVVIMPFFEECFEGLSDDEQQDFVALLECDDPDLFTWIMGH 62

Query: 66 EKPPEYLRTPIFKKIYDY 83
           +        +  K+  +
Sbjct: 63 GRSENLKHASMIDKVVAH 80


>gi|149192319|ref|ZP_01870527.1| hypothetical protein VSAK1_07924 [Vibrio shilonii AK1]
 gi|148833852|gb|EDL50881.1| hypothetical protein VSAK1_07924 [Vibrio shilonii AK1]
          Length = 86

 Score = 65.0 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 19/78 (24%), Positives = 35/78 (44%), Gaps = 1/78 (1%)

Query: 6  NLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGM 65
          + +  +I +   RRG  E+D+++  F +     L+  E     S++E DD +LF W  G 
Sbjct: 4  SEEKARIKW-ACRRGMLELDVVIMPFFEECFDTLNDQEQKDFVSLLECDDPDLFTWVMGH 62

Query: 66 EKPPEYLRTPIFKKIYDY 83
           +        +  KI  +
Sbjct: 63 GRSENLGHASMVDKIVAH 80


>gi|59712703|ref|YP_205479.1| hypothetical protein VF_2096 [Vibrio fischeri ES114]
 gi|75353459|sp|Q5E305|Y2096_VIBF1 RecName: Full=UPF0350 protein VF_2096
 gi|59480804|gb|AAW86591.1| hypothetical protein VF_2096 [Vibrio fischeri ES114]
          Length = 86

 Score = 65.0 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 21/79 (26%), Positives = 37/79 (46%), Gaps = 1/79 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          ++ +   RRG  E+D+++  F D    EL+  E     S++E DD +LF W  G  +   
Sbjct: 9  RVKW-ACRRGMLELDVVIMPFFDECFEELTEAEQQAFVSLLECDDPDLFTWVMGHGRSDN 67

Query: 71 YLRTPIFKKIYDYYSNNLD 89
               +  KI ++  + L 
Sbjct: 68 LAHASMVDKIVEHNLSKLR 86


>gi|221135434|ref|ZP_03561737.1| hypothetical protein GHTCC_10948 [Glaciecola sp. HTCC2999]
          Length = 86

 Score = 65.0 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 17/61 (27%), Positives = 31/61 (50%), Gaps = 1/61 (1%)

Query: 8  QCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEK 67
          +  ++ +   RRG  E+D++   FV+    EL   +    E ++  DD +LF WF G ++
Sbjct: 6  RVNRLKW-ACRRGMLELDVLFLPFVEAAFDELDDGQKLTFERLLTCDDPDLFAWFMGHQQ 64

Query: 68 P 68
           
Sbjct: 65 C 65


>gi|326564771|gb|EGE14983.1| hypothetical protein E9M_00486 [Moraxella catarrhalis 46P47B1]
 gi|326577410|gb|EGE27294.1| hypothetical protein EA1_03270 [Moraxella catarrhalis O35E]
          Length = 88

 Score = 64.7 bits (157), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 20/82 (24%), Positives = 36/82 (43%), Gaps = 1/82 (1%)

Query: 1  MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
          M        R+I+Y+  RRG +E+D  +  +V    L   + E    E+++  +D +L  
Sbjct: 1  MTIQPTDAQRRIIYQA-RRGLKELDFYIDYYVKSHYLSADADEQQAFETLLSYEDPDLLV 59

Query: 61 WFTGMEKPPEYLRTPIFKKIYD 82
          +F G E P       +  K+  
Sbjct: 60 FFLGQETPSGAGVAALIDKMKS 81


>gi|148709411|gb|EDL41357.1| RIKEN cDNA 0610038F07, isoform CRA_b [Mus musculus]
          Length = 129

 Score = 64.7 bits (157), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 10/62 (16%), Positives = 28/62 (45%), Gaps = 2/62 (3%)

Query: 28  LGSFVDHFILELSSVELTMLESIIEE--DDSNLFKWFTGMEKPPEYLRTPIFKKIYDYYS 85
              F   ++  ++  +L + + +I E  +D +++ W T  +  PE     + + + ++  
Sbjct: 49  FSLFAKEYLHNMTEKQLNLYDRLINEPSNDWDIYYWATEAKPAPEIFENEVMELLREFAK 108

Query: 86  NN 87
           N 
Sbjct: 109 NK 110


>gi|237729837|ref|ZP_04560318.1| conserved hypothetical protein [Citrobacter sp. 30_2]
 gi|226908443|gb|EEH94361.1| conserved hypothetical protein [Citrobacter sp. 30_2]
          Length = 88

 Score = 64.7 bits (157), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 21/78 (26%), Positives = 37/78 (47%)

Query: 5  MNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTG 64
          M++  +  ++   RRG RE+D+ +  F +H    LS  E  +   ++E DD +LF W   
Sbjct: 1  MDINNKARIHWACRRGMRELDISIMPFFEHEYDSLSDEEKRIFIRLLECDDPDLFNWLMN 60

Query: 65 MEKPPEYLRTPIFKKIYD 82
            KP +     + + I  
Sbjct: 61 HGKPADEQLEQMVRLIQT 78


>gi|238795221|ref|ZP_04638806.1| hypothetical protein yinte0001_4630 [Yersinia intermedia ATCC
          29909]
 gi|238725441|gb|EEQ17010.1| hypothetical protein yinte0001_4630 [Yersinia intermedia ATCC
          29909]
          Length = 88

 Score = 64.7 bits (157), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 21/72 (29%), Positives = 33/72 (45%), Gaps = 1/72 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          +I +   RRG RE+D+ +  F +H    LS  E      ++E DD +LF W     +P +
Sbjct: 8  RIHW-ACRRGMRELDISIMPFFEHEYDGLSDNEKQAFIRLLECDDPDLFNWLMNHGEPQD 66

Query: 71 YLRTPIFKKIYD 82
               + K I  
Sbjct: 67 SELRQMVKLIQT 78


>gi|77359674|ref|YP_339249.1| hypothetical protein PSHAa0723 [Pseudoalteromonas haloplanktis
          TAC125]
 gi|76874585|emb|CAI85806.1| conserved protein of unknown function(ygfY) [Pseudoalteromonas
          haloplanktis TAC125]
          Length = 83

 Score = 64.7 bits (157), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 19/75 (25%), Positives = 37/75 (49%), Gaps = 1/75 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          +I +   RRG  E+D++   FV+     LS  +  + + ++ E+D +LF WF G ++  +
Sbjct: 9  RIRW-ACRRGMLELDVLFMPFVEDAFDSLSVEQQAIFQRLLTEEDPDLFAWFMGHKECKD 67

Query: 71 YLRTPIFKKIYDYYS 85
               + + I D   
Sbjct: 68 EQLNSMVQLILDRVR 82


>gi|332160500|ref|YP_004297077.1| hypothetical protein YE105_C0878 [Yersinia enterocolitica subsp.
          palearctica 105.5R(r)]
 gi|325664730|gb|ADZ41374.1| hypothetical protein YE105_C0878 [Yersinia enterocolitica subsp.
          palearctica 105.5R(r)]
 gi|330863455|emb|CBX73574.1| UPF0350 protein YPO0897/y3282/YP_3594 [Yersinia enterocolitica
          W22703]
          Length = 88

 Score = 64.7 bits (157), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 21/72 (29%), Positives = 34/72 (47%), Gaps = 1/72 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          +I +   RRG RE+D+ +  F +H    LS  E  +   ++E DD +LF W     +P +
Sbjct: 8  RIHW-ACRRGMRELDISIMPFFEHEYDGLSDNEKQVFIRLLECDDPDLFNWLMNHGEPQD 66

Query: 71 YLRTPIFKKIYD 82
               + K I  
Sbjct: 67 SELRQMVKLIQT 78


>gi|90412076|ref|ZP_01220083.1| hypothetical protein P3TCK_24861 [Photobacterium profundum 3TCK]
 gi|90327054|gb|EAS43433.1| hypothetical protein P3TCK_24861 [Photobacterium profundum 3TCK]
          Length = 86

 Score = 64.7 bits (157), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 19/84 (22%), Positives = 38/84 (45%), Gaps = 1/84 (1%)

Query: 6  NLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGM 65
          + +  ++ +   RRG  E+D+I+  F +  + +L   E     S++  DD +LF W  G 
Sbjct: 4  SDERARLKW-ACRRGMLELDVIIMPFFEECLDDLPDQEQRDFVSLLTSDDPDLFTWMMGH 62

Query: 66 EKPPEYLRTPIFKKIYDYYSNNLD 89
           +        +  KI  + ++ L 
Sbjct: 63 GRSENPAHAAMVDKIVAHNNSKLR 86


>gi|33151335|ref|NP_872688.1| hypothetical protein HD0065 [Haemophilus ducreyi 35000HP]
 gi|81175058|sp|Q7VPK3|Y065_HAEDU RecName: Full=UPF0350 protein HD_0065
 gi|33147555|gb|AAP95077.1| conserved hypothetical protein [Haemophilus ducreyi 35000HP]
          Length = 82

 Score = 64.7 bits (157), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 19/72 (26%), Positives = 34/72 (47%), Gaps = 1/72 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          KI ++C RRG RE+D ++  F   +  +LS  E     +++   D  LF+W       P 
Sbjct: 8  KIEWQC-RRGMRELDKMIMPFYQQYFEQLSEAEQRTFVTMLSYTDPELFRWVMHQSPAPT 66

Query: 71 YLRTPIFKKIYD 82
             + + ++I  
Sbjct: 67 VAISALIERIRA 78


>gi|261364262|ref|ZP_05977145.1| TPR repeat protein [Neisseria mucosa ATCC 25996]
 gi|288567504|gb|EFC89064.1| TPR repeat protein [Neisseria mucosa ATCC 25996]
          Length = 82

 Score = 64.7 bits (157), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 24/76 (31%), Positives = 37/76 (48%), Gaps = 1/76 (1%)

Query: 6  NLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGM 65
          ++  RKI ++  RRG  E+DLI G F++    +LS  EL+    I+E  D  L     G 
Sbjct: 6  DIAKRKIRFQ-TRRGLLELDLIFGRFMEKEFEQLSDKELSEFSEILEFQDQELLALINGH 64

Query: 66 EKPPEYLRTPIFKKIY 81
              +    P+ +KI 
Sbjct: 65 SATDKEHLIPMLEKIR 80


>gi|257454687|ref|ZP_05619943.1| hypothetical protein ENHAE0001_1297 [Enhydrobacter aerosaccus
          SK60]
 gi|257447997|gb|EEV22984.1| hypothetical protein ENHAE0001_1297 [Enhydrobacter aerosaccus
          SK60]
          Length = 88

 Score = 64.7 bits (157), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 22/85 (25%), Positives = 38/85 (44%), Gaps = 5/85 (5%)

Query: 1  MKKNM---NLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSN 57
          M  N     L+ RK++YR  RRG +E+D     +V    L+  S E  +   +++E+D +
Sbjct: 1  MSDNQPEPTLEQRKVIYRA-RRGLKELDYYFDPYVRAHYLQADSQEQQIFAELVKEEDPD 59

Query: 58 LFKWFTGMEKPPEYLRTPIFKKIYD 82
          L  WF   +         +  K+  
Sbjct: 60 LLDWFLHNQPTKPEF-ADLIAKLKS 83


>gi|54310197|ref|YP_131217.1| hypothetical protein PBPRA3099 [Photobacterium profundum SS9]
 gi|81175079|sp|Q6LMR2|Y3099_PHOPR RecName: Full=UPF0350 protein PBPRA3099
 gi|46914638|emb|CAG21415.1| conserved hypothetical protein [Photobacterium profundum SS9]
          Length = 88

 Score = 64.3 bits (156), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 19/84 (22%), Positives = 38/84 (45%), Gaps = 1/84 (1%)

Query: 6  NLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGM 65
          + +  ++ +   RRG  E+D+I+  F +  + +L   E     S++  DD +LF W  G 
Sbjct: 6  SDERARLKW-ACRRGMLELDVIIMPFFEECLDDLPDQEQRDFVSLLTSDDPDLFTWMMGH 64

Query: 66 EKPPEYLRTPIFKKIYDYYSNNLD 89
           +        +  KI  + ++ L 
Sbjct: 65 GRSENPAHAAMVDKIVAHNNSKLR 88


>gi|254507503|ref|ZP_05119637.1| conserved hypothetical protein [Vibrio parahaemolyticus 16]
 gi|219549573|gb|EED26564.1| conserved hypothetical protein [Vibrio parahaemolyticus 16]
          Length = 86

 Score = 64.3 bits (156), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 21/73 (28%), Positives = 34/73 (46%), Gaps = 1/73 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          +I + C RRG  E+D+++  F +     LS  E     S++E DD +LF W  G  +   
Sbjct: 9  RIKWGC-RRGMLELDVVIMPFFEECFESLSENEQRDFVSLLECDDPDLFTWIMGHGRSEN 67

Query: 71 YLRTPIFKKIYDY 83
               +  KI  +
Sbjct: 68 LGHASMVDKIVAH 80


>gi|209695952|ref|YP_002263882.1| hypothetical protein VSAL_I2534 [Aliivibrio salmonicida LFI1238]
 gi|208009905|emb|CAQ80218.1| conserved hypothetical protein [Aliivibrio salmonicida LFI1238]
          Length = 86

 Score = 64.3 bits (156), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 21/79 (26%), Positives = 36/79 (45%), Gaps = 1/79 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          ++ +   RRG  E+D+++  F D    EL+  E     S++E DD +LF W  G  +   
Sbjct: 9  RVKW-ACRRGMLELDVVIMPFFDECFEELTEAEQQGFVSLLESDDPDLFTWIMGHGRSDN 67

Query: 71 YLRTPIFKKIYDYYSNNLD 89
               +  KI  +  + L 
Sbjct: 68 LAHASMIDKIVAHNHSKLR 86


>gi|323143172|ref|ZP_08077869.1| TPR repeat region [Succinatimonas hippei YIT 12066]
 gi|322417059|gb|EFY07696.1| TPR repeat region [Succinatimonas hippei YIT 12066]
          Length = 89

 Score = 64.3 bits (156), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 22/83 (26%), Positives = 39/83 (46%), Gaps = 1/83 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          KI ++  RRG RE+DL+L  FV+H +  +    +     +++  D  LF+W  G  +P  
Sbjct: 8  KIKWQS-RRGMRELDLMLLPFVEHDLPNMDEAAVDAYIDLLKATDLELFRWLHGSAEPDS 66

Query: 71 YLRTPIFKKIYDYYSNNLDRKNM 93
            R  +   I   +     R+ +
Sbjct: 67 KSRKDMIATIIKCHEGRKGREGV 89


>gi|28899356|ref|NP_798961.1| hypothetical protein VP2582 [Vibrio parahaemolyticus RIMD
          2210633]
 gi|153840081|ref|ZP_01992748.1| protein YgfY [Vibrio parahaemolyticus AQ3810]
 gi|260362197|ref|ZP_05775184.1| conserved hypothetical protein [Vibrio parahaemolyticus K5030]
 gi|260878955|ref|ZP_05891310.1| conserved hypothetical protein [Vibrio parahaemolyticus AN-5034]
 gi|260897480|ref|ZP_05905976.1| conserved hypothetical protein [Vibrio parahaemolyticus Peru-466]
 gi|260899630|ref|ZP_05908025.1| conserved hypothetical protein [Vibrio parahaemolyticus AQ4037]
 gi|81175077|sp|Q87LM9|Y2582_VIBPA RecName: Full=UPF0350 protein VP2582
 gi|28807592|dbj|BAC60845.1| conserved hypothetical protein [Vibrio parahaemolyticus RIMD
          2210633]
 gi|149746327|gb|EDM57386.1| protein YgfY [Vibrio parahaemolyticus AQ3810]
 gi|308088018|gb|EFO37713.1| conserved hypothetical protein [Vibrio parahaemolyticus Peru-466]
 gi|308090454|gb|EFO40149.1| conserved hypothetical protein [Vibrio parahaemolyticus AN-5034]
 gi|308108235|gb|EFO45775.1| conserved hypothetical protein [Vibrio parahaemolyticus AQ4037]
 gi|308113965|gb|EFO51505.1| conserved hypothetical protein [Vibrio parahaemolyticus K5030]
 gi|328474113|gb|EGF44918.1| hypothetical protein VP10329_15435 [Vibrio parahaemolyticus
          10329]
          Length = 86

 Score = 64.3 bits (156), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 19/73 (26%), Positives = 33/73 (45%), Gaps = 1/73 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          +I +   RRG  E+D+++  F +     L+  E     S++E DD +LF W  G  +   
Sbjct: 9  RIKW-ACRRGMLELDVVIMPFFEECFDALNEQEQRDFVSLLECDDPDLFTWVMGHGRSEN 67

Query: 71 YLRTPIFKKIYDY 83
               +  KI  +
Sbjct: 68 LGHAAMVDKIVAH 80


>gi|255065297|ref|ZP_05317152.1| TPR repeat protein [Neisseria sicca ATCC 29256]
 gi|255050718|gb|EET46182.1| TPR repeat protein [Neisseria sicca ATCC 29256]
          Length = 82

 Score = 64.3 bits (156), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 24/77 (31%), Positives = 36/77 (46%), Gaps = 1/77 (1%)

Query: 6  NLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGM 65
          ++  RKI ++  RRG  E+DLI G F++     LS  EL+    I+E  D  L     G 
Sbjct: 6  DIAKRKIRFQ-TRRGLLELDLIFGRFMEKEFEHLSDKELSEFSEILEFQDQELLALINGH 64

Query: 66 EKPPEYLRTPIFKKIYD 82
              +    P+ +KI  
Sbjct: 65 SATDKEHLIPMLEKIRQ 81


>gi|323495996|ref|ZP_08101060.1| hypothetical protein VISI1226_03104 [Vibrio sinaloensis DSM
          21326]
 gi|323318958|gb|EGA71905.1| hypothetical protein VISI1226_03104 [Vibrio sinaloensis DSM
          21326]
          Length = 86

 Score = 64.3 bits (156), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 21/73 (28%), Positives = 34/73 (46%), Gaps = 1/73 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          +I + C RRG  E+D+++  F +     LS  E     S++E DD +LF W  G  +   
Sbjct: 9  RIKWGC-RRGMLELDVVIMPFFEECFESLSDNEQRDFVSLLECDDPDLFTWIMGHGRSEN 67

Query: 71 YLRTPIFKKIYDY 83
               +  KI  +
Sbjct: 68 LGHASMVDKIVAH 80


>gi|123443582|ref|YP_001007555.1| hypothetical protein YE3386 [Yersinia enterocolitica subsp.
          enterocolitica 8081]
 gi|238763221|ref|ZP_04624186.1| hypothetical protein ykris0001_27970 [Yersinia kristensenii ATCC
          33638]
 gi|122090543|emb|CAL13412.1| conserved hypothetical protein [Yersinia enterocolitica subsp.
          enterocolitica 8081]
 gi|238698494|gb|EEP91246.1| hypothetical protein ykris0001_27970 [Yersinia kristensenii ATCC
          33638]
 gi|318607032|emb|CBY28530.1| ygfy COG2938 [Yersinia enterocolitica subsp. palearctica Y11]
          Length = 88

 Score = 64.3 bits (156), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 21/72 (29%), Positives = 34/72 (47%), Gaps = 1/72 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          +I +   RRG RE+D+ +  F +H    LS  E  +   ++E DD +LF W     +P +
Sbjct: 8  RIHW-ACRRGMRELDISIMPFFEHEYDGLSDNEKQVFIRLLECDDPDLFNWLMNHGEPQD 66

Query: 71 YLRTPIFKKIYD 82
               + K I  
Sbjct: 67 SELRQMVKLIQT 78


>gi|315127406|ref|YP_004069409.1| hypothetical protein PSM_A2344 [Pseudoalteromonas sp. SM9913]
 gi|315015920|gb|ADT69258.1| hypothetical protein PSM_A2344 [Pseudoalteromonas sp. SM9913]
          Length = 83

 Score = 64.3 bits (156), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 19/75 (25%), Positives = 36/75 (48%), Gaps = 1/75 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          +I +   RRG  E+D++   FV+     L + +    + ++ ++D +LF WF G EK  +
Sbjct: 9  RIRW-ACRRGMLELDVLFMPFVEEAYDSLDAKQQATFQRLLTQEDPDLFAWFMGHEKCKD 67

Query: 71 YLRTPIFKKIYDYYS 85
               + + I D   
Sbjct: 68 VELNSMVELILDRVR 82


>gi|27364926|ref|NP_760454.1| hypothetical protein VV1_1557 [Vibrio vulnificus CMCP6]
 gi|320155311|ref|YP_004187690.1| YgfY [Vibrio vulnificus MO6-24/O]
 gi|81175067|sp|Q8DC84|Y1557_VIBVU RecName: Full=UPF0350 protein VV1_1557
 gi|27361072|gb|AAO09981.1| Uncharacterized conserved protein [Vibrio vulnificus CMCP6]
 gi|319930623|gb|ADV85487.1| ygfY [Vibrio vulnificus MO6-24/O]
          Length = 86

 Score = 64.3 bits (156), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 20/78 (25%), Positives = 35/78 (44%), Gaps = 1/78 (1%)

Query: 6  NLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGM 65
            +  +I +   RRG  E+D+++  F +    +LS  E     S++E DD +LF W  G 
Sbjct: 4  TEEKARIRW-ACRRGMLELDVVVMPFFEECFEKLSEQEQRDFVSLLECDDPDLFTWVMGH 62

Query: 66 EKPPEYLRTPIFKKIYDY 83
           +        +  KI  +
Sbjct: 63 GRSENLGHASMVDKIVAH 80


>gi|84390095|ref|ZP_00991357.1| hypothetical protein V12B01_07920 [Vibrio splendidus 12B01]
 gi|86146367|ref|ZP_01064691.1| hypothetical protein MED222_22341 [Vibrio sp. MED222]
 gi|148981089|ref|ZP_01816282.1| hypothetical protein VSWAT3_20910 [Vibrionales bacterium SWAT-3]
 gi|218710579|ref|YP_002418200.1| hypothetical protein VS_2629 [Vibrio splendidus LGP32]
 gi|84376749|gb|EAP93624.1| hypothetical protein V12B01_07920 [Vibrio splendidus 12B01]
 gi|85835846|gb|EAQ53980.1| hypothetical protein MED222_22341 [Vibrio sp. MED222]
 gi|145960992|gb|EDK26316.1| hypothetical protein VSWAT3_20910 [Vibrionales bacterium SWAT-3]
 gi|218323598|emb|CAV19848.1| Hypothetical protein VS_2629 [Vibrio splendidus LGP32]
          Length = 86

 Score = 63.9 bits (155), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 21/76 (27%), Positives = 34/76 (44%), Gaps = 1/76 (1%)

Query: 8  QCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEK 67
          Q  +I + C RRG  E+D+++  F +     L   E     S++E DD +LF W  G  +
Sbjct: 6  QKARIKWGC-RRGMLELDVVIMPFFEECFDSLQEQEQREFVSLLECDDPDLFTWVMGHGR 64

Query: 68 PPEYLRTPIFKKIYDY 83
                  +  KI  +
Sbjct: 65 SENLGHASMVDKIVAH 80


>gi|261345599|ref|ZP_05973243.1| TPR repeat protein [Providencia rustigianii DSM 4541]
 gi|282566079|gb|EFB71614.1| TPR repeat protein [Providencia rustigianii DSM 4541]
          Length = 95

 Score = 63.9 bits (155), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 17/85 (20%), Positives = 39/85 (45%)

Query: 3  KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
            ++++ +  ++   RRG RE+D+ +  F ++   +L+  +      ++E  D +LF W 
Sbjct: 6  SQIDIKNKARIHWACRRGMRELDISIMPFFEYEYDQLTDEDKYTFVRLLECPDPDLFNWL 65

Query: 63 TGMEKPPEYLRTPIFKKIYDYYSNN 87
              +P +     + K I +   N 
Sbjct: 66 MNHGRPDDEKLFNMIKLIQEKNKNR 90


>gi|37681025|ref|NP_935634.1| hypothetical protein VV2841 [Vibrio vulnificus YJ016]
 gi|81175078|sp|Q7MHM8|Y2841_VIBVY RecName: Full=UPF0350 protein VV2841
 gi|37199775|dbj|BAC95605.1| conserved hypothetical protein [Vibrio vulnificus YJ016]
          Length = 86

 Score = 63.9 bits (155), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 20/78 (25%), Positives = 35/78 (44%), Gaps = 1/78 (1%)

Query: 6  NLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGM 65
            +  +I +   RRG  E+D+++  F +    +LS  E     S++E DD +LF W  G 
Sbjct: 4  TEEKARIRW-ACRRGMLELDVVVMPFFEECFDKLSEQEQRDFVSLLECDDPDLFTWVMGH 62

Query: 66 EKPPEYLRTPIFKKIYDY 83
           +        +  KI  +
Sbjct: 63 GRSENLGHASMVDKIVAH 80


>gi|261253909|ref|ZP_05946482.1| hypothetical protein VIA_003936 [Vibrio orientalis CIP 102891]
 gi|260937300|gb|EEX93289.1| hypothetical protein VIA_003936 [Vibrio orientalis CIP 102891]
          Length = 86

 Score = 63.9 bits (155), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 20/76 (26%), Positives = 33/76 (43%), Gaps = 1/76 (1%)

Query: 8  QCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEK 67
          Q  +I +   RRG  E+D+++  F +     L   E     S++E DD +LF W  G  +
Sbjct: 6  QKARIKW-ACRRGMLELDVVIMPFFEECFESLKENEQQDFVSLLECDDPDLFTWIMGHGR 64

Query: 68 PPEYLRTPIFKKIYDY 83
                  +  KI  +
Sbjct: 65 SENLGHASMVDKIVAH 80


>gi|283788445|ref|YP_003368310.1| hypothetical protein ROD_49361 [Citrobacter rodentium ICC168]
 gi|282951899|emb|CBG91617.1| conserved hypothetical protein [Citrobacter rodentium ICC168]
          Length = 88

 Score = 63.9 bits (155), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 21/71 (29%), Positives = 34/71 (47%), Gaps = 1/71 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          +I +   RRG RE+D+ +  F +H    LS  E  +   ++E DD +LF W     KP +
Sbjct: 8  RIHW-ACRRGMRELDISIMPFFEHEYDTLSDAEKRIFVRLLECDDPDLFNWLMNHGKPAD 66

Query: 71 YLRTPIFKKIY 81
               + + I 
Sbjct: 67 AELEQMVRLIQ 77


>gi|225075120|ref|ZP_03718319.1| hypothetical protein NEIFLAOT_00119 [Neisseria flavescens
          NRL30031/H210]
 gi|241760393|ref|ZP_04758488.1| TPR repeat region family protein [Neisseria flavescens SK114]
 gi|261379701|ref|ZP_05984274.1| TPR repeat protein [Neisseria subflava NJ9703]
 gi|319637653|ref|ZP_07992419.1| hypothetical protein HMPREF0604_00042 [Neisseria mucosa C102]
 gi|224953604|gb|EEG34813.1| hypothetical protein NEIFLAOT_00119 [Neisseria flavescens
          NRL30031/H210]
 gi|241319271|gb|EER55749.1| TPR repeat region family protein [Neisseria flavescens SK114]
 gi|284797365|gb|EFC52712.1| TPR repeat protein [Neisseria subflava NJ9703]
 gi|317400808|gb|EFV81463.1| hypothetical protein HMPREF0604_00042 [Neisseria mucosa C102]
          Length = 82

 Score = 63.9 bits (155), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 24/77 (31%), Positives = 36/77 (46%), Gaps = 1/77 (1%)

Query: 6  NLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGM 65
          ++  RKI ++  RRG  E+DLI G F++     LS  EL+    I+E  D  L     G 
Sbjct: 6  DIAKRKIRFQ-TRRGLLELDLIFGRFMEKEFEHLSDQELSEFSEILEFQDQELLALINGH 64

Query: 66 EKPPEYLRTPIFKKIYD 82
              +    P+ +KI  
Sbjct: 65 SATDKKHLIPMLEKIRQ 81


>gi|323491207|ref|ZP_08096393.1| hypothetical protein VIBR0546_04799 [Vibrio brasiliensis LMG
          20546]
 gi|323314575|gb|EGA67653.1| hypothetical protein VIBR0546_04799 [Vibrio brasiliensis LMG
          20546]
          Length = 86

 Score = 63.9 bits (155), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 20/76 (26%), Positives = 33/76 (43%), Gaps = 1/76 (1%)

Query: 8  QCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEK 67
          Q  +I +   RRG  E+D+++  F +     L   E     S++E DD +LF W  G  +
Sbjct: 6  QKARIKW-ACRRGMLELDVVIMPFFEECFDGLQENEQRDFVSLLECDDPDLFTWIMGHGR 64

Query: 68 PPEYLRTPIFKKIYDY 83
                  +  KI  +
Sbjct: 65 SENLGHASMVDKIVAH 80


>gi|329894323|ref|ZP_08270193.1| YgfY [gamma proteobacterium IMCC3088]
 gi|328923119|gb|EGG30442.1| YgfY [gamma proteobacterium IMCC3088]
          Length = 86

 Score = 63.5 bits (154), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 17/71 (23%), Positives = 31/71 (43%), Gaps = 1/71 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          ++ +   RRG  E+DL+L  FVD     LS+ +    E  +   D +L+ +     +P +
Sbjct: 9  RMRW-AARRGMLELDLLLEPFVDQHYANLSAEDRETFEQFMTCQDQDLYAYLMQRVQPED 67

Query: 71 YLRTPIFKKIY 81
               +   I 
Sbjct: 68 PKFAALVVTIR 78


>gi|316985355|gb|EFV64304.1| conserved hypothetical protein [Neisseria meningitidis H44/76]
 gi|325130097|gb|EGC52881.1| TPR repeat protein [Neisseria meningitidis OX99.30304]
 gi|325132165|gb|EGC54861.1| TPR repeat protein [Neisseria meningitidis M6190]
 gi|325134131|gb|EGC56783.1| TPR repeat protein [Neisseria meningitidis M13399]
 gi|325136112|gb|EGC58721.1| TPR repeat protein [Neisseria meningitidis M0579]
 gi|325138097|gb|EGC60670.1| TPR repeat protein [Neisseria meningitidis ES14902]
 gi|325142227|gb|EGC64645.1| TPR repeat protein [Neisseria meningitidis 961-5945]
 gi|325198185|gb|ADY93641.1| TPR repeat protein [Neisseria meningitidis G2136]
 gi|325202260|gb|ADY97714.1| TPR repeat protein [Neisseria meningitidis M01-240149]
 gi|325204024|gb|ADY99477.1| TPR repeat protein [Neisseria meningitidis M01-240355]
 gi|325206217|gb|ADZ01670.1| TPR repeat protein [Neisseria meningitidis M04-240196]
 gi|325207987|gb|ADZ03439.1| TPR repeat protein [Neisseria meningitidis NZ-05/33]
          Length = 81

 Score = 63.5 bits (154), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 24/76 (31%), Positives = 37/76 (48%), Gaps = 1/76 (1%)

Query: 6  NLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGM 65
          ++  RKI ++  RRG  E+DLI G F++     LS  EL+    I+E  D  L     G 
Sbjct: 5  DIAKRKIRFQ-TRRGLLELDLIFGRFMEKEFEHLSDKELSEFSEILEFQDQELLALINGH 63

Query: 66 EKPPEYLRTPIFKKIY 81
           +  +    P+ +KI 
Sbjct: 64 SETDKGHLIPMLEKIR 79


>gi|271499206|ref|YP_003332231.1| hypothetical protein Dd586_0633 [Dickeya dadantii Ech586]
 gi|270342761|gb|ACZ75526.1| protein of unknown function DUF339 [Dickeya dadantii Ech586]
          Length = 90

 Score = 63.5 bits (154), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 18/65 (27%), Positives = 33/65 (50%)

Query: 4  NMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFT 63
          NM++  +  ++   RRG RE+D+ +  F +H    LS  +      +++ DD +LF W  
Sbjct: 2  NMDINNKARIHWACRRGMRELDISIMPFFEHEYDTLSDDDKQQFIRLLQCDDPDLFNWLM 61

Query: 64 GMEKP 68
             +P
Sbjct: 62 NHGEP 66


>gi|163802949|ref|ZP_02196836.1| hypothetical protein 1103602000581_AND4_13818 [Vibrio sp. AND4]
 gi|159173239|gb|EDP58067.1| hypothetical protein AND4_13818 [Vibrio sp. AND4]
          Length = 86

 Score = 63.5 bits (154), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 17/73 (23%), Positives = 33/73 (45%), Gaps = 1/73 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          +I +   RRG  E+D+++  F +     L+  E     ++++ DD +LF W  G  +   
Sbjct: 9  RIKW-ACRRGMLELDVVIMPFFEECFDALNEQEQRDFVALLDCDDPDLFTWVMGHGRSEN 67

Query: 71 YLRTPIFKKIYDY 83
               +  KI  +
Sbjct: 68 LGHASMVDKIVAH 80


>gi|15837676|ref|NP_298364.1| hypothetical protein XF1074 [Xylella fastidiosa 9a5c]
 gi|81175059|sp|Q9PEF4|Y1074_XYLFA RecName: Full=UPF0350 protein XF_1074
 gi|9106024|gb|AAF83884.1|AE003944_1 conserved hypothetical protein [Xylella fastidiosa 9a5c]
          Length = 97

 Score = 63.5 bits (154), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 17/81 (20%), Positives = 34/81 (41%), Gaps = 1/81 (1%)

Query: 2  KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
            +   +  K+ +R  RRG RE+D +   ++ H   + S  E  +    ++ +D  L++W
Sbjct: 15 TMDEPAELNKLRWRS-RRGMRELDHLFDRYLSHRWAQASEAERGVFLRFLDCEDDKLWRW 73

Query: 62 FTGMEKPPEYLRTPIFKKIYD 82
            G E   +     +   I  
Sbjct: 74 LMGYEVCQDASFAALIVTIRA 94


>gi|15676845|ref|NP_273990.1| hypothetical protein NMB0952 [Neisseria meningitidis MC58]
 gi|121634754|ref|YP_974999.1| hypothetical protein NMC0929 [Neisseria meningitidis FAM18]
 gi|161869865|ref|YP_001599034.1| hypothetical protein NMCC_0896 [Neisseria meningitidis 053442]
 gi|218768036|ref|YP_002342548.1| hypothetical protein NMA1147 [Neisseria meningitidis Z2491]
 gi|254804835|ref|YP_003083056.1| hypothetical protein NMO_0849 [Neisseria meningitidis alpha14]
 gi|304387743|ref|ZP_07369923.1| TPR repeat protein [Neisseria meningitidis ATCC 13091]
 gi|50513319|pdb|1PUZ|A Chain A, Solution Nmr Structure Of Protein Nma1147 From Neisseria
          Meningitidis. Northeast Structural Genomics Consortium
          Target Mr19
 gi|7226191|gb|AAF41358.1| conserved hypothetical protein [Neisseria meningitidis MC58]
 gi|120866460|emb|CAM10206.1| hypothetical protein NMC0929 [Neisseria meningitidis FAM18]
 gi|121052044|emb|CAM08353.1| hypothetical protein NMA1147 [Neisseria meningitidis Z2491]
 gi|161595418|gb|ABX73078.1| conserved hypothetical protein [Neisseria meningitidis 053442]
 gi|254668377|emb|CBA05473.1| conserved hypothetical protein [Neisseria meningitidis alpha14]
 gi|254671325|emb|CBA08728.1| conserved hypothetical protein [Neisseria meningitidis alpha153]
 gi|254672876|emb|CBA07140.1| conserved hypothetical protein [Neisseria meningitidis alpha275]
 gi|261392700|emb|CAX50273.1| conserved hypothetical TPR-containing protein [Neisseria
          meningitidis 8013]
 gi|304338219|gb|EFM04349.1| TPR repeat protein [Neisseria meningitidis ATCC 13091]
 gi|308389609|gb|ADO31929.1| hypothetical protein NMBB_1677 [Neisseria meningitidis alpha710]
 gi|319410285|emb|CBY90627.1| conserved hypothetical TPR-containing protein [Neisseria
          meningitidis WUE 2594]
 gi|325128089|gb|EGC50984.1| TPR repeat protein [Neisseria meningitidis N1568]
 gi|325140158|gb|EGC62685.1| TPR repeat protein [Neisseria meningitidis CU385]
 gi|325144256|gb|EGC66561.1| TPR repeat protein [Neisseria meningitidis M01-240013]
 gi|325200363|gb|ADY95818.1| TPR repeat protein [Neisseria meningitidis H44/76]
          Length = 82

 Score = 63.1 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 24/76 (31%), Positives = 37/76 (48%), Gaps = 1/76 (1%)

Query: 6  NLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGM 65
          ++  RKI ++  RRG  E+DLI G F++     LS  EL+    I+E  D  L     G 
Sbjct: 6  DIAKRKIRFQ-TRRGLLELDLIFGRFMEKEFEHLSDKELSEFSEILEFQDQELLALINGH 64

Query: 66 EKPPEYLRTPIFKKIY 81
           +  +    P+ +KI 
Sbjct: 65 SETDKGHLIPMLEKIR 80


>gi|84995264|ref|XP_952354.1| hypothetical protein [Theileria annulata]
 gi|65302515|emb|CAI74622.1| hypothetical protein TA12770 [Theileria annulata]
          Length = 118

 Score = 63.1 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 17/83 (20%), Positives = 39/83 (46%), Gaps = 5/83 (6%)

Query: 6   NLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGM 65
           +L+ +K+++R    G +E+DLIL  F+ H    L        ES+++ +  +++    G 
Sbjct: 37  DLRAKKLIFRAKNTGMKELDLILSDFIRHNPDVL-ESHHQEFESLLDMETCHIYDIVMGR 95

Query: 66  EKPPEYLRTPIFKKIYDYYSNNL 88
                     ++++I D+    +
Sbjct: 96  T----RHDLSLYRRICDFALKKV 114


>gi|261377707|ref|ZP_05982280.1| TPR repeat protein [Neisseria cinerea ATCC 14685]
 gi|269145980|gb|EEZ72398.1| TPR repeat protein [Neisseria cinerea ATCC 14685]
          Length = 82

 Score = 63.1 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 24/77 (31%), Positives = 36/77 (46%), Gaps = 1/77 (1%)

Query: 6  NLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGM 65
          ++  RKI ++  RRG  E+DLI G F++     LS  EL+    I+E  D  L     G 
Sbjct: 6  DIAKRKIRFQ-TRRGLLELDLIFGRFMEKEFEHLSDQELSEFSEILEFQDQELLALINGH 64

Query: 66 EKPPEYLRTPIFKKIYD 82
              +    P+ +KI  
Sbjct: 65 SVTDKKHLIPMLEKIRQ 81


>gi|114330868|ref|YP_747090.1| hypothetical protein Neut_0862 [Nitrosomonas eutropha C91]
 gi|114307882|gb|ABI59125.1| protein of unknown function DUF339 [Nitrosomonas eutropha C91]
          Length = 77

 Score = 63.1 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 17/75 (22%), Positives = 36/75 (48%), Gaps = 1/75 (1%)

Query: 8  QCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEK 67
             ++ +RC RRG  E+D++L  F+D    +L   +  + E+++   D +L+        
Sbjct: 3  HQARMRWRC-RRGMLELDIVLLRFMDAHYEQLDEQQHELFEALLTYPDHDLWNMIARNTG 61

Query: 68 PPEYLRTPIFKKIYD 82
           P+    PI + + +
Sbjct: 62 VPDEAFRPILRLLQE 76


>gi|309380085|emb|CBX21496.1| unnamed protein product [Neisseria lactamica Y92-1009]
          Length = 81

 Score = 63.1 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 24/76 (31%), Positives = 36/76 (47%), Gaps = 1/76 (1%)

Query: 6  NLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGM 65
          ++  RKI ++  RRG  E+DLI G F++     LS  EL+    I+E  D  L     G 
Sbjct: 5  DIAKRKIRFQ-TRRGLLELDLIFGRFMEKEFEHLSDKELSEFSEILEFQDQELLALINGH 63

Query: 66 EKPPEYLRTPIFKKIY 81
              +    P+ +KI 
Sbjct: 64 SVTDKGHLIPMLEKIR 79


>gi|153835741|ref|ZP_01988408.1| protein YgfY [Vibrio harveyi HY01]
 gi|156975801|ref|YP_001446708.1| hypothetical protein VIBHAR_03545 [Vibrio harveyi ATCC BAA-1116]
 gi|269960414|ref|ZP_06174787.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
 gi|148867600|gb|EDL66904.1| protein YgfY [Vibrio harveyi HY01]
 gi|156527395|gb|ABU72481.1| hypothetical protein VIBHAR_03545 [Vibrio harveyi ATCC BAA-1116]
 gi|269834841|gb|EEZ88927.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
          Length = 86

 Score = 63.1 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 19/73 (26%), Positives = 33/73 (45%), Gaps = 1/73 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          +I +   RRG  E+D+++  F +     L+  E     S++E DD +LF W  G  +   
Sbjct: 9  RIKW-ACRRGMLELDVVIMPFFEECFDALNEQEQRDFVSLLECDDPDLFTWVMGHGRSEN 67

Query: 71 YLRTPIFKKIYDY 83
               +  KI  +
Sbjct: 68 LGHASMVDKIVAH 80


>gi|302914832|ref|XP_003051227.1| hypothetical protein NECHADRAFT_8505 [Nectria haematococca mpVI
          77-13-4]
 gi|256732165|gb|EEU45514.1| hypothetical protein NECHADRAFT_8505 [Nectria haematococca mpVI
          77-13-4]
          Length = 172

 Score = 63.1 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 17/65 (26%), Positives = 36/65 (55%)

Query: 3  KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWF 62
          ++   +  ++VY+  +RGT E DL+L +F    +  L    L   + +++E+D +++ W 
Sbjct: 30 EDDATKRARLVYQSRKRGTLESDLLLSTFASKHLPTLPPKLLDQYDLLLDENDWDIYYWA 89

Query: 63 TGMEK 67
          T  E+
Sbjct: 90 TQKEE 94


>gi|238786190|ref|ZP_04630140.1| hypothetical protein yberc0001_38460 [Yersinia bercovieri ATCC
          43970]
 gi|238787326|ref|ZP_04631125.1| hypothetical protein yfred0001_33140 [Yersinia frederiksenii ATCC
          33641]
 gi|238712907|gb|EEQ04969.1| hypothetical protein yberc0001_38460 [Yersinia bercovieri ATCC
          43970]
 gi|238724588|gb|EEQ16229.1| hypothetical protein yfred0001_33140 [Yersinia frederiksenii ATCC
          33641]
          Length = 88

 Score = 63.1 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 20/72 (27%), Positives = 34/72 (47%), Gaps = 1/72 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          +I +   RRG RE+D+ +  F ++    LS  E  +   ++E DD +LF W     +P +
Sbjct: 8  RIHW-ACRRGMRELDISIMPFFEYEYDGLSDNEKQVFIRLLECDDPDLFNWLMNHGEPQD 66

Query: 71 YLRTPIFKKIYD 82
               + K I  
Sbjct: 67 SELRQMVKLIQA 78


>gi|22127158|ref|NP_670581.1| hypothetical protein y3282 [Yersinia pestis KIM 10]
 gi|45443329|ref|NP_994868.1| hypothetical protein YP_3594 [Yersinia pestis biovar Microtus
          str. 91001]
 gi|51597484|ref|YP_071675.1| hypothetical protein YPTB3173 [Yersinia pseudotuberculosis IP
          32953]
 gi|108806368|ref|YP_650284.1| hypothetical protein YPA_0371 [Yersinia pestis Antiqua]
 gi|108813257|ref|YP_649024.1| hypothetical protein YPN_3097 [Yersinia pestis Nepal516]
 gi|145597924|ref|YP_001162000.1| hypothetical protein YPDSF_0618 [Yersinia pestis Pestoides F]
 gi|150260091|ref|ZP_01916819.1| hypothetical protein YPE_2369 [Yersinia pestis CA88-4125]
 gi|153947508|ref|YP_001399857.1| hypothetical protein YpsIP31758_0873 [Yersinia pseudotuberculosis
          IP 31758]
 gi|162418750|ref|YP_001608148.1| hypothetical protein YpAngola_A3841 [Yersinia pestis Angola]
 gi|165924892|ref|ZP_02220724.1| conserved hypothetical protein [Yersinia pestis biovar Orientalis
          str. F1991016]
 gi|165937211|ref|ZP_02225775.1| conserved hypothetical protein [Yersinia pestis biovar Orientalis
          str. IP275]
 gi|166010357|ref|ZP_02231255.1| conserved hypothetical protein [Yersinia pestis biovar Antiqua
          str. E1979001]
 gi|166212757|ref|ZP_02238792.1| conserved hypothetical protein [Yersinia pestis biovar Antiqua
          str. B42003004]
 gi|167400077|ref|ZP_02305595.1| conserved hypothetical protein [Yersinia pestis biovar Antiqua
          str. UG05-0454]
 gi|167418999|ref|ZP_02310752.1| conserved hypothetical protein [Yersinia pestis biovar Orientalis
          str. MG05-1020]
 gi|167425228|ref|ZP_02316981.1| conserved hypothetical protein [Yersinia pestis biovar
          Mediaevalis str. K1973002]
 gi|167467687|ref|ZP_02332391.1| hypothetical protein YpesF_07269 [Yersinia pestis FV-1]
 gi|170023125|ref|YP_001719630.1| hypothetical protein YPK_0876 [Yersinia pseudotuberculosis YPIII]
 gi|186896604|ref|YP_001873716.1| hypothetical protein YPTS_3304 [Yersinia pseudotuberculosis
          PB1/+]
 gi|218928071|ref|YP_002345946.1| hypothetical protein YPO0897 [Yersinia pestis CO92]
 gi|229837584|ref|ZP_04457746.1| conserved protein [Yersinia pestis Pestoides A]
 gi|229840807|ref|ZP_04460966.1| conserved protein [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|229842634|ref|ZP_04462789.1| conserved protein [Yersinia pestis biovar Orientalis str. India
          195]
 gi|229903713|ref|ZP_04518826.1| conserved protein [Yersinia pestis Nepal516]
 gi|270487492|ref|ZP_06204566.1| TPR repeat region-containing protein [Yersinia pestis KIM D27]
 gi|81175080|sp|Q666S3|Y3173_YERPS RecName: Full=UPF0350 protein YPTB3173
 gi|81175093|sp|Q8ZHJ5|Y897_YERPE RecName: Full=UPF0350 protein YPO0897/y3282/YP_3594
 gi|21960220|gb|AAM86832.1|AE013929_5 hypothetical protein y3282 [Yersinia pestis KIM 10]
 gi|45438198|gb|AAS63745.1| conserved hypothetical protein [Yersinia pestis biovar Microtus
          str. 91001]
 gi|51590766|emb|CAH22411.1| Conserved hypothetical protein [Yersinia pseudotuberculosis IP
          32953]
 gi|108776905|gb|ABG19424.1| hypothetical protein YPN_3097 [Yersinia pestis Nepal516]
 gi|108778281|gb|ABG12339.1| hypothetical protein YPA_0371 [Yersinia pestis Antiqua]
 gi|115346682|emb|CAL19565.1| conserved hypothetical protein [Yersinia pestis CO92]
 gi|145209620|gb|ABP39027.1| hypothetical protein YPDSF_0618 [Yersinia pestis Pestoides F]
 gi|149289499|gb|EDM39576.1| hypothetical protein YPE_2369 [Yersinia pestis CA88-4125]
 gi|152959003|gb|ABS46464.1| conserved hypothetical protein [Yersinia pseudotuberculosis IP
          31758]
 gi|162351565|gb|ABX85513.1| conserved hypothetical protein [Yersinia pestis Angola]
 gi|165914685|gb|EDR33298.1| conserved hypothetical protein [Yersinia pestis biovar Orientalis
          str. IP275]
 gi|165923092|gb|EDR40243.1| conserved hypothetical protein [Yersinia pestis biovar Orientalis
          str. F1991016]
 gi|165990843|gb|EDR43144.1| conserved hypothetical protein [Yersinia pestis biovar Antiqua
          str. E1979001]
 gi|166206049|gb|EDR50529.1| conserved hypothetical protein [Yersinia pestis biovar Antiqua
          str. B42003004]
 gi|166962993|gb|EDR59014.1| conserved hypothetical protein [Yersinia pestis biovar Orientalis
          str. MG05-1020]
 gi|167050785|gb|EDR62193.1| conserved hypothetical protein [Yersinia pestis biovar Antiqua
          str. UG05-0454]
 gi|167055628|gb|EDR65412.1| conserved hypothetical protein [Yersinia pestis biovar
          Mediaevalis str. K1973002]
 gi|169749659|gb|ACA67177.1| protein of unknown function DUF339 [Yersinia pseudotuberculosis
          YPIII]
 gi|186699630|gb|ACC90259.1| protein of unknown function DUF339 [Yersinia pseudotuberculosis
          PB1/+]
 gi|229679483|gb|EEO75586.1| conserved protein [Yersinia pestis Nepal516]
 gi|229690944|gb|EEO82998.1| conserved protein [Yersinia pestis biovar Orientalis str. India
          195]
 gi|229697173|gb|EEO87220.1| conserved protein [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|229704272|gb|EEO91283.1| conserved protein [Yersinia pestis Pestoides A]
 gi|270335996|gb|EFA46773.1| TPR repeat region-containing protein [Yersinia pestis KIM D27]
 gi|320014026|gb|ADV97597.1| conserved protein [Yersinia pestis biovar Medievalis str. Harbin
          35]
          Length = 88

 Score = 63.1 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 20/72 (27%), Positives = 33/72 (45%), Gaps = 1/72 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          +I +   RRG RE+D+ +  F ++    LS  E      ++E DD +LF W     +P +
Sbjct: 8  RIHW-ACRRGMRELDISIMPFFEYEYDSLSDNEKQAFIRLLECDDPDLFNWLMNHGEPQD 66

Query: 71 YLRTPIFKKIYD 82
               + K I  
Sbjct: 67 SELYQMVKLIQS 78


>gi|307129425|ref|YP_003881441.1| hypothetical protein Dda3937_02301 [Dickeya dadantii 3937]
 gi|306526954|gb|ADM96884.1| conserved protein [Dickeya dadantii 3937]
          Length = 88

 Score = 63.1 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 18/77 (23%), Positives = 33/77 (42%), Gaps = 1/77 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          +I +   RRG RE+D+ +  F +H    LS  +      +++ DD +LF W     +P +
Sbjct: 8  RIHW-ACRRGMRELDISIMPFFEHEYDTLSDDDKQQFIRLLQCDDPDLFNWLMNHGEPVD 66

Query: 71 YLRTPIFKKIYDYYSNN 87
               +   I     + 
Sbjct: 67 PALKRMVSLIQTRNKDR 83


>gi|257093963|ref|YP_003167604.1| hypothetical protein CAP2UW1_2386 [Candidatus Accumulibacter
          phosphatis clade IIA str. UW-1]
 gi|257046487|gb|ACV35675.1| protein of unknown function DUF339 [Candidatus Accumulibacter
          phosphatis clade IIA str. UW-1]
          Length = 84

 Score = 63.1 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 17/75 (22%), Positives = 35/75 (46%)

Query: 8  QCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEK 67
          +  ++ +RC RR   EMDL+LG F+D     L+  +      + + +D  L+    G  +
Sbjct: 6  KLNRLRWRCTRRAMLEMDLLLGEFLDRLYPSLTPPQADAFVILADMEDLELWPLVNGSRE 65

Query: 68 PPEYLRTPIFKKIYD 82
            + ++  +   + D
Sbjct: 66 SSDPVQAEVLALLRD 80


>gi|117925049|ref|YP_865666.1| hypothetical protein Mmc1_1752 [Magnetococcus sp. MC-1]
 gi|117608805|gb|ABK44260.1| hypothetical protein Mmc1_1752 [Magnetococcus sp. MC-1]
          Length = 99

 Score = 63.1 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 16/83 (19%), Positives = 38/83 (45%)

Query: 4  NMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFT 63
           +    R++ Y   RR   E +L+   F+D  I +          +++   D++L  W  
Sbjct: 11 TLEQLKRRVTYEVTRRSMFEAELLFQRFLDAEISKFDETLCEAFLNLLVYPDADLLDWMA 70

Query: 64 GMEKPPEYLRTPIFKKIYDYYSN 86
          G+++PP  +   + ++I  ++ +
Sbjct: 71 GIKEPPVGVDLQLLQRINHHWPH 93


>gi|152995126|ref|YP_001339961.1| hypothetical protein Mmwyl1_1095 [Marinomonas sp. MWYL1]
 gi|150836050|gb|ABR70026.1| protein of unknown function DUF339 [Marinomonas sp. MWYL1]
          Length = 91

 Score = 62.7 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 20/82 (24%), Positives = 35/82 (42%), Gaps = 3/82 (3%)

Query: 1  MKKNMNLQC-RKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLF 59
          M +  N    +++  +C RRG  E+D++L  F+    L L   +     +++  +D +LF
Sbjct: 1  MTETKNSLSFKRLKMQC-RRGMLELDVLLEPFLAEVYLTLEEEDKQRFVNLLALEDQDLF 59

Query: 60 KWFTGMEKPPEYLRTPIFKKIY 81
           WF      PE         I 
Sbjct: 60 PWFM-QSAVPEDPDHARIVNII 80


>gi|261401139|ref|ZP_05987264.1| TPR repeat protein [Neisseria lactamica ATCC 23970]
 gi|296314768|ref|ZP_06864709.1| TPR repeat protein [Neisseria polysaccharea ATCC 43768]
 gi|313668605|ref|YP_004048889.1| hypothetical protein NLA_13080 [Neisseria lactamica ST-640]
 gi|269208917|gb|EEZ75372.1| TPR repeat protein [Neisseria lactamica ATCC 23970]
 gi|296838412|gb|EFH22350.1| TPR repeat protein [Neisseria polysaccharea ATCC 43768]
 gi|313006067|emb|CBN87528.1| conserved hypothetical protein [Neisseria lactamica 020-06]
          Length = 82

 Score = 62.7 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 24/76 (31%), Positives = 36/76 (47%), Gaps = 1/76 (1%)

Query: 6  NLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGM 65
          ++  RKI ++  RRG  E+DLI G F++     LS  EL+    I+E  D  L     G 
Sbjct: 6  DIAKRKIRFQ-TRRGLLELDLIFGRFMEKEFEHLSDKELSEFSEILEFQDQELLALINGH 64

Query: 66 EKPPEYLRTPIFKKIY 81
              +    P+ +KI 
Sbjct: 65 SVTDKGHLIPMLEKIR 80


>gi|94500783|ref|ZP_01307312.1| hypothetical protein RED65_03570 [Oceanobacter sp. RED65]
 gi|94427105|gb|EAT12086.1| hypothetical protein RED65_03570 [Oceanobacter sp. RED65]
          Length = 93

 Score = 62.7 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 20/84 (23%), Positives = 43/84 (51%), Gaps = 1/84 (1%)

Query: 2  KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
          ++++  + +++ +   RRG  E+D++L  F++    +LS  +     ++++ +D  LFKW
Sbjct: 9  EQDLATEKKRLWWHS-RRGMLELDVLLLPFLEEVYDDLSEEDKARYRNLLDVEDPELFKW 67

Query: 62 FTGMEKPPEYLRTPIFKKIYDYYS 85
          F   EKP +     I + I     
Sbjct: 68 FMQKEKPSDPDHRAIVEIILARVQ 91


>gi|119476431|ref|ZP_01616782.1| hypothetical protein GP2143_08269 [marine gamma proteobacterium
          HTCC2143]
 gi|119450295|gb|EAW31530.1| hypothetical protein GP2143_08269 [marine gamma proteobacterium
          HTCC2143]
          Length = 84

 Score = 62.7 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 24/77 (31%), Positives = 37/77 (48%), Gaps = 1/77 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          +I +   RRG  E+DLILG FV+H    L  +       +++ +DS+LF WF G   P +
Sbjct: 9  RIRW-ASRRGMLELDLILGPFVEHCYRGLDDINRQRYIDLLDGEDSDLFSWFLGRGVPED 67

Query: 71 YLRTPIFKKIYDYYSNN 87
               I  +I  +    
Sbjct: 68 PELRCIVDQINQFTRKK 84


>gi|317493829|ref|ZP_07952246.1| hypothetical protein HMPREF0864_03014 [Enterobacteriaceae
          bacterium 9_2_54FAA]
 gi|316918156|gb|EFV39498.1| hypothetical protein HMPREF0864_03014 [Enterobacteriaceae
          bacterium 9_2_54FAA]
          Length = 88

 Score = 62.7 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 20/83 (24%), Positives = 37/83 (44%)

Query: 5  MNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTG 64
          M+++ +  ++   RRG RE+D+ +  F +H    LS  +      ++E DD +LF W   
Sbjct: 1  MDIENKSRIHWACRRGMRELDISIMPFFEHEYDSLSDTDKQTFVRLLECDDPDLFNWLMN 60

Query: 65 MEKPPEYLRTPIFKKIYDYYSNN 87
             P +     + K I     + 
Sbjct: 61 HGSPKDPELAHMVKLIQTRNKDR 83


>gi|238752997|ref|ZP_04614456.1| hypothetical protein yrohd0001_18630 [Yersinia rohdei ATCC 43380]
 gi|238708785|gb|EEQ01044.1| hypothetical protein yrohd0001_18630 [Yersinia rohdei ATCC 43380]
          Length = 88

 Score = 62.7 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 20/72 (27%), Positives = 33/72 (45%), Gaps = 1/72 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          +I +   RRG RE+D+ +  F ++    LS  E      ++E DD +LF W     +P +
Sbjct: 8  RIHW-ACRRGMRELDISIMPFFEYEYDGLSESEKQTFIRLLECDDPDLFNWLMNHGEPQD 66

Query: 71 YLRTPIFKKIYD 82
               + K I  
Sbjct: 67 SELRQMVKLIQT 78


>gi|61680288|pdb|1X6I|A Chain A, Crystal Structure Of Ygfy From Escherichia Coli
 gi|61680289|pdb|1X6I|B Chain B, Crystal Structure Of Ygfy From Escherichia Coli
 gi|61680290|pdb|1X6J|A Chain A, Crystal Structure Of Ygfy From Escherichia Coli
          Length = 91

 Score = 62.3 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 20/72 (27%), Positives = 33/72 (45%), Gaps = 2/72 (2%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          +I +   RRG RE+D+ +  F +H    LS  E  +   ++E DD +LF W     K P 
Sbjct: 11 RIHW-ACRRGMRELDISIMPFFEHEYDSLSDDEKRIFIRLLECDDPDLFNWLMNHGK-PA 68

Query: 71 YLRTPIFKKIYD 82
               +  ++  
Sbjct: 69 DAELEMMVRLIQ 80


>gi|291385936|ref|XP_002709367.1| PREDICTED: succinate dehydrogenase complex assembly factor 2-like
           [Oryctolagus cuniculus]
          Length = 151

 Score = 62.3 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 14/78 (17%), Positives = 34/78 (43%), Gaps = 3/78 (3%)

Query: 12  IVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEE--DDSNLFKWFTGMEKPP 69
           ++Y   ++GT E  ++L  F    +  ++  +L + + +     +D  ++ W T  +  P
Sbjct: 56  LLYESRKKGTLENYILLSFFAKEHLH-MTEKQLNLYDCLTNVHRNDWGIYYWATEAKPAP 114

Query: 70  EYLRTPIFKKIYDYYSNN 87
           E     +   + D+  N 
Sbjct: 115 EIFENEVMALLGDFAKNK 132


>gi|239998845|ref|ZP_04718769.1| hypothetical protein Ngon3_05096 [Neisseria gonorrhoeae 35/02]
 gi|240014240|ref|ZP_04721153.1| hypothetical protein NgonD_06282 [Neisseria gonorrhoeae DGI18]
 gi|240016676|ref|ZP_04723216.1| hypothetical protein NgonFA_05848 [Neisseria gonorrhoeae FA6140]
 gi|240080865|ref|ZP_04725408.1| hypothetical protein NgonF_06081 [Neisseria gonorrhoeae FA19]
 gi|240112771|ref|ZP_04727261.1| hypothetical protein NgonM_04167 [Neisseria gonorrhoeae MS11]
 gi|240115522|ref|ZP_04729584.1| hypothetical protein NgonPID1_04615 [Neisseria gonorrhoeae PID18]
 gi|240117817|ref|ZP_04731879.1| hypothetical protein NgonPID_05022 [Neisseria gonorrhoeae PID1]
 gi|240121803|ref|ZP_04734765.1| hypothetical protein NgonPI_08587 [Neisseria gonorrhoeae PID24-1]
 gi|240123372|ref|ZP_04736328.1| hypothetical protein NgonP_05425 [Neisseria gonorrhoeae PID332]
 gi|240125620|ref|ZP_04738506.1| hypothetical protein NgonSK_05273 [Neisseria gonorrhoeae
          SK-92-679]
 gi|240128076|ref|ZP_04740737.1| hypothetical protein NgonS_05442 [Neisseria gonorrhoeae
          SK-93-1035]
          Length = 81

 Score = 62.3 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 24/76 (31%), Positives = 37/76 (48%), Gaps = 1/76 (1%)

Query: 6  NLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGM 65
          ++  RKI ++  RRG  E+DLI G F++     LS  EL+    I+E  D  L     G 
Sbjct: 5  DIAKRKIRFQ-TRRGLLELDLIFGRFMEKEFEHLSDKELSEFSEILEFQDQELLALIHGH 63

Query: 66 EKPPEYLRTPIFKKIY 81
           +  +    P+ +KI 
Sbjct: 64 SETDKGHLIPMLEKIR 79


>gi|149910164|ref|ZP_01898810.1| TPR repeat protein [Moritella sp. PE36]
 gi|149806750|gb|EDM66714.1| TPR repeat protein [Moritella sp. PE36]
          Length = 83

 Score = 62.3 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 19/75 (25%), Positives = 35/75 (46%), Gaps = 1/75 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          ++ +   RRG  E+D++   FVD    +LS  +  + + ++E +D  LF W  G +K  +
Sbjct: 9  RLRW-ACRRGMLELDVLFRPFVDEAYDDLSDEDKFIFQRLLEGEDPELFAWAMGHKKCGD 67

Query: 71 YLRTPIFKKIYDYYS 85
               +  KI     
Sbjct: 68 PELAYMMDKIVSRVK 82


>gi|331648643|ref|ZP_08349731.1| putative cytoplasmic protein [Escherichia coli M605]
 gi|281179902|dbj|BAI56232.1| conserved hypothetical protein [Escherichia coli SE15]
 gi|330908929|gb|EGH37443.1| ygfY [Escherichia coli AA86]
 gi|331042390|gb|EGI14532.1| putative cytoplasmic protein [Escherichia coli M605]
          Length = 88

 Score = 62.3 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 20/78 (25%), Positives = 35/78 (44%), Gaps = 1/78 (1%)

Query: 5  MNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTG 64
          M++  +  ++   RRG RE+D+ +  F +H    LS  E      ++E DD +LF W   
Sbjct: 1  MDINNKARIHWACRRGMRELDISIMPFFEHEYDSLSDDEKRTFIRLLECDDPDLFNWLMN 60

Query: 65 MEKPPEYLRTPIFKKIYD 82
            K P      +  ++  
Sbjct: 61 HGK-PADAELEMMVRLIQ 77


>gi|269101839|ref|ZP_06154536.1| hypothetical protein VDA_001255 [Photobacterium damselae subsp.
          damselae CIP 102761]
 gi|268161737|gb|EEZ40233.1| hypothetical protein VDA_001255 [Photobacterium damselae subsp.
          damselae CIP 102761]
          Length = 86

 Score = 62.3 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 19/79 (24%), Positives = 36/79 (45%), Gaps = 1/79 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          ++ +   RRG  E+D+I+  F +     LS  E     +++  DD +LFKW     +  +
Sbjct: 9  RVKW-ACRRGMLELDVIIMPFFEECFDGLSEQEQQDFIALLGCDDPDLFKWVMNHGRSED 67

Query: 71 YLRTPIFKKIYDYYSNNLD 89
               +  KI  + ++ L 
Sbjct: 68 PALAVMVDKIVAHNNSKLR 86


>gi|238796536|ref|ZP_04640043.1| hypothetical protein ymoll0001_30010 [Yersinia mollaretii ATCC
          43969]
 gi|238719514|gb|EEQ11323.1| hypothetical protein ymoll0001_30010 [Yersinia mollaretii ATCC
          43969]
          Length = 88

 Score = 62.3 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 20/72 (27%), Positives = 34/72 (47%), Gaps = 1/72 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          +I +   RRG RE+D+ +  F ++    LS  E  +   ++E DD +LF W     +P +
Sbjct: 8  RIHW-ACRRGMRELDISIMPFFEYEYDGLSDHEKQVFIRLLECDDPDLFNWLMNHGEPQD 66

Query: 71 YLRTPIFKKIYD 82
               + K I  
Sbjct: 67 SELRQMVKLIQA 78


>gi|260599237|ref|YP_003211808.1| hypothetical protein CTU_34450 [Cronobacter turicensis z3032]
 gi|260218414|emb|CBA33505.1| UPF0350 protein ygfY [Cronobacter turicensis z3032]
          Length = 86

 Score = 62.3 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 20/72 (27%), Positives = 34/72 (47%), Gaps = 1/72 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          +I +   RRG RE+D+ +  F +H    LS  +  +   ++E DD +LF W     KP +
Sbjct: 6  RIHW-ACRRGMRELDISIMPFFEHDYDSLSEEDKRVFVRLLECDDPDLFNWLMNHGKPAD 64

Query: 71 YLRTPIFKKIYD 82
               + + I  
Sbjct: 65 AELARMVELIQQ 76


>gi|24114151|ref|NP_708661.1| hypothetical protein SF2883 [Shigella flexneri 2a str. 301]
 gi|110806800|ref|YP_690320.1| hypothetical protein SFV_2945 [Shigella flexneri 5 str. 8401]
 gi|33301883|sp|Q83JU2|YGFY_SHIFL RecName: Full=UPF0350 protein ygfY
 gi|24053291|gb|AAN44368.1| orf, conserved hypothetical protein [Shigella flexneri 2a str.
          301]
 gi|110616348|gb|ABF05015.1| conserved hypothetical protein [Shigella flexneri 5 str. 8401]
 gi|313647937|gb|EFS12383.1| hypothetical protein SF2457T_3535 [Shigella flexneri 2a str.
          2457T]
 gi|332752934|gb|EGJ83318.1| hypothetical protein SF434370_3112 [Shigella flexneri 4343-70]
 gi|332754705|gb|EGJ85071.1| hypothetical protein SF274771_3474 [Shigella flexneri 2747-71]
 gi|332765828|gb|EGJ96041.1| hypothetical protein SF293071_3386 [Shigella flexneri 2930-71]
 gi|332999670|gb|EGK19255.1| hypothetical protein SFVA6_3817 [Shigella flexneri VA-6]
 gi|332999947|gb|EGK19530.1| hypothetical protein SFK218_3892 [Shigella flexneri K-218]
 gi|333000716|gb|EGK20291.1| hypothetical protein SFK272_3653 [Shigella flexneri K-272]
 gi|333015228|gb|EGK34570.1| hypothetical protein SFK227_3684 [Shigella flexneri K-227]
          Length = 88

 Score = 62.0 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 21/78 (26%), Positives = 36/78 (46%), Gaps = 1/78 (1%)

Query: 5  MNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTG 64
          M++  +  ++   RRG RE+D+ +  F +H    LS  E  +   ++E DD +LF W   
Sbjct: 1  MDINNKARIHWACRRGMRELDISIMPFFEHEYDSLSDDEKRIFIRLLECDDPDLFNWLMN 60

Query: 65 MEKPPEYLRTPIFKKIYD 82
            K P      I  ++  
Sbjct: 61 HGK-PADAELEIMVRLIQ 77


>gi|284922845|emb|CBG35934.1| conserved hypothetical protein [Escherichia coli 042]
          Length = 88

 Score = 62.0 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 21/78 (26%), Positives = 37/78 (47%)

Query: 5  MNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTG 64
          M++  +  ++   RRG RE+D+ +  F +H    LS  E  +   ++E DD +LF W   
Sbjct: 1  MDINNKARIHWACRRGMRELDISIMPFFEHEYDSLSDDEKRIFIRLLECDDPDLFNWLMN 60

Query: 65 MEKPPEYLRTPIFKKIYD 82
            KP +     + + I  
Sbjct: 61 HGKPADEELEMMVRLIQT 78


>gi|59801315|ref|YP_208027.1| hypothetical protein NGO0919 [Neisseria gonorrhoeae FA 1090]
 gi|194098446|ref|YP_002001505.1| hypothetical protein NGK_0880 [Neisseria gonorrhoeae NCCP11945]
 gi|254493631|ref|ZP_05106802.1| conserved hypothetical protein [Neisseria gonorrhoeae 1291]
 gi|260440667|ref|ZP_05794483.1| hypothetical protein NgonDG_06210 [Neisseria gonorrhoeae DGI2]
 gi|268594688|ref|ZP_06128855.1| conserved hypothetical protein [Neisseria gonorrhoeae 35/02]
 gi|268596982|ref|ZP_06131149.1| conserved hypothetical protein [Neisseria gonorrhoeae FA19]
 gi|268598839|ref|ZP_06133006.1| conserved hypothetical protein [Neisseria gonorrhoeae MS11]
 gi|268601197|ref|ZP_06135364.1| conserved hypothetical protein [Neisseria gonorrhoeae PID18]
 gi|268603517|ref|ZP_06137684.1| conserved hypothetical protein [Neisseria gonorrhoeae PID1]
 gi|268681997|ref|ZP_06148859.1| conserved hypothetical protein [Neisseria gonorrhoeae PID332]
 gi|268684209|ref|ZP_06151071.1| conserved hypothetical protein [Neisseria gonorrhoeae SK-92-679]
 gi|268686465|ref|ZP_06153327.1| conserved hypothetical protein [Neisseria gonorrhoeae SK-93-1035]
 gi|291043976|ref|ZP_06569692.1| conserved hypothetical protein [Neisseria gonorrhoeae DGI2]
 gi|293399175|ref|ZP_06643340.1| conserved hypothetical protein [Neisseria gonorrhoeae F62]
 gi|59718210|gb|AAW89615.1| conserved hypothetical protein [Neisseria gonorrhoeae FA 1090]
 gi|193933736|gb|ACF29560.1| Conserved hypothetical protein [Neisseria gonorrhoeae NCCP11945]
 gi|226512671|gb|EEH62016.1| conserved hypothetical protein [Neisseria gonorrhoeae 1291]
 gi|268548077|gb|EEZ43495.1| conserved hypothetical protein [Neisseria gonorrhoeae 35/02]
 gi|268550770|gb|EEZ45789.1| conserved hypothetical protein [Neisseria gonorrhoeae FA19]
 gi|268582970|gb|EEZ47646.1| conserved hypothetical protein [Neisseria gonorrhoeae MS11]
 gi|268585328|gb|EEZ50004.1| conserved hypothetical protein [Neisseria gonorrhoeae PID18]
 gi|268587648|gb|EEZ52324.1| conserved hypothetical protein [Neisseria gonorrhoeae PID1]
 gi|268622281|gb|EEZ54681.1| conserved hypothetical protein [Neisseria gonorrhoeae PID332]
 gi|268624493|gb|EEZ56893.1| conserved hypothetical protein [Neisseria gonorrhoeae SK-92-679]
 gi|268626749|gb|EEZ59149.1| conserved hypothetical protein [Neisseria gonorrhoeae SK-93-1035]
 gi|291012439|gb|EFE04428.1| conserved hypothetical protein [Neisseria gonorrhoeae DGI2]
 gi|291610589|gb|EFF39699.1| conserved hypothetical protein [Neisseria gonorrhoeae F62]
 gi|317164132|gb|ADV07673.1| hypothetical protein NGTW08_0702 [Neisseria gonorrhoeae
          TCDC-NG08107]
          Length = 82

 Score = 62.0 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 24/76 (31%), Positives = 37/76 (48%), Gaps = 1/76 (1%)

Query: 6  NLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGM 65
          ++  RKI ++  RRG  E+DLI G F++     LS  EL+    I+E  D  L     G 
Sbjct: 6  DIAKRKIRFQ-TRRGLLELDLIFGRFMEKEFEHLSDKELSEFSEILEFQDQELLALIHGH 64

Query: 66 EKPPEYLRTPIFKKIY 81
           +  +    P+ +KI 
Sbjct: 65 SETDKGHLIPMLEKIR 80


>gi|16761828|ref|NP_457445.1| hypothetical protein STY3203 [Salmonella enterica subsp. enterica
          serovar Typhi str. CT18]
 gi|16766348|ref|NP_461963.1| hypothetical protein STM3047 [Salmonella enterica subsp. enterica
          serovar Typhimurium str. LT2]
 gi|29143315|ref|NP_806657.1| hypothetical protein t2965 [Salmonella enterica subsp. enterica
          serovar Typhi str. Ty2]
 gi|56414993|ref|YP_152068.1| hypothetical protein SPA2915 [Salmonella enterica subsp. enterica
          serovar Paratyphi A str. ATCC 9150]
 gi|62181557|ref|YP_217974.1| hypothetical protein SC2987 [Salmonella enterica subsp. enterica
          serovar Choleraesuis str. SC-B67]
 gi|161615995|ref|YP_001589959.1| hypothetical protein SPAB_03795 [Salmonella enterica subsp.
          enterica serovar Paratyphi B str. SPB7]
 gi|167550069|ref|ZP_02343826.1| TPR repeat protein [Salmonella enterica subsp. enterica serovar
          Saintpaul str. SARA29]
 gi|167994110|ref|ZP_02575202.1| TPR repeat protein [Salmonella enterica subsp. enterica serovar
          4,[5],12:i:- str. CVM23701]
 gi|168231152|ref|ZP_02656210.1| TPR repeat protein [Salmonella enterica subsp. enterica serovar
          Kentucky str. CDC 191]
 gi|168236106|ref|ZP_02661164.1| TPR repeat protein [Salmonella enterica subsp. enterica serovar
          Schwarzengrund str. SL480]
 gi|168242834|ref|ZP_02667766.1| protein YgfY [Salmonella enterica subsp. enterica serovar
          Heidelberg str. SL486]
 gi|168261791|ref|ZP_02683764.1| TPR repeat protein [Salmonella enterica subsp. enterica serovar
          Hadar str. RI_05P066]
 gi|168463785|ref|ZP_02697702.1| TPR repeat protein [Salmonella enterica subsp. enterica serovar
          Newport str. SL317]
 gi|168823062|ref|ZP_02835062.1| TPR repeat protein [Salmonella enterica subsp. enterica serovar
          Weltevreden str. HI_N05-537]
 gi|194443194|ref|YP_002042298.1| hypothetical protein SNSL254_A3282 [Salmonella enterica subsp.
          enterica serovar Newport str. SL254]
 gi|194451388|ref|YP_002047031.1| hypothetical protein SeHA_C3279 [Salmonella enterica subsp.
          enterica serovar Heidelberg str. SL476]
 gi|194470206|ref|ZP_03076190.1| TPR repeat protein [Salmonella enterica subsp. enterica serovar
          Kentucky str. CVM29188]
 gi|194472028|ref|ZP_03078012.1| TPR repeat protein [Salmonella enterica subsp. enterica serovar
          Kentucky str. CVM29188]
 gi|194736338|ref|YP_002115996.1| hypothetical protein SeSA_A3216 [Salmonella enterica subsp.
          enterica serovar Schwarzengrund str. CVM19633]
 gi|197250464|ref|YP_002147959.1| hypothetical protein SeAg_B3204 [Salmonella enterica subsp.
          enterica serovar Agona str. SL483]
 gi|197264493|ref|ZP_03164567.1| TPR repeat protein [Salmonella enterica subsp. enterica serovar
          Saintpaul str. SARA23]
 gi|197363922|ref|YP_002143559.1| hypothetical protein SSPA2717 [Salmonella enterica subsp.
          enterica serovar Paratyphi A str. AKU_12601]
 gi|198244586|ref|YP_002217024.1| hypothetical protein SeD_A3384 [Salmonella enterica subsp.
          enterica serovar Dublin str. CT_02021853]
 gi|200387067|ref|ZP_03213679.1| protein YgfY [Salmonella enterica subsp. enterica serovar Virchow
          str. SL491]
 gi|204928371|ref|ZP_03219571.1| TPR repeat protein [Salmonella enterica subsp. enterica serovar
          Javiana str. GA_MM04042433]
 gi|205353971|ref|YP_002227772.1| hypothetical protein SG2942 [Salmonella enterica subsp. enterica
          serovar Gallinarum str. 287/91]
 gi|207858310|ref|YP_002244961.1| hypothetical protein SEN2890 [Salmonella enterica subsp. enterica
          serovar Enteritidis str. P125109]
 gi|213025340|ref|ZP_03339787.1| hypothetical protein Salmonelentericaenterica_23998 [Salmonella
          enterica subsp. enterica serovar Typhi str. 404ty]
 gi|213162148|ref|ZP_03347858.1| hypothetical protein Salmoneentericaenterica_19993 [Salmonella
          enterica subsp. enterica serovar Typhi str. E00-7866]
 gi|213425826|ref|ZP_03358576.1| hypothetical protein SentesTyphi_09337 [Salmonella enterica
          subsp. enterica serovar Typhi str. E02-1180]
 gi|213582633|ref|ZP_03364459.1| hypothetical protein SentesTyph_16088 [Salmonella enterica subsp.
          enterica serovar Typhi str. E98-0664]
 gi|213609790|ref|ZP_03369616.1| hypothetical protein SentesTyp_04375 [Salmonella enterica subsp.
          enterica serovar Typhi str. E98-2068]
 gi|213646967|ref|ZP_03377020.1| hypothetical protein SentesTy_06454 [Salmonella enterica subsp.
          enterica serovar Typhi str. J185]
 gi|213857739|ref|ZP_03384710.1| hypothetical protein SentesT_21660 [Salmonella enterica subsp.
          enterica serovar Typhi str. M223]
 gi|224584836|ref|YP_002638634.1| hypothetical protein SPC_3106 [Salmonella enterica subsp.
          enterica serovar Paratyphi C strain RKS4594]
 gi|238909846|ref|ZP_04653683.1| hypothetical protein SentesTe_01750 [Salmonella enterica subsp.
          enterica serovar Tennessee str. CDC07-0191]
 gi|289806994|ref|ZP_06537623.1| hypothetical protein Salmonellaentericaenterica_22237 [Salmonella
          enterica subsp. enterica serovar Typhi str. AG3]
 gi|289823824|ref|ZP_06543436.1| hypothetical protein Salmonellentericaenterica_01172 [Salmonella
          enterica subsp. enterica serovar Typhi str. E98-3139]
 gi|75481005|sp|Q57K69|YGFY_SALCH RecName: Full=UPF0350 protein ygfY
 gi|81175094|sp|Q5PJF5|YGFY_SALPA RecName: Full=UPF0350 protein ygfY
 gi|81175095|sp|Q8XEN6|YGFY_SALTI RecName: Full=UPF0350 protein ygfY
 gi|81175096|sp|Q7CPV1|YGFY_SALTY RecName: Full=UPF0350 protein ygfY
 gi|25512534|pir||AE0872 conserved hypothetical protein STY3203 [imported] - Salmonella
          enterica subsp. enterica serovar Typhi (strain CT18)
 gi|16421598|gb|AAL21922.1| putative cytoplasmic protein [Salmonella enterica subsp. enterica
          serovar Typhimurium str. LT2]
 gi|16504130|emb|CAD02877.1| conserved hypothetical protein [Salmonella enterica subsp.
          enterica serovar Typhi]
 gi|29138949|gb|AAO70517.1| conserved hypothetical protein [Salmonella enterica subsp.
          enterica serovar Typhi str. Ty2]
 gi|56129250|gb|AAV78756.1| conserved hypothetical protein [Salmonella enterica subsp.
          enterica serovar Paratyphi A str. ATCC 9150]
 gi|62129190|gb|AAX66893.1| putative cytoplasmic protein [Salmonella enterica subsp. enterica
          serovar Choleraesuis str. SC-B67]
 gi|161365359|gb|ABX69127.1| hypothetical protein SPAB_03795 [Salmonella enterica subsp.
          enterica serovar Paratyphi B str. SPB7]
 gi|194401857|gb|ACF62079.1| TPR repeat protein [Salmonella enterica subsp. enterica serovar
          Newport str. SL254]
 gi|194409692|gb|ACF69911.1| protein YgfY [Salmonella enterica subsp. enterica serovar
          Heidelberg str. SL476]
 gi|194456570|gb|EDX45409.1| TPR repeat protein [Salmonella enterica subsp. enterica serovar
          Kentucky str. CVM29188]
 gi|194458392|gb|EDX47231.1| TPR repeat protein [Salmonella enterica subsp. enterica serovar
          Kentucky str. CVM29188]
 gi|194711840|gb|ACF91061.1| TPR repeat protein [Salmonella enterica subsp. enterica serovar
          Schwarzengrund str. CVM19633]
 gi|195633729|gb|EDX52143.1| TPR repeat protein [Salmonella enterica subsp. enterica serovar
          Newport str. SL317]
 gi|197095399|emb|CAR60958.1| conserved hypothetical protein [Salmonella enterica subsp.
          enterica serovar Paratyphi A str. AKU_12601]
 gi|197214167|gb|ACH51564.1| TPR repeat protein [Salmonella enterica subsp. enterica serovar
          Agona str. SL483]
 gi|197242748|gb|EDY25368.1| TPR repeat protein [Salmonella enterica subsp. enterica serovar
          Saintpaul str. SARA23]
 gi|197290673|gb|EDY30027.1| TPR repeat protein [Salmonella enterica subsp. enterica serovar
          Schwarzengrund str. SL480]
 gi|197939102|gb|ACH76435.1| TPR repeat protein [Salmonella enterica subsp. enterica serovar
          Dublin str. CT_02021853]
 gi|199604165|gb|EDZ02710.1| protein YgfY [Salmonella enterica subsp. enterica serovar Virchow
          str. SL491]
 gi|204322693|gb|EDZ07890.1| TPR repeat protein [Salmonella enterica subsp. enterica serovar
          Javiana str. GA_MM04042433]
 gi|205273752|emb|CAR38747.1| conserved hypothetical protein [Salmonella enterica subsp.
          enterica serovar Gallinarum str. 287/91]
 gi|205324788|gb|EDZ12627.1| TPR repeat protein [Salmonella enterica subsp. enterica serovar
          Saintpaul str. SARA29]
 gi|205327995|gb|EDZ14759.1| TPR repeat protein [Salmonella enterica subsp. enterica serovar
          4,[5],12:i:- str. CVM23701]
 gi|205334422|gb|EDZ21186.1| TPR repeat protein [Salmonella enterica subsp. enterica serovar
          Kentucky str. CDC 191]
 gi|205338218|gb|EDZ24982.1| protein YgfY [Salmonella enterica subsp. enterica serovar
          Heidelberg str. SL486]
 gi|205340635|gb|EDZ27399.1| TPR repeat protein [Salmonella enterica subsp. enterica serovar
          Weltevreden str. HI_N05-537]
 gi|205349097|gb|EDZ35728.1| TPR repeat protein [Salmonella enterica subsp. enterica serovar
          Hadar str. RI_05P066]
 gi|206710113|emb|CAR34468.1| conserved hypothetical protein [Salmonella enterica subsp.
          enterica serovar Enteritidis str. P125109]
 gi|224469363|gb|ACN47193.1| hypothetical protein SPC_3106 [Salmonella enterica subsp.
          enterica serovar Paratyphi C strain RKS4594]
 gi|261248179|emb|CBG26015.1| conserved hypothetical protein [Salmonella enterica subsp.
          enterica serovar Typhimurium str. D23580]
 gi|267995201|gb|ACY90086.1| hypothetical protein STM14_3679 [Salmonella enterica subsp.
          enterica serovar Typhimurium str. 14028S]
 gi|301159603|emb|CBW19122.1| conserved hypothetical protein [Salmonella enterica subsp.
          enterica serovar Typhimurium str. SL1344]
 gi|312914068|dbj|BAJ38042.1| hypothetical protein STMDT12_C30990 [Salmonella enterica subsp.
          enterica serovar Typhimurium str. T000240]
 gi|320087476|emb|CBY97241.1| UPF0350 protein YPTB3173 [Salmonella enterica subsp. enterica
          serovar Weltevreden str. 2007-60-3289-1]
 gi|322613445|gb|EFY10386.1| hypothetical protein SEEM315_06935 [Salmonella enterica subsp.
          enterica serovar Montevideo str. 315996572]
 gi|322621037|gb|EFY17895.1| hypothetical protein SEEM971_19659 [Salmonella enterica subsp.
          enterica serovar Montevideo str. 495297-1]
 gi|322624101|gb|EFY20935.1| hypothetical protein SEEM973_19780 [Salmonella enterica subsp.
          enterica serovar Montevideo str. 495297-3]
 gi|322628160|gb|EFY24949.1| hypothetical protein SEEM974_21515 [Salmonella enterica subsp.
          enterica serovar Montevideo str. 495297-4]
 gi|322633279|gb|EFY30021.1| hypothetical protein SEEM201_12605 [Salmonella enterica subsp.
          enterica serovar Montevideo str. 515920-1]
 gi|322636143|gb|EFY32851.1| hypothetical protein SEEM202_13463 [Salmonella enterica subsp.
          enterica serovar Montevideo str. 515920-2]
 gi|322639481|gb|EFY36169.1| hypothetical protein SEEM954_11592 [Salmonella enterica subsp.
          enterica serovar Montevideo str. 531954]
 gi|322647586|gb|EFY44075.1| hypothetical protein SEEM054_10677 [Salmonella enterica subsp.
          enterica serovar Montevideo str. NC_MB110209-0054]
 gi|322648770|gb|EFY45217.1| hypothetical protein SEEM675_04666 [Salmonella enterica subsp.
          enterica serovar Montevideo str. OH_2009072675]
 gi|322653825|gb|EFY50151.1| hypothetical protein SEEM965_22316 [Salmonella enterica subsp.
          enterica serovar Montevideo str. CASC_09SCPH15965]
 gi|322657931|gb|EFY54199.1| hypothetical protein SEEM19N_18431 [Salmonella enterica subsp.
          enterica serovar Montevideo str. 19N]
 gi|322664034|gb|EFY60233.1| hypothetical protein SEEM801_04731 [Salmonella enterica subsp.
          enterica serovar Montevideo str. 81038-01]
 gi|322668955|gb|EFY65106.1| hypothetical protein SEEM507_09846 [Salmonella enterica subsp.
          enterica serovar Montevideo str. MD_MDA09249507]
 gi|322673051|gb|EFY69158.1| hypothetical protein SEEM877_00935 [Salmonella enterica subsp.
          enterica serovar Montevideo str. 414877]
 gi|322677958|gb|EFY74021.1| hypothetical protein SEEM867_01877 [Salmonella enterica subsp.
          enterica serovar Montevideo str. 366867]
 gi|322681134|gb|EFY77167.1| hypothetical protein SEEM180_20369 [Salmonella enterica subsp.
          enterica serovar Montevideo str. 413180]
 gi|322687936|gb|EFY83903.1| hypothetical protein SEEM600_16016 [Salmonella enterica subsp.
          enterica serovar Montevideo str. 446600]
 gi|322716038|gb|EFZ07609.1| UPF0350 protein ygfY [Salmonella enterica subsp. enterica serovar
          Choleraesuis str. A50]
 gi|323131403|gb|ADX18833.1| UPF0350 protein ygfY [Salmonella enterica subsp. enterica serovar
          Typhimurium str. 4/74]
 gi|323194868|gb|EFZ80055.1| hypothetical protein SEEM581_15587 [Salmonella enterica subsp.
          enterica serovar Montevideo str. 609458-1]
 gi|323196619|gb|EFZ81767.1| hypothetical protein SEEM501_20663 [Salmonella enterica subsp.
          enterica serovar Montevideo str. 556150-1]
 gi|323202681|gb|EFZ87721.1| hypothetical protein SEEM460_18430 [Salmonella enterica subsp.
          enterica serovar Montevideo str. 609460]
 gi|323207832|gb|EFZ92778.1| hypothetical protein SEEM020_18210 [Salmonella enterica subsp.
          enterica serovar Montevideo str. 507440-20]
 gi|323212616|gb|EFZ97433.1| hypothetical protein SEEM6152_10338 [Salmonella enterica subsp.
          enterica serovar Montevideo str. 556152]
 gi|323214901|gb|EFZ99649.1| hypothetical protein SEEM0077_03064 [Salmonella enterica subsp.
          enterica serovar Montevideo str. MB101509-0077]
 gi|323222632|gb|EGA06997.1| hypothetical protein SEEM0047_09315 [Salmonella enterica subsp.
          enterica serovar Montevideo str. MB102109-0047]
 gi|323225089|gb|EGA09341.1| hypothetical protein SEEM0055_02505 [Salmonella enterica subsp.
          enterica serovar Montevideo str. MB110209-0055]
 gi|323230611|gb|EGA14729.1| hypothetical protein SEEM0052_20144 [Salmonella enterica subsp.
          enterica serovar Montevideo str. MB111609-0052]
 gi|323235038|gb|EGA19124.1| hypothetical protein SEEM3312_05848 [Salmonella enterica subsp.
          enterica serovar Montevideo str. 2009083312]
 gi|323239077|gb|EGA23127.1| hypothetical protein SEEM5258_05725 [Salmonella enterica subsp.
          enterica serovar Montevideo str. 2009085258]
 gi|323244565|gb|EGA28571.1| hypothetical protein SEEM1156_01482 [Salmonella enterica subsp.
          enterica serovar Montevideo str. 315731156]
 gi|323247180|gb|EGA31146.1| hypothetical protein SEEM9199_21540 [Salmonella enterica subsp.
          enterica serovar Montevideo str. IA_2009159199]
 gi|323253337|gb|EGA37166.1| hypothetical protein SEEM8282_09691 [Salmonella enterica subsp.
          enterica serovar Montevideo str. IA_2010008282]
 gi|323256356|gb|EGA40092.1| hypothetical protein SEEM8283_12186 [Salmonella enterica subsp.
          enterica serovar Montevideo str. IA_2010008283]
 gi|323262468|gb|EGA46024.1| hypothetical protein SEEM8284_01851 [Salmonella enterica subsp.
          enterica serovar Montevideo str. IA_2010008284]
 gi|323267436|gb|EGA50920.1| hypothetical protein SEEM8285_21677 [Salmonella enterica subsp.
          enterica serovar Montevideo str. IA_2010008285]
 gi|323269160|gb|EGA52615.1| hypothetical protein SEEM8287_10727 [Salmonella enterica subsp.
          enterica serovar Montevideo str. IA_2010008287]
 gi|326624792|gb|EGE31137.1| TPR repeat protein [Salmonella enterica subsp. enterica serovar
          Dublin str. 3246]
 gi|326629085|gb|EGE35428.1| YgfY protein [Salmonella enterica subsp. enterica serovar
          Gallinarum str. 9]
 gi|332989914|gb|AEF08897.1| hypothetical protein STMUK_3035 [Salmonella enterica subsp.
          enterica serovar Typhimurium str. UK-1]
          Length = 88

 Score = 62.0 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 20/78 (25%), Positives = 37/78 (47%)

Query: 5  MNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTG 64
          M++  +  ++   RRG RE+D+ +  F +H    LS  E  +   +++ DD +LF W   
Sbjct: 1  MDIHNKARIHWACRRGMRELDISIMPFFEHEYDSLSDEEKRIFVRLLQSDDPDLFNWLMN 60

Query: 65 MEKPPEYLRTPIFKKIYD 82
            KP +     + + I  
Sbjct: 61 HGKPADAELEQMVRLIQT 78


>gi|148652349|ref|YP_001279442.1| hypothetical protein PsycPRwf_0537 [Psychrobacter sp. PRwf-1]
 gi|148571433|gb|ABQ93492.1| protein of unknown function DUF339 [Psychrobacter sp. PRwf-1]
          Length = 90

 Score = 62.0 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 16/82 (19%), Positives = 36/82 (43%), Gaps = 1/82 (1%)

Query: 8  QCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEK 67
          + R+++Y+  RRG +E+D  +  +V  + L     E      ++  +D +L  +F   + 
Sbjct: 10 EQRRVIYQA-RRGLKELDFYIDPYVKQYYLTADEDEQATFAKLLTYEDPDLLNYFMNQDT 68

Query: 68 PPEYLRTPIFKKIYDYYSNNLD 89
          P +     +  K+      +L 
Sbjct: 69 PDDAKVGELVLKLKKLQHGDLS 90


>gi|251791000|ref|YP_003005721.1| hypothetical protein Dd1591_3430 [Dickeya zeae Ech1591]
 gi|247539621|gb|ACT08242.1| protein of unknown function DUF339 [Dickeya zeae Ech1591]
          Length = 90

 Score = 62.0 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 18/65 (27%), Positives = 33/65 (50%)

Query: 4  NMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFT 63
          NM++  +  ++   RRG RE+D+ +  F +H    LS  +      +++ DD +LF W  
Sbjct: 2  NMDINNKARIHWACRRGMRELDISIMPFFEHDYDTLSDDDKQQFIRLLQCDDPDLFNWLM 61

Query: 64 GMEKP 68
             +P
Sbjct: 62 NHGEP 66


>gi|254481369|ref|ZP_05094614.1| TPR repeat region superfamily protein [marine gamma
          proteobacterium HTCC2148]
 gi|214038532|gb|EEB79194.1| TPR repeat region superfamily protein [marine gamma
          proteobacterium HTCC2148]
          Length = 88

 Score = 62.0 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 23/84 (27%), Positives = 40/84 (47%), Gaps = 1/84 (1%)

Query: 6  NLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGM 65
          + +  ++ +   RRG  E+DL+L  FV      L   +    + ++  +D +LF WF   
Sbjct: 4  DEEINRMRW-AARRGMLELDLVLEPFVQSRFATLDEADRIRFKDLMLSEDQDLFAWFMRR 62

Query: 66 EKPPEYLRTPIFKKIYDYYSNNLD 89
          E+P +     I KKI D+   + D
Sbjct: 63 EQPQDRELALIVKKILDFTHTSPD 86


>gi|323183451|gb|EFZ68848.1| hypothetical protein ECOK1357_3230 [Escherichia coli 1357]
          Length = 88

 Score = 62.0 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 20/78 (25%), Positives = 36/78 (46%), Gaps = 1/78 (1%)

Query: 5  MNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTG 64
          M++  +  ++   RRG RE+D+ +  F +H    LS  E  +   ++E DD +LF W   
Sbjct: 1  MDINNKARIHWACRRGMRELDISIMPFFEHEYDSLSDDEKRIFVRLLECDDPDLFNWLMN 60

Query: 65 MEKPPEYLRTPIFKKIYD 82
            K P      +  ++  
Sbjct: 61 HGK-PADAELEMMVRLIQ 77


>gi|90021899|ref|YP_527726.1| response regulator receiver domain-containing protein
          [Saccharophagus degradans 2-40]
 gi|89951499|gb|ABD81514.1| protein of unknown function DUF339 [Saccharophagus degradans
          2-40]
          Length = 81

 Score = 62.0 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 24/79 (30%), Positives = 39/79 (49%), Gaps = 5/79 (6%)

Query: 9  CRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKP 68
            K+ +   RRG  E+DL+L  F+D+    L + +  +   ++EE D +LF+WF    +P
Sbjct: 3  INKLRW-ASRRGMLELDLVLNPFLDNVYSTLGADDQALFHKLLEEQDQDLFQWFMRKSEP 61

Query: 69 PEYLRTPIFKKIYDYYSNN 87
                P  K+I     NN
Sbjct: 62 ----EAPDLKRIVSIILNN 76


>gi|297537890|ref|YP_003673659.1| hypothetical protein M301_0698 [Methylotenera sp. 301]
 gi|297257237|gb|ADI29082.1| protein of unknown function DUF339 [Methylotenera sp. 301]
          Length = 96

 Score = 62.0 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 16/60 (26%), Positives = 32/60 (53%), Gaps = 1/60 (1%)

Query: 6  NLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGM 65
          + + R++ +RC RRG  E+D++L  F +  +  L+  EL   +S+++  D+      T  
Sbjct: 9  DEEVRRLSWRC-RRGLLELDIVLQRFSEKHLATLTKPELLAFDSLLDLPDNEFLDVVTSR 67


>gi|15803433|ref|NP_289466.1| hypothetical protein Z4235 [Escherichia coli O157:H7 EDL933]
 gi|15833023|ref|NP_311796.1| hypothetical protein ECs3769 [Escherichia coli O157:H7 str.
          Sakai]
 gi|16130799|ref|NP_417373.1| conserved protein [Escherichia coli str. K-12 substr. MG1655]
 gi|26249312|ref|NP_755352.1| hypothetical protein c3477 [Escherichia coli CFT073]
 gi|30064209|ref|NP_838380.1| hypothetical protein S3082 [Shigella flexneri 2a str. 2457T]
 gi|74313455|ref|YP_311874.1| hypothetical protein SSON_3050 [Shigella sonnei Ss046]
 gi|82545480|ref|YP_409427.1| hypothetical protein SBO_3095 [Shigella boydii Sb227]
 gi|82778337|ref|YP_404686.1| hypothetical protein SDY_3185 [Shigella dysenteriae Sd197]
 gi|89109676|ref|AP_003456.1| hypothetical protein [Escherichia coli str. K-12 substr. W3110]
 gi|91212275|ref|YP_542261.1| hypothetical protein UTI89_C3282 [Escherichia coli UTI89]
 gi|110643045|ref|YP_670775.1| hypothetical protein ECP_2890 [Escherichia coli 536]
 gi|117625128|ref|YP_854116.1| hypothetical protein APECO1_3630 [Escherichia coli APEC O1]
 gi|157157949|ref|YP_001464234.1| hypothetical protein EcE24377A_3223 [Escherichia coli E24377A]
 gi|168747624|ref|ZP_02772646.1| TPR repeat protein [Escherichia coli O157:H7 str. EC4113]
 gi|168753835|ref|ZP_02778842.1| TPR repeat protein [Escherichia coli O157:H7 str. EC4401]
 gi|168760025|ref|ZP_02785032.1| TPR repeat protein [Escherichia coli O157:H7 str. EC4501]
 gi|168766890|ref|ZP_02791897.1| TPR repeat protein [Escherichia coli O157:H7 str. EC4486]
 gi|168775774|ref|ZP_02800781.1| TPR repeat protein [Escherichia coli O157:H7 str. EC4196]
 gi|168778910|ref|ZP_02803917.1| TPR repeat protein [Escherichia coli O157:H7 str. EC4076]
 gi|168785743|ref|ZP_02810750.1| TPR repeat protein [Escherichia coli O157:H7 str. EC869]
 gi|168800030|ref|ZP_02825037.1| TPR repeat protein [Escherichia coli O157:H7 str. EC508]
 gi|170018857|ref|YP_001723811.1| hypothetical protein EcolC_0812 [Escherichia coli ATCC 8739]
 gi|170082458|ref|YP_001731778.1| hypothetical protein ECDH10B_3071 [Escherichia coli str. K-12
          substr. DH10B]
 gi|170679885|ref|YP_001745050.1| hypothetical protein EcSMS35_3030 [Escherichia coli SMS-3-5]
 gi|170765739|ref|ZP_02900550.1| TPR repeat protein [Escherichia albertii TW07627]
 gi|187732511|ref|YP_001881666.1| hypothetical protein SbBS512_E3317 [Shigella boydii CDC 3083-94]
 gi|188495995|ref|ZP_03003265.1| TPR repeat protein [Escherichia coli 53638]
 gi|191166001|ref|ZP_03027837.1| TPR repeat protein [Escherichia coli B7A]
 gi|191173258|ref|ZP_03034789.1| TPR repeat protein [Escherichia coli F11]
 gi|193063569|ref|ZP_03044658.1| TPR repeat protein [Escherichia coli E22]
 gi|193070555|ref|ZP_03051494.1| TPR repeat protein [Escherichia coli E110019]
 gi|194426186|ref|ZP_03058741.1| TPR repeat protein [Escherichia coli B171]
 gi|194431723|ref|ZP_03064014.1| TPR repeat protein [Shigella dysenteriae 1012]
 gi|194436860|ref|ZP_03068960.1| TPR repeat protein [Escherichia coli 101-1]
 gi|195936515|ref|ZP_03081897.1| hypothetical protein EscherichcoliO157_08637 [Escherichia coli
          O157:H7 str. EC4024]
 gi|208806447|ref|ZP_03248784.1| TPR repeat protein [Escherichia coli O157:H7 str. EC4206]
 gi|208811923|ref|ZP_03253252.1| TPR repeat protein [Escherichia coli O157:H7 str. EC4045]
 gi|208820745|ref|ZP_03261065.1| TPR repeat protein [Escherichia coli O157:H7 str. EC4042]
 gi|209397339|ref|YP_002272371.1| TPR repeat protein [Escherichia coli O157:H7 str. EC4115]
 gi|209920351|ref|YP_002294435.1| hypothetical protein ECSE_3160 [Escherichia coli SE11]
 gi|215488197|ref|YP_002330628.1| hypothetical protein E2348C_3150 [Escherichia coli O127:H6 str.
          E2348/69]
 gi|217327300|ref|ZP_03443383.1| TPR repeat protein [Escherichia coli O157:H7 str. TW14588]
 gi|218550144|ref|YP_002383935.1| hypothetical protein EFER_2832 [Escherichia fergusonii ATCC
          35469]
 gi|218555445|ref|YP_002388358.1| hypothetical protein ECIAI1_3016 [Escherichia coli IAI1]
 gi|218559890|ref|YP_002392803.1| hypothetical protein ECS88_3177 [Escherichia coli S88]
 gi|218691022|ref|YP_002399234.1| hypothetical protein ECED1_3356 [Escherichia coli ED1a]
 gi|218696492|ref|YP_002404159.1| hypothetical protein EC55989_3183 [Escherichia coli 55989]
 gi|218701606|ref|YP_002409235.1| hypothetical protein ECIAI39_3313 [Escherichia coli IAI39]
 gi|218706403|ref|YP_002413922.1| hypothetical protein ECUMN_3239 [Escherichia coli UMN026]
 gi|227888446|ref|ZP_04006251.1| protein of hypothetical function DUF339 [Escherichia coli 83972]
 gi|237706458|ref|ZP_04536939.1| ygfY [Escherichia sp. 3_2_53FAA]
 gi|238902022|ref|YP_002927818.1| hypothetical protein BWG_2622 [Escherichia coli BW2952]
 gi|253772262|ref|YP_003035093.1| hypothetical protein ECBD_0840 [Escherichia coli
          'BL21-Gold(DE3)pLysS AG']
 gi|254037942|ref|ZP_04872000.1| TPR repeat protein [Escherichia sp. 1_1_43]
 gi|254162809|ref|YP_003045917.1| hypothetical protein ECB_02729 [Escherichia coli B str. REL606]
 gi|254794847|ref|YP_003079684.1| hypothetical protein ECSP_3865 [Escherichia coli O157:H7 str.
          TW14359]
 gi|256019305|ref|ZP_05433170.1| hypothetical protein ShiD9_10336 [Shigella sp. D9]
 gi|256024593|ref|ZP_05438458.1| hypothetical protein E4_14544 [Escherichia sp. 4_1_40B]
 gi|260845565|ref|YP_003223343.1| hypothetical protein ECO103_3472 [Escherichia coli O103:H2 str.
          12009]
 gi|260857020|ref|YP_003230911.1| hypothetical protein ECO26_3986 [Escherichia coli O26:H11 str.
          11368]
 gi|260869574|ref|YP_003235976.1| hypothetical protein ECO111_3635 [Escherichia coli O111:H- str.
          11128]
 gi|261226210|ref|ZP_05940491.1| hypothetical protein EscherichiacoliO157_16668 [Escherichia coli
          O157:H7 str. FRIK2000]
 gi|261256535|ref|ZP_05949068.1| hypothetical protein EscherichiacoliO157EcO_11956 [Escherichia
          coli O157:H7 str. FRIK966]
 gi|291284216|ref|YP_003501034.1| hypothetical protein G2583_3550 [Escherichia coli O55:H7 str.
          CB9615]
 gi|293406396|ref|ZP_06650322.1| hypothetical protein ECGG_01692 [Escherichia coli FVEC1412]
 gi|293412256|ref|ZP_06654979.1| hypothetical protein ECEG_02261 [Escherichia coli B354]
 gi|293416150|ref|ZP_06658790.1| ygfY protein [Escherichia coli B185]
 gi|293449219|ref|ZP_06663640.1| hypothetical protein ECCG_02249 [Escherichia coli B088]
 gi|297518189|ref|ZP_06936575.1| hypothetical protein EcolOP_11161 [Escherichia coli OP50]
 gi|298382132|ref|ZP_06991729.1| hypothetical protein ECFG_01877 [Escherichia coli FVEC1302]
 gi|301027410|ref|ZP_07190747.1| TPR repeat region protein [Escherichia coli MS 69-1]
 gi|301027805|ref|ZP_07191110.1| TPR repeat region [Escherichia coli MS 196-1]
 gi|306812201|ref|ZP_07446399.1| hypothetical protein ECNC101_09819 [Escherichia coli NC101]
 gi|307139584|ref|ZP_07498940.1| hypothetical protein EcolH7_15849 [Escherichia coli H736]
 gi|307310484|ref|ZP_07590132.1| protein of unknown function DUF339 [Escherichia coli W]
 gi|309785296|ref|ZP_07679927.1| conserved hypothetical protein [Shigella dysenteriae 1617]
 gi|312964843|ref|ZP_07779083.1| conserved hypothetical protein [Escherichia coli 2362-75]
 gi|312972861|ref|ZP_07787034.1| conserved hypothetical protein [Escherichia coli 1827-70]
 gi|331643587|ref|ZP_08344718.1| putative cytoplasmic protein [Escherichia coli H736]
 gi|331654395|ref|ZP_08355395.1| putative cytoplasmic protein [Escherichia coli M718]
 gi|331659027|ref|ZP_08359969.1| putative cytoplasmic protein [Escherichia coli TA206]
 gi|331664470|ref|ZP_08365376.1| putative cytoplasmic protein [Escherichia coli TA143]
 gi|331669632|ref|ZP_08370478.1| putative cytoplasmic protein [Escherichia coli TA271]
 gi|331674382|ref|ZP_08375142.1| putative cytoplasmic protein [Escherichia coli TA280]
 gi|331678884|ref|ZP_08379558.1| putative cytoplasmic protein [Escherichia coli H591]
 gi|331684523|ref|ZP_08385115.1| putative cytoplasmic protein [Escherichia coli H299]
 gi|332280418|ref|ZP_08392831.1| conserved hypothetical protein [Shigella sp. D9]
 gi|54040231|sp|P64560|YGFY_ECOL6 RecName: Full=UPF0350 protein ygfY
 gi|54040232|sp|P64561|YGFY_ECO57 RecName: Full=UPF0350 protein ygfY
 gi|54042398|sp|P64559|YGFY_ECOLI RecName: Full=UPF0350 protein ygfY
 gi|12517425|gb|AAG58025.1|AE005520_3 orf, hypothetical protein [Escherichia coli O157:H7 str. EDL933]
 gi|26109720|gb|AAN81925.1|AE016766_13 Hypothetical protein ygfY [Escherichia coli CFT073]
 gi|887847|gb|AAA83078.1| ORF_f88 [Escherichia coli]
 gi|1789264|gb|AAC75935.1| conserved protein [Escherichia coli str. K-12 substr. MG1655]
 gi|13363241|dbj|BAB37192.1| hypothetical protein [Escherichia coli O157:H7 str. Sakai]
 gi|30042466|gb|AAP18190.1| hypothetical protein S3082 [Shigella flexneri 2a str. 2457T]
 gi|73856932|gb|AAZ89639.1| conserved hypothetical protein [Shigella sonnei Ss046]
 gi|81242485|gb|ABB63195.1| conserved hypothetical protein [Shigella dysenteriae Sd197]
 gi|81246891|gb|ABB67599.1| conserved hypothetical protein [Shigella boydii Sb227]
 gi|85675709|dbj|BAE76962.1| conserved hypothetical protein [Escherichia coli str. K12 substr.
          W3110]
 gi|91073849|gb|ABE08730.1| hypothetical protein UTI89_C3282 [Escherichia coli UTI89]
 gi|110344637|gb|ABG70874.1| putative cytoplasmic protein [Escherichia coli 536]
 gi|115514252|gb|ABJ02327.1| conserved hypothetical protein [Escherichia coli APEC O1]
 gi|157079979|gb|ABV19687.1| TPR repeat protein [Escherichia coli E24377A]
 gi|169753785|gb|ACA76484.1| protein of unknown function DUF339 [Escherichia coli ATCC 8739]
 gi|169890293|gb|ACB04000.1| conserved protein [Escherichia coli str. K-12 substr. DH10B]
 gi|170124885|gb|EDS93816.1| TPR repeat protein [Escherichia albertii TW07627]
 gi|170517603|gb|ACB15781.1| TPR repeat protein [Escherichia coli SMS-3-5]
 gi|187429503|gb|ACD08777.1| TPR repeat protein [Shigella boydii CDC 3083-94]
 gi|187768798|gb|EDU32642.1| TPR repeat protein [Escherichia coli O157:H7 str. EC4196]
 gi|188017748|gb|EDU55870.1| TPR repeat protein [Escherichia coli O157:H7 str. EC4113]
 gi|188491194|gb|EDU66297.1| TPR repeat protein [Escherichia coli 53638]
 gi|189003162|gb|EDU72148.1| TPR repeat protein [Escherichia coli O157:H7 str. EC4076]
 gi|189358708|gb|EDU77127.1| TPR repeat protein [Escherichia coli O157:H7 str. EC4401]
 gi|189363659|gb|EDU82078.1| TPR repeat protein [Escherichia coli O157:H7 str. EC4486]
 gi|189369361|gb|EDU87777.1| TPR repeat protein [Escherichia coli O157:H7 str. EC4501]
 gi|189373927|gb|EDU92343.1| TPR repeat protein [Escherichia coli O157:H7 str. EC869]
 gi|189377651|gb|EDU96067.1| TPR repeat protein [Escherichia coli O157:H7 str. EC508]
 gi|190903949|gb|EDV63662.1| TPR repeat protein [Escherichia coli B7A]
 gi|190906509|gb|EDV66117.1| TPR repeat protein [Escherichia coli F11]
 gi|192930846|gb|EDV83451.1| TPR repeat protein [Escherichia coli E22]
 gi|192956138|gb|EDV86602.1| TPR repeat protein [Escherichia coli E110019]
 gi|194415494|gb|EDX31761.1| TPR repeat protein [Escherichia coli B171]
 gi|194420079|gb|EDX36157.1| TPR repeat protein [Shigella dysenteriae 1012]
 gi|194424342|gb|EDX40329.1| TPR repeat protein [Escherichia coli 101-1]
 gi|208726248|gb|EDZ75849.1| TPR repeat protein [Escherichia coli O157:H7 str. EC4206]
 gi|208733200|gb|EDZ81887.1| TPR repeat protein [Escherichia coli O157:H7 str. EC4045]
 gi|208740868|gb|EDZ88550.1| TPR repeat protein [Escherichia coli O157:H7 str. EC4042]
 gi|209158739|gb|ACI36172.1| TPR repeat protein [Escherichia coli O157:H7 str. EC4115]
 gi|209760548|gb|ACI78586.1| hypothetical protein ECs3769 [Escherichia coli]
 gi|209760550|gb|ACI78587.1| hypothetical protein ECs3769 [Escherichia coli]
 gi|209760552|gb|ACI78588.1| hypothetical protein ECs3769 [Escherichia coli]
 gi|209760554|gb|ACI78589.1| hypothetical protein ECs3769 [Escherichia coli]
 gi|209760556|gb|ACI78590.1| hypothetical protein ECs3769 [Escherichia coli]
 gi|209913610|dbj|BAG78684.1| conserved hypothetical protein [Escherichia coli SE11]
 gi|215266269|emb|CAS10698.1| predicted protein [Escherichia coli O127:H6 str. E2348/69]
 gi|217319667|gb|EEC28092.1| TPR repeat protein [Escherichia coli O157:H7 str. TW14588]
 gi|218353224|emb|CAU99144.1| conserved hypothetical protein [Escherichia coli 55989]
 gi|218357685|emb|CAQ90326.1| conserved hypothetical protein [Escherichia fergusonii ATCC
          35469]
 gi|218362213|emb|CAQ99831.1| conserved hypothetical protein [Escherichia coli IAI1]
 gi|218366659|emb|CAR04413.1| conserved hypothetical protein [Escherichia coli S88]
 gi|218371592|emb|CAR19431.1| conserved hypothetical protein [Escherichia coli IAI39]
 gi|218428586|emb|CAR09367.1| conserved hypothetical protein [Escherichia coli ED1a]
 gi|218433500|emb|CAR14403.1| conserved hypothetical protein [Escherichia coli UMN026]
 gi|222034592|emb|CAP77334.1| UPF0350 protein ygfY [Escherichia coli LF82]
 gi|226839566|gb|EEH71587.1| TPR repeat protein [Escherichia sp. 1_1_43]
 gi|226899498|gb|EEH85757.1| ygfY [Escherichia sp. 3_2_53FAA]
 gi|227834715|gb|EEJ45181.1| protein of hypothetical function DUF339 [Escherichia coli 83972]
 gi|238860373|gb|ACR62371.1| conserved protein [Escherichia coli BW2952]
 gi|242378428|emb|CAQ33209.1| conserved protein [Escherichia coli BL21(DE3)]
 gi|253323306|gb|ACT27908.1| protein of unknown function DUF339 [Escherichia coli
          'BL21-Gold(DE3)pLysS AG']
 gi|253974710|gb|ACT40381.1| hypothetical protein ECB_02729 [Escherichia coli B str. REL606]
 gi|253978876|gb|ACT44546.1| hypothetical protein ECD_02729 [Escherichia coli BL21(DE3)]
 gi|254594247|gb|ACT73608.1| conserved protein [Escherichia coli O157:H7 str. TW14359]
 gi|257755669|dbj|BAI27171.1| conserved predicted protein [Escherichia coli O26:H11 str. 11368]
 gi|257760712|dbj|BAI32209.1| conserved predicted protein [Escherichia coli O103:H2 str. 12009]
 gi|257765930|dbj|BAI37425.1| conserved predicted protein [Escherichia coli O111:H- str. 11128]
 gi|260448057|gb|ACX38479.1| protein of unknown function DUF339 [Escherichia coli DH1]
 gi|290764089|gb|ADD58050.1| UPF0350 protein ygfY [Escherichia coli O55:H7 str. CB9615]
 gi|291322309|gb|EFE61738.1| hypothetical protein ECCG_02249 [Escherichia coli B088]
 gi|291426402|gb|EFE99434.1| hypothetical protein ECGG_01692 [Escherichia coli FVEC1412]
 gi|291432339|gb|EFF05321.1| ygfY protein [Escherichia coli B185]
 gi|291469027|gb|EFF11518.1| hypothetical protein ECEG_02261 [Escherichia coli B354]
 gi|294493677|gb|ADE92433.1| TPR repeat protein [Escherichia coli IHE3034]
 gi|298277272|gb|EFI18788.1| hypothetical protein ECFG_01877 [Escherichia coli FVEC1302]
 gi|299879067|gb|EFI87278.1| TPR repeat region [Escherichia coli MS 196-1]
 gi|300394918|gb|EFJ78456.1| TPR repeat region protein [Escherichia coli MS 69-1]
 gi|305854239|gb|EFM54677.1| hypothetical protein ECNC101_09819 [Escherichia coli NC101]
 gi|306909379|gb|EFN39874.1| protein of unknown function DUF339 [Escherichia coli W]
 gi|307554874|gb|ADN47649.1| TPR repeat protein [Escherichia coli ABU 83972]
 gi|307625530|gb|ADN69834.1| hypothetical protein UM146_02035 [Escherichia coli UM146]
 gi|308926416|gb|EFP71892.1| conserved hypothetical protein [Shigella dysenteriae 1617]
 gi|309703257|emb|CBJ02592.1| conserved hypothetical protein [Escherichia coli ETEC H10407]
 gi|310332803|gb|EFQ00017.1| conserved hypothetical protein [Escherichia coli 1827-70]
 gi|312290399|gb|EFR18279.1| conserved hypothetical protein [Escherichia coli 2362-75]
 gi|312947430|gb|ADR28257.1| hypothetical protein NRG857_14220 [Escherichia coli O83:H1 str.
          NRG 857C]
 gi|315062201|gb|ADT76528.1| conserved hypothetical protein [Escherichia coli W]
 gi|315137496|dbj|BAJ44655.1| hypothetical protein ECDH1ME8569_2799 [Escherichia coli DH1]
 gi|315614947|gb|EFU95585.1| conserved hypothetical protein [Escherichia coli 3431]
 gi|320175915|gb|EFW50993.1| hypothetical protein SDB_01607 [Shigella dysenteriae CDC 74-1112]
 gi|320182200|gb|EFW57103.1| hypothetical protein SGB_00570 [Shigella boydii ATCC 9905]
 gi|320184559|gb|EFW59360.1| hypothetical protein SGF_03273 [Shigella flexneri CDC 796-83]
 gi|320189241|gb|EFW63900.1| hypothetical protein ECoD_04243 [Escherichia coli O157:H7 str.
          EC1212]
 gi|320195016|gb|EFW69645.1| hypothetical protein EcoM_02777 [Escherichia coli WV_060327]
 gi|320202557|gb|EFW77127.1| hypothetical protein ECoL_00218 [Escherichia coli EC4100B]
 gi|320640540|gb|EFX10079.1| hypothetical protein ECO5101_03969 [Escherichia coli O157:H7 str.
          G5101]
 gi|320645787|gb|EFX14772.1| hypothetical protein ECO9389_23456 [Escherichia coli O157:H- str.
          493-89]
 gi|320651087|gb|EFX19527.1| hypothetical protein ECO2687_11443 [Escherichia coli O157:H- str.
          H 2687]
 gi|320656583|gb|EFX24479.1| hypothetical protein ECO7815_01600 [Escherichia coli O55:H7 str.
          3256-97 TW 07815]
 gi|320662103|gb|EFX29504.1| hypothetical protein ECO5905_09543 [Escherichia coli O55:H7 str.
          USDA 5905]
 gi|320667178|gb|EFX34141.1| hypothetical protein ECOSU61_08619 [Escherichia coli O157:H7 str.
          LSU-61]
 gi|323162512|gb|EFZ48362.1| hypothetical protein ECE128010_1277 [Escherichia coli E128010]
 gi|323167897|gb|EFZ53587.1| hypothetical protein SS53G_1776 [Shigella sonnei 53G]
 gi|323173895|gb|EFZ59524.1| hypothetical protein ECLT68_2214 [Escherichia coli LT-68]
 gi|323188704|gb|EFZ73989.1| hypothetical protein ECRN5871_3124 [Escherichia coli RN587/1]
 gi|323377215|gb|ADX49483.1| protein of unknown function DUF339 [Escherichia coli KO11]
 gi|323935871|gb|EGB32170.1| ygfY [Escherichia coli E1520]
 gi|323941582|gb|EGB37762.1| ygfY [Escherichia coli E482]
 gi|323946617|gb|EGB42640.1| ygfY [Escherichia coli H120]
 gi|323951664|gb|EGB47539.1| ygfY [Escherichia coli H252]
 gi|323957382|gb|EGB53104.1| ygfY [Escherichia coli H263]
 gi|323960806|gb|EGB56427.1| ygfY [Escherichia coli H489]
 gi|323966698|gb|EGB62130.1| ygfY [Escherichia coli M863]
 gi|323971665|gb|EGB66894.1| ygfY [Escherichia coli TA007]
 gi|323978811|gb|EGB73892.1| ygfY [Escherichia coli TW10509]
 gi|324115086|gb|EGC09051.1| ygfY [Escherichia fergusonii B253]
 gi|324119938|gb|EGC13817.1| ygfY [Escherichia coli E1167]
 gi|325498458|gb|EGC96317.1| hypothetical protein ECD227_2555 [Escherichia fergusonii ECD227]
 gi|326339019|gb|EGD62834.1| protein of unknown function DUF339 [Escherichia coli O157:H7 str.
          1044]
 gi|326343099|gb|EGD66867.1| hypothetical protein ECF_02610 [Escherichia coli O157:H7 str.
          1125]
 gi|327251660|gb|EGE63346.1| hypothetical protein ECSTEC7V_3511 [Escherichia coli STEC_7v]
 gi|331037058|gb|EGI09282.1| putative cytoplasmic protein [Escherichia coli H736]
 gi|331047777|gb|EGI19854.1| putative cytoplasmic protein [Escherichia coli M718]
 gi|331053609|gb|EGI25638.1| putative cytoplasmic protein [Escherichia coli TA206]
 gi|331058401|gb|EGI30382.1| putative cytoplasmic protein [Escherichia coli TA143]
 gi|331063300|gb|EGI35213.1| putative cytoplasmic protein [Escherichia coli TA271]
 gi|331068476|gb|EGI39871.1| putative cytoplasmic protein [Escherichia coli TA280]
 gi|331073714|gb|EGI45035.1| putative cytoplasmic protein [Escherichia coli H591]
 gi|331078138|gb|EGI49344.1| putative cytoplasmic protein [Escherichia coli H299]
 gi|332086822|gb|EGI91958.1| hypothetical protein SB521682_3448 [Shigella boydii 5216-82]
 gi|332087676|gb|EGI92803.1| hypothetical protein SD15574_3456 [Shigella dysenteriae 155-74]
 gi|332090917|gb|EGI96008.1| hypothetical protein SB359474_3591 [Shigella boydii 3594-74]
 gi|332102770|gb|EGJ06116.1| conserved hypothetical protein [Shigella sp. D9]
 gi|332344793|gb|AEE58127.1| conserved hypothetical protein [Escherichia coli UMNK88]
          Length = 88

 Score = 62.0 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 20/78 (25%), Positives = 36/78 (46%), Gaps = 1/78 (1%)

Query: 5  MNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTG 64
          M++  +  ++   RRG RE+D+ +  F +H    LS  E  +   ++E DD +LF W   
Sbjct: 1  MDINNKARIHWACRRGMRELDISIMPFFEHEYDSLSDDEKRIFIRLLECDDPDLFNWLMN 60

Query: 65 MEKPPEYLRTPIFKKIYD 82
            K P      +  ++  
Sbjct: 61 HGK-PADAELEMMVRLIQ 77


>gi|88858213|ref|ZP_01132855.1| hypothetical protein PTD2_12524 [Pseudoalteromonas tunicata D2]
 gi|88819830|gb|EAR29643.1| hypothetical protein PTD2_12524 [Pseudoalteromonas tunicata D2]
          Length = 83

 Score = 61.6 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 19/75 (25%), Positives = 37/75 (49%), Gaps = 1/75 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          ++ +   RRG  E+D++L  FV+     LS+ +  + + ++ ++D  LF WF G E   +
Sbjct: 9  RLRW-ACRRGMLELDVLLMPFVEEGYDALSAEDKVIFQHLLTQEDPELFAWFMGHETAKD 67

Query: 71 YLRTPIFKKIYDYYS 85
               + K I +   
Sbjct: 68 PQLNYMVKLILNRVR 82


>gi|260775216|ref|ZP_05884114.1| hypothetical protein VIC_000587 [Vibrio coralliilyticus ATCC
          BAA-450]
 gi|260608917|gb|EEX35079.1| hypothetical protein VIC_000587 [Vibrio coralliilyticus ATCC
          BAA-450]
          Length = 86

 Score = 61.6 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 20/78 (25%), Positives = 34/78 (43%), Gaps = 1/78 (1%)

Query: 6  NLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGM 65
            +  +I +   RRG  E+D+++  F +    EL   E     S++E DD +LF W  G 
Sbjct: 4  TEEKARIKW-ACRRGMLELDVVIMPFFEECFEELKDNEQRDFVSLLECDDPDLFTWIMGH 62

Query: 66 EKPPEYLRTPIFKKIYDY 83
           +        +  KI  +
Sbjct: 63 GRSENLGHASMVDKIVAH 80


>gi|281602230|gb|ADA75214.1| hypothetical protein SFxv_3162 [Shigella flexneri 2002017]
 gi|332753733|gb|EGJ84112.1| hypothetical protein SFK671_3463 [Shigella flexneri K-671]
 gi|333015102|gb|EGK34445.1| hypothetical protein SFK304_3694 [Shigella flexneri K-304]
          Length = 88

 Score = 61.6 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 22/78 (28%), Positives = 37/78 (47%), Gaps = 1/78 (1%)

Query: 5  MNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTG 64
          M++  +  ++   RRG RE+D+ + SF +H    LS  E  +   ++E DD +LF W   
Sbjct: 1  MDINNKARIHWACRRGMRELDISIMSFFEHEYDSLSDDEKRIFIRLLECDDPDLFNWLMN 60

Query: 65 MEKPPEYLRTPIFKKIYD 82
            K P      I  ++  
Sbjct: 61 HGK-PADAELEIMVRLIQ 77


>gi|71281404|ref|YP_270786.1| TPR repeat-containing protein [Colwellia psychrerythraea 34H]
 gi|81175085|sp|Q47WN6|Y4131_COLP3 RecName: Full=UPF0350 protein CPS_4131
 gi|71147144|gb|AAZ27617.1| TPR repeat protein [Colwellia psychrerythraea 34H]
          Length = 91

 Score = 61.6 bits (149), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 20/70 (28%), Positives = 33/70 (47%), Gaps = 1/70 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          ++ +   RRG  E+D++   FVD    ELS+ +    E ++   D  LF WF G E   +
Sbjct: 17 RLKW-ACRRGMLELDVLFIPFVDEAYDELSTKDQFTFERLLTGQDPELFAWFMGHEVCED 75

Query: 71 YLRTPIFKKI 80
               + + I
Sbjct: 76 TELNAMVQLI 85


>gi|28198271|ref|NP_778585.1| hypothetical protein PD0354 [Xylella fastidiosa Temecula1]
 gi|71899438|ref|ZP_00681597.1| Protein of unknown function DUF339 [Xylella fastidiosa Ann-1]
 gi|81175082|sp|Q87EF7|Y354_XYLFT RecName: Full=UPF0350 protein PD_0354
 gi|28056341|gb|AAO28234.1| conserved hypothetical protein [Xylella fastidiosa Temecula1]
 gi|71730847|gb|EAO32919.1| Protein of unknown function DUF339 [Xylella fastidiosa Ann-1]
          Length = 97

 Score = 61.6 bits (149), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 16/81 (19%), Positives = 34/81 (41%), Gaps = 1/81 (1%)

Query: 2  KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
            +   +  K+ +R  RRG RE+D +   ++ H   + S  E  +    ++ +D  L++W
Sbjct: 15 TMDKPAELNKLRWRS-RRGMRELDHLFDRYLSHCWAQASEAERGVFLRFLDCEDDKLWRW 73

Query: 62 FTGMEKPPEYLRTPIFKKIYD 82
            G E   +     +   +  
Sbjct: 74 LMGYEVCQDASFAALIVTMRA 94


>gi|29654197|ref|NP_819889.1| TPR repeat protein [Coxiella burnetii RSA 493]
 gi|153209216|ref|ZP_01947282.1| TPR repeat protein [Coxiella burnetii 'MSU Goat Q177']
 gi|154705902|ref|YP_001424315.1| tetratricopeptide repeat family protein [Coxiella burnetii Dugway
          5J108-111]
 gi|161830976|ref|YP_001596837.1| TPR repeat-containing protein [Coxiella burnetii RSA 331]
 gi|165918504|ref|ZP_02218590.1| TPR repeat protein [Coxiella burnetii RSA 334]
 gi|212212677|ref|YP_002303613.1| tetratricopeptide repeat family protein [Coxiella burnetii
          CbuG_Q212]
 gi|212218350|ref|YP_002305137.1| tetratricopeptide repeat family protein [Coxiella burnetii
          CbuK_Q154]
 gi|81175092|sp|Q83D70|Y870_COXBU RecName: Full=UPF0350 protein CBU_0870
 gi|29541463|gb|AAO90403.1| tetratricopeptide repeat family protein [Coxiella burnetii RSA
          493]
 gi|120575471|gb|EAX32095.1| TPR repeat protein [Coxiella burnetii 'MSU Goat Q177']
 gi|154355188|gb|ABS76650.1| tetratricopeptide repeat family protein [Coxiella burnetii Dugway
          5J108-111]
 gi|161762843|gb|ABX78485.1| TPR repeat protein [Coxiella burnetii RSA 331]
 gi|165917750|gb|EDR36354.1| TPR repeat protein [Coxiella burnetii RSA 334]
 gi|212011087|gb|ACJ18468.1| tetratricopeptide repeat family protein [Coxiella burnetii
          CbuG_Q212]
 gi|212012612|gb|ACJ19992.1| tetratricopeptide repeat family protein [Coxiella burnetii
          CbuK_Q154]
          Length = 82

 Score = 61.6 bits (149), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 21/82 (25%), Positives = 38/82 (46%), Gaps = 3/82 (3%)

Query: 1  MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
          M + +    +KI ++C RRG  E+D++L  F +     L+  E  +   ++++ D  L+ 
Sbjct: 1  MNEPLAS--KKIRWKC-RRGMLELDILLERFYEEKFRSLTKNEKEIFNQLLDQPDPLLYD 57

Query: 61 WFTGMEKPPEYLRTPIFKKIYD 82
          W  G   P       I +KI  
Sbjct: 58 WLLGHVTPESSEFKKIIRKIQQ 79


>gi|332977756|gb|EGK14516.1| TPR repeat region superfamily protein [Psychrobacter sp.
          1501(2011)]
          Length = 89

 Score = 61.6 bits (149), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 16/82 (19%), Positives = 34/82 (41%), Gaps = 1/82 (1%)

Query: 8  QCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEK 67
          + R+ +Y+  RRG +E+D  +  +V    L     E      ++  +D +L  +F   + 
Sbjct: 9  EQRRAIYQA-RRGLKELDFYIDPYVKQHYLTADEDEQATFAKLLTYEDPDLLNYFMNQDT 67

Query: 68 PPEYLRTPIFKKIYDYYSNNLD 89
          P +     +  K+      +L 
Sbjct: 68 PEDSKVADLVLKLKTLQHGDLS 89


>gi|89075097|ref|ZP_01161538.1| hypothetical protein SKA34_21915 [Photobacterium sp. SKA34]
 gi|89049184|gb|EAR54749.1| hypothetical protein SKA34_21915 [Photobacterium sp. SKA34]
          Length = 88

 Score = 61.6 bits (149), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 17/74 (22%), Positives = 31/74 (41%)

Query: 16 CWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPEYLRTP 75
            RRG  E+D+I+  F +    ELS  +     +++  DD +LF W     +        
Sbjct: 13 ACRRGMLELDVIIMPFFEERFDELSEQQQQDFINLLTCDDPDLFTWVMKHGRSENEAHAN 72

Query: 76 IFKKIYDYYSNNLD 89
          +   I  + ++ L 
Sbjct: 73 MVDMIVAHNNSKLR 86


>gi|254785326|ref|YP_003072755.1| response regulator receiver domain-containing protein
          [Teredinibacter turnerae T7901]
 gi|237685750|gb|ACR13014.1| response regulator receiver domain protein [Teredinibacter
          turnerae T7901]
          Length = 107

 Score = 61.6 bits (149), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 17/60 (28%), Positives = 34/60 (56%), Gaps = 1/60 (1%)

Query: 9  CRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKP 68
            ++ +   RRG  E+DL+L  F+++    L++ +  + E+++E +D +LF WF     P
Sbjct: 27 INRLRW-ASRRGMLELDLVLLPFLENHFHSLNAEDQQLFETLLECEDQDLFNWFLRKNLP 85


>gi|326794159|ref|YP_004311979.1| hypothetical protein Marme_0868 [Marinomonas mediterranea MMB-1]
 gi|326544923|gb|ADZ90143.1| protein of unknown function DUF339 [Marinomonas mediterranea
          MMB-1]
          Length = 91

 Score = 61.6 bits (149), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 20/72 (27%), Positives = 34/72 (47%), Gaps = 2/72 (2%)

Query: 10 RKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPP 69
          +++ + C RRG  E+DL+L  F+D   L L   +      +I+ +D  +F WF   ++ P
Sbjct: 11 KRLKWHC-RRGMLELDLLLEPFLDEVFLTLDEEDQKRFYKLIQCEDQEIFPWFM-QKEVP 68

Query: 70 EYLRTPIFKKIY 81
          E         I 
Sbjct: 69 EDPDLARIVDII 80


>gi|92114273|ref|YP_574201.1| hypothetical protein Csal_2151 [Chromohalobacter salexigens DSM
          3043]
 gi|91797363|gb|ABE59502.1| protein of unknown function DUF339 [Chromohalobacter salexigens
          DSM 3043]
          Length = 92

 Score = 61.2 bits (148), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 20/89 (22%), Positives = 43/89 (48%), Gaps = 1/89 (1%)

Query: 6  NLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGM 65
          +   +++ +   RRG  E+DL+L  F++H   +L   +    +++I+++D +LF W    
Sbjct: 4  DATTKRLYWHS-RRGMWELDLLLIPFLEHRYPQLDDADKARYQALIDQEDQDLFIWLMRR 62

Query: 66 EKPPEYLRTPIFKKIYDYYSNNLDRKNML 94
          + P +     I + I DY     + +   
Sbjct: 63 DWPSDPELRRIVQMIVDYAETTSNAQYRT 91


>gi|242240708|ref|YP_002988889.1| hypothetical protein Dd703_3305 [Dickeya dadantii Ech703]
 gi|242132765|gb|ACS87067.1| protein of unknown function DUF339 [Dickeya dadantii Ech703]
          Length = 88

 Score = 61.2 bits (148), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 17/78 (21%), Positives = 35/78 (44%)

Query: 5  MNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTG 64
          M++  +  ++   RRG RE+D+ +  F +H    L+  +      +++ DD +LF W   
Sbjct: 1  MDIDNKARIHWACRRGMRELDISIMPFFEHEYDTLNDDDKHHFVRLLQCDDPDLFNWLMN 60

Query: 65 MEKPPEYLRTPIFKKIYD 82
            +P +     +   I  
Sbjct: 61 HGEPADPDLKRMVSLIQA 78


>gi|114320492|ref|YP_742175.1| hypothetical protein Mlg_1336 [Alkalilimnicola ehrlichii MLHE-1]
 gi|114226886|gb|ABI56685.1| protein of unknown function DUF339 [Alkalilimnicola ehrlichii
          MLHE-1]
          Length = 76

 Score = 61.2 bits (148), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 17/73 (23%), Positives = 37/73 (50%), Gaps = 1/73 (1%)

Query: 10 RKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPP 69
          +++ +RC RRGT+E+D++   F+      L+  E    E +++ +D  L  W     +P 
Sbjct: 2  KRLRWRC-RRGTKELDILFERFLAKGYGALTDSERVTFERLLDCEDDQLQAWLLTDRRPT 60

Query: 70 EYLRTPIFKKIYD 82
          +     + ++I +
Sbjct: 61 DGALDALVQRIRN 73


>gi|163752425|ref|ZP_02159617.1| hypothetical protein KT99_03484 [Shewanella benthica KT99]
 gi|161327684|gb|EDP98876.1| hypothetical protein KT99_03484 [Shewanella benthica KT99]
          Length = 66

 Score = 61.2 bits (148), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 16/61 (26%), Positives = 29/61 (47%)

Query: 21 TREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPEYLRTPIFKKI 80
            E+D+I   FV+ +  +LS     +   ++E +D  LF WF G E+ P+     +   +
Sbjct: 1  MLELDVIFQPFVERYYEQLSVKNKEVFVRLLEGEDPELFAWFMGHEQCPDPELAEMVVLV 60

Query: 81 Y 81
           
Sbjct: 61 R 61


>gi|192361870|ref|YP_001982678.1| TPR repeat family protein [Cellvibrio japonicus Ueda107]
 gi|190688035|gb|ACE85713.1| TPR repeat family protein [Cellvibrio japonicus Ueda107]
          Length = 81

 Score = 60.8 bits (147), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 25/84 (29%), Positives = 39/84 (46%), Gaps = 5/84 (5%)

Query: 9  CRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKP 68
            ++ +   RRG  E+DLIL  F++     L   +     +++EE D +LF WF   E P
Sbjct: 3  INRLFWGS-RRGMLELDLILLPFLERVYPGLEQADKERYWALLEEQDQDLFAWFLRRENP 61

Query: 69 PEYLRTPIFKKIYDYYSNNLDRKN 92
          P    T   ++I D    N   +N
Sbjct: 62 P----TAELQRIVDIIRANTGLQN 81


>gi|238759288|ref|ZP_04620454.1| hypothetical protein yaldo0001_5150 [Yersinia aldovae ATCC 35236]
 gi|238702449|gb|EEP95000.1| hypothetical protein yaldo0001_5150 [Yersinia aldovae ATCC 35236]
          Length = 88

 Score = 60.8 bits (147), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 20/72 (27%), Positives = 34/72 (47%), Gaps = 1/72 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          +I +   RRG RE+D+ +  F ++    LS  E  +   ++E DD +LF W     +P +
Sbjct: 8  RIHW-ACRRGMRELDISIMPFFEYEYDGLSDHEKYVFIRLLECDDPDLFNWLMNHGEPQD 66

Query: 71 YLRTPIFKKIYD 82
               + K I  
Sbjct: 67 SDLRQMVKLIQT 78


>gi|90580317|ref|ZP_01236124.1| hypothetical protein VAS14_20336 [Vibrio angustum S14]
 gi|90438619|gb|EAS63803.1| hypothetical protein VAS14_20336 [Vibrio angustum S14]
          Length = 86

 Score = 60.8 bits (147), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 17/74 (22%), Positives = 31/74 (41%)

Query: 16 CWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPEYLRTP 75
            RRG  E+D+I+  F +    ELS  +     +++  DD +LF W     +        
Sbjct: 13 ACRRGMLELDVIIMPFFEERFDELSEQQQQDFINLLTCDDPDLFTWVMKHGRSENEAHAN 72

Query: 76 IFKKIYDYYSNNLD 89
          +   I  + ++ L 
Sbjct: 73 MVDMIVAHNNSKLR 86


>gi|332970367|gb|EGK09359.1| TPR repeat protein [Kingella kingae ATCC 23330]
          Length = 82

 Score = 60.8 bits (147), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 22/82 (26%), Positives = 39/82 (47%), Gaps = 1/82 (1%)

Query: 1  MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
          M +   +  R+I ++  RRG  E+D++L  F +     LS  EL++L  I+  +D +   
Sbjct: 1  MAQFNEIAKRRIRFQ-MRRGLLELDIVLKRFAEKEFSTLSDEELSVLVDILALEDQDFLA 59

Query: 61 WFTGMEKPPEYLRTPIFKKIYD 82
          +    + P      PI +KI  
Sbjct: 60 FINQYDTPERQDFLPILEKIRA 81


>gi|226941335|ref|YP_002796409.1| SdhB [Laribacter hongkongensis HLHK9]
 gi|226716262|gb|ACO75400.1| SdhB [Laribacter hongkongensis HLHK9]
          Length = 319

 Score = 60.8 bits (147), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 17/74 (22%), Positives = 30/74 (40%), Gaps = 1/74 (1%)

Query: 9   CRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKP 68
            ++I +   RRG  EMDL+L  F+D     L   E+     ++E  D+   +   G    
Sbjct: 246 RQRIRWHS-RRGLLEMDLVLTRFLDRHFDTLGDEEMDAYVRLLELIDTEFLEIVNGKRDV 304

Query: 69  PEYLRTPIFKKIYD 82
            +    P+   +  
Sbjct: 305 DDPALQPLVDMLRA 318


>gi|311278183|ref|YP_003940414.1| hypothetical protein Entcl_0856 [Enterobacter cloacae SCF1]
 gi|308747378|gb|ADO47130.1| protein of unknown function DUF339 [Enterobacter cloacae SCF1]
          Length = 88

 Score = 60.8 bits (147), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 19/72 (26%), Positives = 34/72 (47%), Gaps = 1/72 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          +I +   RRG RE+D+ +  F ++    LS  +  +   ++E DD +LF W     KP +
Sbjct: 8  RIHW-ACRRGMRELDISIMPFFEYEYDTLSDSDKQLFIRLLECDDPDLFNWLMNHGKPAD 66

Query: 71 YLRTPIFKKIYD 82
               + + I  
Sbjct: 67 AELQRMVQLIQT 78


>gi|331005233|ref|ZP_08328626.1| hypothetical protein IMCC1989_1373 [gamma proteobacterium
          IMCC1989]
 gi|330420976|gb|EGG95249.1| hypothetical protein IMCC1989_1373 [gamma proteobacterium
          IMCC1989]
          Length = 82

 Score = 60.8 bits (147), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 19/61 (31%), Positives = 31/61 (50%), Gaps = 1/61 (1%)

Query: 8  QCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEK 67
             ++ +   RRG  E+DL+L  F++     LS  +  +   ++EE D +LF WF   E 
Sbjct: 2  HKNRLFW-SSRRGMLELDLVLMPFIEKVYSSLSEADQQLYHLLLEEQDQDLFTWFMRRED 60

Query: 68 P 68
          P
Sbjct: 61 P 61


>gi|182680908|ref|YP_001829068.1| hypothetical protein XfasM23_0346 [Xylella fastidiosa M23]
 gi|182631018|gb|ACB91794.1| protein of unknown function DUF339 [Xylella fastidiosa M23]
 gi|307579376|gb|ADN63345.1| hypothetical protein XFLM_07145 [Xylella fastidiosa subsp.
          fastidiosa GB514]
          Length = 82

 Score = 60.8 bits (147), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 16/79 (20%), Positives = 34/79 (43%), Gaps = 1/79 (1%)

Query: 4  NMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFT 63
          +   +  K+ +R  RRG RE+D +   ++ H   + S  E  +    ++ +D  L++W  
Sbjct: 2  DKPAELNKLRWRS-RRGMRELDHLFDRYLSHCWAQASEAERGVFLRFLDCEDDKLWRWLM 60

Query: 64 GMEKPPEYLRTPIFKKIYD 82
          G E   +     +   +  
Sbjct: 61 GYEVCQDASFAALIVTMRA 79


>gi|293394598|ref|ZP_06638892.1| TPR repeat protein [Serratia odorifera DSM 4582]
 gi|291422907|gb|EFE96142.1| TPR repeat protein [Serratia odorifera DSM 4582]
          Length = 88

 Score = 60.4 bits (146), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 18/77 (23%), Positives = 33/77 (42%), Gaps = 1/77 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          +I +   RRG RE+D+ +  F ++    LS  +  +   ++E DD +LF W      P +
Sbjct: 8  RIHW-ACRRGMRELDISIMPFFEYEYDSLSDKDKALFIRLLECDDPDLFNWLMNHGAPQD 66

Query: 71 YLRTPIFKKIYDYYSNN 87
               +   I     + 
Sbjct: 67 DELQRMVTLIQTRNKDR 83


>gi|49082492|gb|AAT50646.1| PA0760 [synthetic construct]
          Length = 85

 Score = 60.4 bits (146), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 17/80 (21%), Positives = 36/80 (45%), Gaps = 1/80 (1%)

Query: 6  NLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGM 65
            + +++ +   RRG  E+D++L  FV      L + +      ++E +D ++F WF   
Sbjct: 4  ETELKRLYWHS-RRGMLELDVLLVPFVQEVYPGLDAEDQARFRKLLECEDQDMFGWFMQR 62

Query: 66 EKPPEYLRTPIFKKIYDYYS 85
           +P +     + + I D   
Sbjct: 63 GEPEDADLRRMVRMILDRVQ 82


>gi|320540114|ref|ZP_08039769.1| putative conserved protein [Serratia symbiotica str. Tucson]
 gi|320029780|gb|EFW11804.1| putative conserved protein [Serratia symbiotica str. Tucson]
          Length = 88

 Score = 60.4 bits (146), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 17/72 (23%), Positives = 33/72 (45%), Gaps = 1/72 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          +I +   RRG RE+D+ +  F ++   +L+  +  +   ++E DD +LF W      P +
Sbjct: 8  RIHW-ACRRGMRELDISIMPFFEYEYDQLNDTDKALFIRLLECDDPDLFNWLMNHGAPED 66

Query: 71 YLRTPIFKKIYD 82
               +   I  
Sbjct: 67 SELQRMVALIQS 78


>gi|300722121|ref|YP_003711403.1| hypothetical protein XNC1_1127 [Xenorhabdus nematophila ATCC
          19061]
 gi|297628620|emb|CBJ89198.1| conserved hypothetical protein [Xenorhabdus nematophila ATCC
          19061]
          Length = 88

 Score = 60.4 bits (146), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 20/86 (23%), Positives = 39/86 (45%), Gaps = 3/86 (3%)

Query: 5  MNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTG 64
          M++  +  ++   RRG RE+D+ +  F ++    LS  +  +   ++E  D +LF W   
Sbjct: 1  MDIDNKARIHWACRRGMRELDISVMPFFEYEYDSLSDEDKRVFVRLLECPDPDLFNWLMN 60

Query: 65 MEKPPEYLRTPIFKKIYDYYSNNLDR 90
            +P       +F+ +    S N  R
Sbjct: 61 HGRP---EDDELFRMVRLIQSRNQAR 83


>gi|212710032|ref|ZP_03318160.1| hypothetical protein PROVALCAL_01085 [Providencia alcalifaciens
          DSM 30120]
 gi|212687239|gb|EEB46767.1| hypothetical protein PROVALCAL_01085 [Providencia alcalifaciens
          DSM 30120]
          Length = 99

 Score = 60.4 bits (146), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 19/77 (24%), Positives = 36/77 (46%), Gaps = 1/77 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          +I +   RRG RE+D+ +  F ++   EL+  +  +   ++E  D +LF W     +P +
Sbjct: 19 RIHW-ACRRGMRELDISIMPFFEYEYDELTDHDKRIFVRLLECPDPDLFNWLMNHGRPED 77

Query: 71 YLRTPIFKKIYDYYSNN 87
               + K I +   N 
Sbjct: 78 EELFSMIKLIQERNKNR 94


>gi|269140275|ref|YP_003296976.1| hypothetical protein ETAE_2932 [Edwardsiella tarda EIB202]
 gi|267985936|gb|ACY85765.1| hypothetical protein ETAE_2932 [Edwardsiella tarda EIB202]
 gi|281181714|dbj|BAI58036.1| hypothetical protein [Edwardsiella tarda]
 gi|304560102|gb|ADM42766.1| YgfY [Edwardsiella tarda FL6-60]
          Length = 88

 Score = 60.0 bits (145), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 18/67 (26%), Positives = 28/67 (41%)

Query: 16 CWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPEYLRTP 75
            RRG RE+D+ +  F +H    L+  +      ++  DD  LFKW     KP +     
Sbjct: 12 ACRRGMRELDIAIMPFFEHEYDALNDADKQTFVRLLACDDPELFKWLMNQGKPDDADLAR 71

Query: 76 IFKKIYD 82
          +   I  
Sbjct: 72 MITLIQT 78


>gi|15595957|ref|NP_249451.1| hypothetical protein PA0760 [Pseudomonas aeruginosa PAO1]
 gi|107100220|ref|ZP_01364138.1| hypothetical protein PaerPA_01001243 [Pseudomonas aeruginosa
          PACS2]
 gi|116048675|ref|YP_792525.1| hypothetical protein PA14_54470 [Pseudomonas aeruginosa
          UCBPP-PA14]
 gi|152985307|ref|YP_001350102.1| hypothetical protein PSPA7_4760 [Pseudomonas aeruginosa PA7]
 gi|218893297|ref|YP_002442166.1| hypothetical protein PLES_45831 [Pseudomonas aeruginosa LESB58]
 gi|254239122|ref|ZP_04932445.1| conserved hypothetical protein [Pseudomonas aeruginosa C3719]
 gi|254245014|ref|ZP_04938336.1| conserved hypothetical protein [Pseudomonas aeruginosa 2192]
 gi|296390891|ref|ZP_06880366.1| hypothetical protein PaerPAb_22170 [Pseudomonas aeruginosa PAb1]
 gi|313105581|ref|ZP_07791847.1| hypothetical protein PA39016_000080017 [Pseudomonas aeruginosa
          39016]
 gi|81175090|sp|Q9I5G9|Y760_PSEAE RecName: Full=UPF0350 protein PA0760
 gi|9946648|gb|AAG04149.1|AE004511_2 conserved hypothetical protein [Pseudomonas aeruginosa PAO1]
 gi|115583896|gb|ABJ09911.1| conserved hypothetical protein [Pseudomonas aeruginosa
          UCBPP-PA14]
 gi|126171053|gb|EAZ56564.1| conserved hypothetical protein [Pseudomonas aeruginosa C3719]
 gi|126198392|gb|EAZ62455.1| conserved hypothetical protein [Pseudomonas aeruginosa 2192]
 gi|150960465|gb|ABR82490.1| conserved hypothetical protein [Pseudomonas aeruginosa PA7]
 gi|218773525|emb|CAW29337.1| conserved hypothetical protein [Pseudomonas aeruginosa LESB58]
 gi|310878349|gb|EFQ36943.1| hypothetical protein PA39016_000080017 [Pseudomonas aeruginosa
          39016]
          Length = 84

 Score = 60.0 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 17/80 (21%), Positives = 36/80 (45%), Gaps = 1/80 (1%)

Query: 6  NLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGM 65
            + +++ +   RRG  E+D++L  FV      L + +      ++E +D ++F WF   
Sbjct: 4  ETELKRLYWHS-RRGMLELDVLLVPFVQEVYPGLDAEDQARFRKLLECEDQDMFGWFMQR 62

Query: 66 EKPPEYLRTPIFKKIYDYYS 85
           +P +     + + I D   
Sbjct: 63 GEPEDADLRRMVRMILDRVQ 82


>gi|74227640|dbj|BAE35674.1| unnamed protein product [Mus musculus]
          Length = 80

 Score = 60.0 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 10/59 (16%), Positives = 28/59 (47%), Gaps = 2/59 (3%)

Query: 31 FVDHFILELSSVELTMLESIIEE--DDSNLFKWFTGMEKPPEYLRTPIFKKIYDYYSNN 87
          F   ++  ++  +L + + +I E  +D +++ W T  +  PE     + + + ++  N 
Sbjct: 3  FAKEYLHNMTEKQLNLYDRLINEPSNDWDIYYWATEAKPAPEIFENEVMELLREFAKNK 61


>gi|240950121|ref|ZP_04754414.1| hypothetical protein AM305_02953 [Actinobacillus minor NM305]
 gi|240295390|gb|EER46163.1| hypothetical protein AM305_02953 [Actinobacillus minor NM305]
          Length = 82

 Score = 60.0 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 14/69 (20%), Positives = 26/69 (37%)

Query: 16 CWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPEYLRTP 75
            RRG RE+D ++  F  +    L+  +      ++   D  LF+W       P    T 
Sbjct: 12 ACRRGMRELDKMIMPFYQNHFESLTEAQQQTFAEMLTYPDPELFRWVMHQLPAPTQKMTD 71

Query: 76 IFKKIYDYY 84
          + + +    
Sbjct: 72 LIELMRSKI 80


>gi|119713594|gb|ABL97645.1| hypothetical protein MBMO_EB0-39H12.0021 [uncultured marine
          bacterium EB0_39H12]
          Length = 87

 Score = 59.6 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 23/85 (27%), Positives = 42/85 (49%), Gaps = 1/85 (1%)

Query: 5  MNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTG 64
          MN   +KI+++C RRG  E+D I   FV++   ELS+ E+     ++  +D ++F     
Sbjct: 1  MNELEKKILWQC-RRGLWELDAIFIPFVENNFAELSNEEIDSFRELLSFEDIDIFDILVN 59

Query: 65 MEKPPEYLRTPIFKKIYDYYSNNLD 89
           +   +     I  KI  Y+ + + 
Sbjct: 60 KKPFEDTTLKGIVHKIISYHESRIG 84


>gi|238921203|ref|YP_002934718.1| hypothetical protein NT01EI_3345 [Edwardsiella ictaluri 93-146]
 gi|238870772|gb|ACR70483.1| conserved hypothetical protein [Edwardsiella ictaluri 93-146]
          Length = 88

 Score = 59.6 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 18/67 (26%), Positives = 28/67 (41%)

Query: 16 CWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPEYLRTP 75
            RRG RE+D+ +  F +H    L+  +      ++  DD  LFKW     KP +     
Sbjct: 12 ACRRGMRELDIAIMPFFEHEYDALNDADKQTFVRLLSCDDPELFKWLMNQGKPDDTDLAR 71

Query: 76 IFKKIYD 82
          +   I  
Sbjct: 72 MITLIQT 78


>gi|296104559|ref|YP_003614705.1| hypothetical protein ECL_04223 [Enterobacter cloacae subsp.
          cloacae ATCC 13047]
 gi|295059018|gb|ADF63756.1| hypothetical protein ECL_04223 [Enterobacter cloacae subsp.
          cloacae ATCC 13047]
          Length = 88

 Score = 59.6 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 21/86 (24%), Positives = 41/86 (47%), Gaps = 3/86 (3%)

Query: 5  MNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTG 64
          M++  +  ++   RRG RE+D+ +  F ++    LS  +  +   ++E DD +LF W   
Sbjct: 1  MDINNKARIHWACRRGMRELDISIMPFFEYEYDSLSDEDKRLFVRLLESDDPDLFNWLMN 60

Query: 65 MEKPPEYLRTPIFKKIYDYYSNNLDR 90
            KP     T + + +    + N +R
Sbjct: 61 HGKP---ADTELQRMVQLIQTRNRER 83


>gi|71275599|ref|ZP_00651884.1| Protein of unknown function DUF339 [Xylella fastidiosa Dixon]
 gi|71899496|ref|ZP_00681653.1| Protein of unknown function DUF339 [Xylella fastidiosa Ann-1]
 gi|170729593|ref|YP_001775026.1| hypothetical protein Xfasm12_0382 [Xylella fastidiosa M12]
 gi|71163490|gb|EAO13207.1| Protein of unknown function DUF339 [Xylella fastidiosa Dixon]
 gi|71730716|gb|EAO32790.1| Protein of unknown function DUF339 [Xylella fastidiosa Ann-1]
 gi|167964386|gb|ACA11396.1| conserved hypothetical protein [Xylella fastidiosa M12]
          Length = 82

 Score = 59.6 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 16/79 (20%), Positives = 34/79 (43%), Gaps = 1/79 (1%)

Query: 4  NMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFT 63
          +   +  K+ +R  RRG RE+D +   ++ H   + S  E  +    ++ +D  L++W  
Sbjct: 2  DKPAELNKLRWRS-RRGMRELDHLFDRYLSHCWAQASEAERGVFLRFLDCEDDKLWRWLI 60

Query: 64 GMEKPPEYLRTPIFKKIYD 82
          G E   +     +   +  
Sbjct: 61 GYEVCQDASFAALIVTMRA 79


>gi|152971843|ref|YP_001336952.1| hypothetical protein KPN_03325 [Klebsiella pneumoniae subsp.
          pneumoniae MGH 78578]
 gi|206576457|ref|YP_002236646.1| TPR repeat protein [Klebsiella pneumoniae 342]
 gi|238896437|ref|YP_002921175.1| hypothetical protein KP1_4613 [Klebsiella pneumoniae NTUH-K2044]
 gi|288933623|ref|YP_003437682.1| hypothetical protein Kvar_0740 [Klebsiella variicola At-22]
 gi|290511311|ref|ZP_06550680.1| ygfY [Klebsiella sp. 1_1_55]
 gi|330010969|ref|ZP_08306934.1| TPR repeat region [Klebsiella sp. MS 92-3]
 gi|150956692|gb|ABR78722.1| hypothetical protein KPN_03325 [Klebsiella pneumoniae subsp.
          pneumoniae MGH 78578]
 gi|206565515|gb|ACI07291.1| TPR repeat protein [Klebsiella pneumoniae 342]
 gi|238548757|dbj|BAH65108.1| hypothetical protein KP1_4613 [Klebsiella pneumoniae subsp.
          pneumoniae NTUH-K2044]
 gi|288888352|gb|ADC56670.1| protein of unknown function DUF339 [Klebsiella variicola At-22]
 gi|289776304|gb|EFD84303.1| ygfY [Klebsiella sp. 1_1_55]
 gi|328534346|gb|EGF60956.1| TPR repeat region [Klebsiella sp. MS 92-3]
          Length = 88

 Score = 59.6 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 19/72 (26%), Positives = 33/72 (45%), Gaps = 1/72 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          +I +   RRG RE+D+ +  F ++    LS  +  +   ++E DD +LF W     KP +
Sbjct: 8  RIHW-ACRRGMRELDISIMPFFEYEYDTLSDADKQLFIRLLENDDPDLFNWLMNHGKPAD 66

Query: 71 YLRTPIFKKIYD 82
               +   I  
Sbjct: 67 AELQRMVTLIQT 78


>gi|319786913|ref|YP_004146388.1| hypothetical protein Psesu_1310 [Pseudoxanthomonas suwonensis
          11-1]
 gi|317465425|gb|ADV27157.1| protein of unknown function DUF339 [Pseudoxanthomonas suwonensis
          11-1]
          Length = 97

 Score = 59.6 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 15/63 (23%), Positives = 29/63 (46%)

Query: 20 GTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPEYLRTPIFKK 79
          G RE+D +   ++ H   + S  E  +   +++ +D  L++WF G E  P+     +   
Sbjct: 32 GMRELDQLFERWLAHRWEQASDSERAVFLRMLDCEDDRLWRWFMGYEACPDAELAGLIAS 91

Query: 80 IYD 82
          I  
Sbjct: 92 IRA 94


>gi|322831503|ref|YP_004211530.1| hypothetical protein Rahaq_0776 [Rahnella sp. Y9602]
 gi|321166704|gb|ADW72403.1| protein of unknown function DUF339 [Rahnella sp. Y9602]
          Length = 94

 Score = 59.6 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 19/81 (23%), Positives = 36/81 (44%)

Query: 2  KKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKW 61
          K  +++  R  V+   RRG RE+D+ +  F ++    LS  +  +   ++  DD +LF W
Sbjct: 4  KNQLDINNRSRVHWACRRGMRELDISIMPFFEYEYDSLSETDKEVFVRLLTCDDPDLFNW 63

Query: 62 FTGMEKPPEYLRTPIFKKIYD 82
               +P +     +   I  
Sbjct: 64 LMNHGEPKDTELQRMVALIQT 84


>gi|325982410|ref|YP_004294812.1| hypothetical protein NAL212_1784 [Nitrosomonas sp. AL212]
 gi|325531929|gb|ADZ26650.1| protein of unknown function DUF339 [Nitrosomonas sp. AL212]
          Length = 77

 Score = 59.3 bits (143), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 16/56 (28%), Positives = 30/56 (53%), Gaps = 1/56 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGME 66
          +  +RC RRG  E+D++L  F+D    +L    L   E ++   D++L+   +G +
Sbjct: 6  RARWRC-RRGMLELDIVLQRFMDQNYRQLDETGLLQFERLLALPDNDLWDLISGKQ 60


>gi|300718206|ref|YP_003743009.1| hypothetical protein [Erwinia billingiae Eb661]
 gi|299064042|emb|CAX61162.1| Conserved uncharacterized protein [Erwinia billingiae Eb661]
          Length = 88

 Score = 59.3 bits (143), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 15/84 (17%), Positives = 30/84 (35%), Gaps = 5/84 (5%)

Query: 9  CRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKP 68
            ++ +   RRG  E+D+ +  F       L   +      ++E  D +LF W     +P
Sbjct: 6  RARVHW-ACRRGMLELDIAIMPFFKFEYDTLDDNDKQQFVRLLESPDPDLFNWLMNHGEP 64

Query: 69 PEYLRTPIFKKIYDYYSNNLDRKN 92
                   K+I +       ++ 
Sbjct: 65 ----DDAELKRIVNLIQQRNQQRG 84


>gi|304310533|ref|YP_003810131.1| hypothetical protein HDN1F_08910 [gamma proteobacterium HdN1]
 gi|301796266|emb|CBL44474.1| conserved hypothetical protein [gamma proteobacterium HdN1]
          Length = 86

 Score = 59.3 bits (143), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 20/77 (25%), Positives = 42/77 (54%), Gaps = 1/77 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          +I + C RRG +E + +L  F D +  +L+  +      +++E D +LF+WFT   +P +
Sbjct: 10 RIRWDC-RRGIKEAEYLLLPFFDRYFADLTLEQKRAFVLLLKEQDVDLFEWFTLRSEPED 68

Query: 71 YLRTPIFKKIYDYYSNN 87
           +   + + I D  +++
Sbjct: 69 EVLRNMVRLIMDRCASS 85


>gi|88812340|ref|ZP_01127590.1| hypothetical protein NB231_01099 [Nitrococcus mobilis Nb-231]
 gi|88790347|gb|EAR21464.1| hypothetical protein NB231_01099 [Nitrococcus mobilis Nb-231]
          Length = 79

 Score = 59.3 bits (143), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 21/75 (28%), Positives = 38/75 (50%), Gaps = 2/75 (2%)

Query: 7  LQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGME 66
           +  ++ +RC RRGTRE++ +L  F+DH +  L   +L   E +++ +D  L  W    +
Sbjct: 2  SEIARLRWRC-RRGTRELEYLLQRFLDHHL-SLDEPDLRAFERLLDCEDDRLIDWLIRGD 59

Query: 67 KPPEYLRTPIFKKIY 81
           P +     I + I 
Sbjct: 60 DPADGQLCAIIRHIR 74


>gi|262042538|ref|ZP_06015695.1| TPR repeat protein [Klebsiella pneumoniae subsp. rhinoscleromatis
          ATCC 13884]
 gi|259040098|gb|EEW41212.1| TPR repeat protein [Klebsiella pneumoniae subsp. rhinoscleromatis
          ATCC 13884]
          Length = 88

 Score = 58.9 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 20/80 (25%), Positives = 37/80 (46%), Gaps = 4/80 (5%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          +I +   RRG RE+D+ +  F ++    LS  +  +   ++E DD +LF W     KP  
Sbjct: 8  RIHW-ACRRGMRELDISIMPFFEYEYDTLSDADKQLFIRLLENDDPDLFNWLMNHGKP-- 64

Query: 71 YLRTPIFKKIYDYYSNNLDR 90
               + + +    + N +R
Sbjct: 65 -ADAELQRMVILIQTRNRER 83


>gi|270264910|ref|ZP_06193174.1| hypothetical protein SOD_j01260 [Serratia odorifera 4Rx13]
 gi|270041208|gb|EFA14308.1| hypothetical protein SOD_j01260 [Serratia odorifera 4Rx13]
          Length = 88

 Score = 58.9 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 18/77 (23%), Positives = 34/77 (44%), Gaps = 1/77 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          +I +   RRG RE+D+ +  F +H   +L+  +  +   ++E DD +LF W      P +
Sbjct: 8  RIHW-ACRRGMRELDISIMPFFEHEYDQLNDTDKALFIRLLESDDPDLFNWLMNHGAPQD 66

Query: 71 YLRTPIFKKIYDYYSNN 87
               +   I     + 
Sbjct: 67 SELQRMVTLIQTRNKDR 83


>gi|93006842|ref|YP_581279.1| hypothetical protein Pcryo_2018 [Psychrobacter cryohalolentis K5]
 gi|92394520|gb|ABE75795.1| protein of unknown function DUF339 [Psychrobacter cryohalolentis
          K5]
          Length = 93

 Score = 58.9 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 17/80 (21%), Positives = 36/80 (45%), Gaps = 1/80 (1%)

Query: 8  QCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEK 67
          + R+I+Y+  RRG +E+D     ++    L   + E      ++  +D +L  +FT   +
Sbjct: 12 EQRRIIYQA-RRGLKELDFYFEPYIKELYLTAEAAEQESFAQMLTHEDPDLLDYFTNQSR 70

Query: 68 PPEYLRTPIFKKIYDYYSNN 87
          P +     +  KI  +  + 
Sbjct: 71 PEDEAIWELVNKIKTWRHSK 90


>gi|146281604|ref|YP_001171757.1| hypothetical protein PST_1220 [Pseudomonas stutzeri A1501]
 gi|145569809|gb|ABP78915.1| conserved hypothetical protein [Pseudomonas stutzeri A1501]
 gi|327479783|gb|AEA83093.1| conserved hypothetical protein [Pseudomonas stutzeri DSM 4166]
          Length = 84

 Score = 58.9 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 17/79 (21%), Positives = 35/79 (44%), Gaps = 1/79 (1%)

Query: 7  LQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGME 66
           +  ++ ++  RRG  E+D++L  FV      L   +      ++  +D ++F WF   E
Sbjct: 5  SELNRLFWQS-RRGMLELDVLLVPFVKEVYPGLDEEDQRRYRKLLSCEDQDMFGWFMQRE 63

Query: 67 KPPEYLRTPIFKKIYDYYS 85
          +P +     + + I D   
Sbjct: 64 EPEDEDLRRMVRMILDRVQ 82


>gi|261342300|ref|ZP_05970158.1| TPR repeat protein [Enterobacter cancerogenus ATCC 35316]
 gi|288315641|gb|EFC54579.1| TPR repeat protein [Enterobacter cancerogenus ATCC 35316]
          Length = 88

 Score = 58.9 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 21/86 (24%), Positives = 41/86 (47%), Gaps = 3/86 (3%)

Query: 5  MNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTG 64
          M++  +  ++   RRG RE+D+ +  F ++    LS  +  +   ++E DD +LF W   
Sbjct: 1  MDINNKARIHWACRRGMRELDISIMPFFEYEYDTLSDDDKRLFVRLLESDDPDLFNWLMN 60

Query: 65 MEKPPEYLRTPIFKKIYDYYSNNLDR 90
            KP     T + + +    + N +R
Sbjct: 61 HGKP---ADTELQRMVQLIQTRNRER 83


>gi|183599844|ref|ZP_02961337.1| hypothetical protein PROSTU_03361 [Providencia stuartii ATCC
          25827]
 gi|188022116|gb|EDU60156.1| hypothetical protein PROSTU_03361 [Providencia stuartii ATCC
          25827]
          Length = 88

 Score = 58.9 bits (142), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 19/83 (22%), Positives = 38/83 (45%)

Query: 5  MNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTG 64
          M+++ +  ++   RRG RE+D+ +  F ++    LS  +      ++E  D +LF W   
Sbjct: 1  MDIENKARIHWACRRGMRELDISIMPFFEYEYEGLSDKDKRTFVRLLECADPDLFNWLMN 60

Query: 65 MEKPPEYLRTPIFKKIYDYYSNN 87
            +P +     + K I +   N 
Sbjct: 61 HGRPDDDELFGMVKLIQERNKNR 83


>gi|238754567|ref|ZP_04615921.1| hypothetical protein yruck0001_4350 [Yersinia ruckeri ATCC 29473]
 gi|238707198|gb|EEP99561.1| hypothetical protein yruck0001_4350 [Yersinia ruckeri ATCC 29473]
          Length = 88

 Score = 58.5 bits (141), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 18/72 (25%), Positives = 33/72 (45%), Gaps = 1/72 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          +I +   RRG RE+D+ +  F +H    L+  +  +   ++  DD +LF W     +P +
Sbjct: 8  RIHW-ACRRGMRELDISIMPFFEHEYDTLNDNDKRVFIRLLTSDDPDLFNWLMNHGEPQD 66

Query: 71 YLRTPIFKKIYD 82
               + K I  
Sbjct: 67 SELKRMVKLIQT 78


>gi|146306496|ref|YP_001186961.1| hypothetical protein Pmen_1464 [Pseudomonas mendocina ymp]
 gi|145574697|gb|ABP84229.1| protein of unknown function DUF339 [Pseudomonas mendocina ymp]
          Length = 84

 Score = 58.5 bits (141), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 17/79 (21%), Positives = 35/79 (44%), Gaps = 1/79 (1%)

Query: 7  LQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGME 66
           +  ++ +   RRG  E+D++L  FV      L + +      ++E +D ++F WF    
Sbjct: 5  SELNRLFWHS-RRGMLELDVLLVPFVKEVYPSLDAEDQARYRKLLECEDQDMFGWFMQRG 63

Query: 67 KPPEYLRTPIFKKIYDYYS 85
          +P +     + + I D   
Sbjct: 64 EPEDADLKRMVRMILDRVQ 82


>gi|71066291|ref|YP_265018.1| hypothetical protein Psyc_1736 [Psychrobacter arcticus 273-4]
 gi|81175068|sp|Q4FQX4|Y1736_PSYA2 RecName: Full=UPF0350 protein Psyc_1736
 gi|71039276|gb|AAZ19584.1| conserved hypothetical protein [Psychrobacter arcticus 273-4]
          Length = 93

 Score = 58.5 bits (141), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 17/80 (21%), Positives = 36/80 (45%), Gaps = 1/80 (1%)

Query: 8  QCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEK 67
          + R+I+Y+  RRG +E+D     ++    L   + E      ++  +D +L  +FT   +
Sbjct: 12 EQRRIIYQA-RRGLKELDFYFEPYIKELYLTAEAAEQESFAQMLTHEDPDLLDYFTNQSR 70

Query: 68 PPEYLRTPIFKKIYDYYSNN 87
          P +     +  KI  +  + 
Sbjct: 71 PEDDAMWALVNKIKTWRHSK 90


>gi|295097433|emb|CBK86523.1| Uncharacterized conserved protein [Enterobacter cloacae subsp.
          cloacae NCTC 9394]
          Length = 88

 Score = 58.5 bits (141), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 21/80 (26%), Positives = 38/80 (47%), Gaps = 4/80 (5%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          +I +   RRG RE+D+ +  F ++    LS  +  +   ++E DD +LF W     KP  
Sbjct: 8  RIHW-ACRRGMRELDISIMPFFEYEYDSLSDDDKRLFVRLLESDDPDLFNWLMNHGKP-- 64

Query: 71 YLRTPIFKKIYDYYSNNLDR 90
             T + + +    + N +R
Sbjct: 65 -ADTELQRMVQLIQTRNQER 83


>gi|253988689|ref|YP_003040045.1| hypothetical protein PAU_01208 [Photorhabdus asymbiotica subsp.
          asymbiotica ATCC 43949]
 gi|211637987|emb|CAR66615.1| Conserved Hypothetical Protein [Photorhabdus asymbiotica subsp.
          asymbiotica ATCC 43949]
 gi|253780139|emb|CAQ83300.1| conserved hypothetical protein [Photorhabdus asymbiotica]
          Length = 88

 Score = 58.5 bits (141), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 22/86 (25%), Positives = 39/86 (45%), Gaps = 3/86 (3%)

Query: 5  MNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTG 64
          M++  +  ++   RRG RE+D+ +  F  +    LS  +  +   ++E  D +LF W   
Sbjct: 1  MDIDNKARIHWACRRGMRELDISIMPFFKYEYDSLSDDDKRLFIRLLECADPDLFNWLMN 60

Query: 65 MEKPPEYLRTPIFKKIYDYYSNNLDR 90
              PE     +F+ I    + N DR
Sbjct: 61 HG-CPE--DEELFRMIKLIQNRNKDR 83


>gi|32034926|ref|ZP_00135017.1| COG2938: Uncharacterized conserved protein [Actinobacillus
          pleuropneumoniae serovar 1 str. 4074]
 gi|126208985|ref|YP_001054210.1| hypothetical protein APL_1521 [Actinobacillus pleuropneumoniae
          L20]
 gi|126097777|gb|ABN74605.1| hypothetical protein APL_1521 [Actinobacillus pleuropneumoniae
          serovar 5b str. L20]
          Length = 82

 Score = 58.5 bits (141), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 20/74 (27%), Positives = 33/74 (44%), Gaps = 1/74 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          +I + C RRG RE+D ++  F      ELS  +     ++++  D  LF+WF      P 
Sbjct: 8  RIEWEC-RRGMRELDKMIMPFYKAHFDELSEAQQQTFVAMLKYTDPELFRWFMHQAPAPT 66

Query: 71 YLRTPIFKKIYDYY 84
             T + + I    
Sbjct: 67 QEMTDLIELIRSKI 80


>gi|253687039|ref|YP_003016229.1| hypothetical protein PC1_0638 [Pectobacterium carotovorum subsp.
          carotovorum PC1]
 gi|251753617|gb|ACT11693.1| protein of unknown function DUF339 [Pectobacterium carotovorum
          subsp. carotovorum PC1]
          Length = 88

 Score = 58.5 bits (141), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 21/80 (26%), Positives = 36/80 (45%), Gaps = 4/80 (5%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          +I +   RRG RE+D+ +  F +H    LS  +      +++ DD +LF W     +P  
Sbjct: 8  RIHW-ACRRGMRELDIAIMPFFEHDYDTLSDSDKRTFVRLLQSDDPDLFNWLMNHGEP-- 64

Query: 71 YLRTPIFKKIYDYYSNNLDR 90
               + + I    + N DR
Sbjct: 65 -KDGELKRMISLIQTRNKDR 83


>gi|83644622|ref|YP_433057.1| hypothetical protein HCH_01788 [Hahella chejuensis KCTC 2396]
 gi|83632665|gb|ABC28632.1| uncharacterized conserved protein [Hahella chejuensis KCTC 2396]
          Length = 86

 Score = 58.5 bits (141), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 18/76 (23%), Positives = 38/76 (50%), Gaps = 2/76 (2%)

Query: 6  NLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGM 65
          +++ +++ +   RRG  E+D++L  F+     EL   +      ++E +D+++F+WF   
Sbjct: 4  DVEYKRLFWHS-RRGMLELDVLLVPFLKEAYPELPDEDKARYRMLLECEDTDMFQWFM-Q 61

Query: 66 EKPPEYLRTPIFKKIY 81
          +  PE        KI 
Sbjct: 62 KSTPEDPDLARIVKII 77


>gi|88703562|ref|ZP_01101278.1| protein containing DUF339 and TPR repeat region [Congregibacter
          litoralis KT71]
 gi|88702276|gb|EAQ99379.1| protein containing DUF339 and TPR repeat region [Congregibacter
          litoralis KT71]
          Length = 86

 Score = 58.5 bits (141), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 21/78 (26%), Positives = 34/78 (43%), Gaps = 1/78 (1%)

Query: 5  MNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTG 64
          M+ + +++ +   RRG  E+DLIL  FV      L         S++   D  LF WF  
Sbjct: 1  MDEEHKRMRW-ASRRGMLELDLILEPFVRLHYPHLDEAGRERYRSLMSCQDQELFDWFLR 59

Query: 65 MEKPPEYLRTPIFKKIYD 82
           + P +     + + I D
Sbjct: 60 KQIPEDGEHAQMVQTILD 77


>gi|226328251|ref|ZP_03803769.1| hypothetical protein PROPEN_02144 [Proteus penneri ATCC 35198]
 gi|225202984|gb|EEG85338.1| hypothetical protein PROPEN_02144 [Proteus penneri ATCC 35198]
          Length = 93

 Score = 58.1 bits (140), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 18/74 (24%), Positives = 32/74 (43%)

Query: 16 CWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPEYLRTP 75
            RRG RE+D+ +  F ++    LS  +  +   ++E  D +LF W     +P +     
Sbjct: 14 ACRRGMRELDISIMPFFENEYDTLSDNDKALFVRLLECADPDLFNWLMNHGRPDDDELYY 73

Query: 76 IFKKIYDYYSNNLD 89
          + K I D     + 
Sbjct: 74 MVKLIQDRNKARMA 87


>gi|85059974|ref|YP_455676.1| hypothetical protein SG1996 [Sodalis glossinidius str.
          'morsitans']
 gi|84780494|dbj|BAE75271.1| conserved hypothetical protein [Sodalis glossinidius str.
          'morsitans']
          Length = 88

 Score = 58.1 bits (140), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 19/72 (26%), Positives = 31/72 (43%), Gaps = 1/72 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          +I +   RRG RE+D+ +  F +H    L   +      ++E DD +LF W     +P +
Sbjct: 8  RIHW-ACRRGMRELDIAIMPFFEHDFDALDDQDKQRFVRLLECDDPDLFYWLMNHGQPDD 66

Query: 71 YLRTPIFKKIYD 82
               I   I  
Sbjct: 67 GELRQIITMIQT 78


>gi|302421802|ref|XP_003008731.1| DUF339 domain-containing protein [Verticillium albo-atrum VaMs.102]
 gi|261351877|gb|EEY14305.1| DUF339 domain-containing protein [Verticillium albo-atrum VaMs.102]
          Length = 238

 Score = 58.1 bits (140), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 12/44 (27%), Positives = 25/44 (56%)

Query: 3   KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTM 46
           ++      +++Y+C +RGT E DL+L +F D  +  +S  ++  
Sbjct: 66  EDATTMRARLLYQCRKRGTLESDLLLSTFADTHLPTMSHAQMQQ 109


>gi|307610277|emb|CBW99841.1| hypothetical protein LPW_16021 [Legionella pneumophila 130b]
          Length = 63

 Score = 58.1 bits (140), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 18/66 (27%), Positives = 34/66 (51%), Gaps = 5/66 (7%)

Query: 21 TREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPEYLRTPIFKKI 80
            E+DL+L  F+ + I  L+  +L   ++++  +D NL+ W  G E+P + L      +I
Sbjct: 1  MLELDLVLQKFIANEIDRLTENQLKAFDNLLTHNDPNLYAWLMGHEEPEKELL-----EI 55

Query: 81 YDYYSN 86
            +  N
Sbjct: 56 VSFIRN 61


>gi|91763275|ref|ZP_01265239.1| hypothetical protein PU1002_01415 [Candidatus Pelagibacter ubique
          HTCC1002]
 gi|91717688|gb|EAS84339.1| hypothetical protein PU1002_01415 [Candidatus Pelagibacter ubique
          HTCC1002]
          Length = 88

 Score = 58.1 bits (140), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 28/83 (33%), Positives = 44/83 (53%)

Query: 1  MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
          M  N+     KI YR   RGT+EMD +LGSF   +I + +  ELT+L  +++ DD NL+K
Sbjct: 1  MTINIKDLKNKITYRANYRGTKEMDKLLGSFTKKYIDQFNEQELTLLCDLLDFDDENLYK 60

Query: 61 WFTGMEKPPEYLRTPIFKKIYDY 83
          +  G     +     + +   +Y
Sbjct: 61 FNQGQNPTIQIELNKVSEMFKNY 83


>gi|330446931|ref|ZP_08310582.1| conserved hypothetical protein [Photobacterium leiognathi subsp.
          mandapamensis svers.1.1.]
 gi|328491122|dbj|GAA05079.1| conserved hypothetical protein [Photobacterium leiognathi subsp.
          mandapamensis svers.1.1.]
          Length = 86

 Score = 58.1 bits (140), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 16/74 (21%), Positives = 30/74 (40%)

Query: 16 CWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPEYLRTP 75
            RRG  E+D+I+  F +     LS  +     +++  DD +LF W     +        
Sbjct: 13 ACRRGMLELDVIIMPFFEERFDGLSEQQQQDFINLLTCDDPDLFTWMMQHGRSDNEAYAN 72

Query: 76 IFKKIYDYYSNNLD 89
          +   I  + ++ L 
Sbjct: 73 MVDMIVAHNNSKLR 86


>gi|160872824|ref|ZP_02062956.1| conserved domain protein [Rickettsiella grylli]
 gi|159121623|gb|EDP46961.1| conserved domain protein [Rickettsiella grylli]
          Length = 85

 Score = 58.1 bits (140), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 17/78 (21%), Positives = 41/78 (52%), Gaps = 1/78 (1%)

Query: 4  NMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFT 63
           +  + +++ ++C RRG  E+DL+L +F+D+  L L+     + E ++   DS L+ +  
Sbjct: 3  QLEKKRQRLRWQC-RRGMLELDLLLKAFLDNRYLSLTPSNQVLFEQLLTYSDSALYAYLI 61

Query: 64 GMEKPPEYLRTPIFKKIY 81
            +   + L   + +++ 
Sbjct: 62 QRKPVSDSLMQALIEQVR 79


>gi|146312955|ref|YP_001178029.1| hypothetical protein Ent638_3315 [Enterobacter sp. 638]
 gi|145319831|gb|ABP61978.1| protein of unknown function DUF339 [Enterobacter sp. 638]
          Length = 88

 Score = 58.1 bits (140), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 21/80 (26%), Positives = 38/80 (47%), Gaps = 4/80 (5%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          +I +   RRG RE+D+ +  F ++    LS  +  +   ++E DD +LF W     KP  
Sbjct: 8  RIHW-ACRRGMRELDISVMPFFEYEYDSLSDDDKRLFIRLLESDDPDLFNWLMNHGKP-- 64

Query: 71 YLRTPIFKKIYDYYSNNLDR 90
             T + + +    + N +R
Sbjct: 65 -ADTELQRMVQLIQTRNRER 83


>gi|90416427|ref|ZP_01224358.1| hypothetical protein GB2207_04477 [marine gamma proteobacterium
          HTCC2207]
 gi|90331626|gb|EAS46854.1| hypothetical protein GB2207_04477 [marine gamma proteobacterium
          HTCC2207]
          Length = 81

 Score = 58.1 bits (140), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 21/72 (29%), Positives = 35/72 (48%), Gaps = 5/72 (6%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          ++ +   RRG  E+DLIL  FV++F   L   +    E ++E +D +LF W    + P  
Sbjct: 5  RLRW-ACRRGMLELDLILEPFVENFYETLEEADQLRFEVLLESEDQSLFMWLMKRQAP-- 61

Query: 71 YLRTPIFKKIYD 82
              P  ++I  
Sbjct: 62 --ENPDMQRIVQ 71


>gi|304413500|ref|ZP_07394973.1| hypothetical protein REG_0578 [Candidatus Regiella insecticola
          LSR1]
 gi|304284343|gb|EFL92736.1| hypothetical protein REG_0578 [Candidatus Regiella insecticola
          LSR1]
          Length = 93

 Score = 58.1 bits (140), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 20/81 (24%), Positives = 39/81 (48%), Gaps = 3/81 (3%)

Query: 13 VYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPEYL 72
          VY   RRG RE+D+++  F ++    LS+ +  +   +++ DD +LF W     +P    
Sbjct: 14 VYWACRRGMRELDIVIMPFFEYEYETLSNDDKGLFMRLLKSDDPDLFNWLMNYGEP---Q 70

Query: 73 RTPIFKKIYDYYSNNLDRKNM 93
           + + + I      N  R ++
Sbjct: 71 DSELQRMIKLIQMRNKARGSL 91


>gi|226943487|ref|YP_002798560.1| hypothetical protein Avin_13630 [Azotobacter vinelandii DJ]
 gi|226718414|gb|ACO77585.1| conserved hypothetical protein [Azotobacter vinelandii DJ]
          Length = 84

 Score = 58.1 bits (140), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 15/63 (23%), Positives = 32/63 (50%), Gaps = 1/63 (1%)

Query: 6  NLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGM 65
          +++  ++ +   RRG  E+D++L  FV      L + +      ++  +D ++F WF   
Sbjct: 4  DIELNRLSWHS-RRGMLELDVLLVPFVKEAYPNLDAEDQARFRKLLACEDQDMFGWFMRR 62

Query: 66 EKP 68
          E+P
Sbjct: 63 EEP 65


>gi|330502434|ref|YP_004379303.1| hypothetical protein MDS_1520 [Pseudomonas mendocina NK-01]
 gi|328916720|gb|AEB57551.1| hypothetical protein MDS_1520 [Pseudomonas mendocina NK-01]
          Length = 84

 Score = 57.7 bits (139), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 18/79 (22%), Positives = 34/79 (43%), Gaps = 1/79 (1%)

Query: 7  LQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGME 66
           +  ++ +   RRG  E+D++L  FV      L +        ++E +D ++F WF    
Sbjct: 5  SELNRLFWHS-RRGMLELDVLLVPFVQEVYPTLDAENQARYRKLLECEDQDMFGWFMQRG 63

Query: 67 KPPEYLRTPIFKKIYDYYS 85
          +P +     I + I D   
Sbjct: 64 EPEDADLRHIVRMILDRVQ 82


>gi|37527428|ref|NP_930772.1| hypothetical protein plu3555 [Photorhabdus luminescens subsp.
          laumondii TTO1]
 gi|81175083|sp|Q7N1C1|Y3555_PHOLL RecName: Full=UPF0350 protein plu3555
 gi|36786863|emb|CAE15928.1| unnamed protein product [Photorhabdus luminescens subsp.
          laumondii TTO1]
          Length = 88

 Score = 57.7 bits (139), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 20/86 (23%), Positives = 39/86 (45%), Gaps = 3/86 (3%)

Query: 5  MNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTG 64
          M++  +  ++   RRG RE+D+ +  F  +    LS  +  +   ++   D +LF W   
Sbjct: 1  MDIDNKARIHWACRRGMRELDISIMPFFKYEYDSLSDDDKRLFIRLLACADPDLFNWLMN 60

Query: 65 MEKPPEYLRTPIFKKIYDYYSNNLDR 90
            +P +     +F+ I    + N DR
Sbjct: 61 HGRPEDE---ELFRMIKLIQNRNKDR 83


>gi|118371032|ref|XP_001018716.1| conserved hypothetical protein [Tetrahymena thermophila]
 gi|89300483|gb|EAR98471.1| conserved hypothetical protein [Tetrahymena thermophila SB210]
          Length = 115

 Score = 57.7 bits (139), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 17/71 (23%), Positives = 32/71 (45%), Gaps = 1/71 (1%)

Query: 1  MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLES-IIEEDDSNLF 59
          ++ ++    +++ +R    G RE+DL+LG+F    +   S  EL      ++  +   L 
Sbjct: 24 IENDVENLKKQLTWRASNMGMRELDLLLGTFAKDKLKNFSKDELVQFNKDVLVLETPVLN 83

Query: 60 KWFTGMEKPPE 70
          K   G    PE
Sbjct: 84 KILLGQLPIPE 94


>gi|227112626|ref|ZP_03826282.1| hypothetical protein PcarbP_06667 [Pectobacterium carotovorum
          subsp. brasiliensis PBR1692]
          Length = 88

 Score = 57.7 bits (139), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 17/77 (22%), Positives = 33/77 (42%), Gaps = 1/77 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          +I +   RRG RE+D+ +  F +H    L+  +      +++ DD +LF W     +P +
Sbjct: 8  RIHW-ACRRGMRELDIAIMPFFEHDYDTLNDTDKRTFVRLLQSDDPDLFNWLMNHGEPED 66

Query: 71 YLRTPIFKKIYDYYSNN 87
               +   I     + 
Sbjct: 67 GELKHMISLIQTRNKDR 83


>gi|298369266|ref|ZP_06980584.1| TPR repeat protein [Neisseria sp. oral taxon 014 str. F0314]
 gi|298283269|gb|EFI24756.1| TPR repeat protein [Neisseria sp. oral taxon 014 str. F0314]
          Length = 82

 Score = 57.7 bits (139), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 25/76 (32%), Positives = 36/76 (47%), Gaps = 1/76 (1%)

Query: 6  NLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGM 65
          ++  RKI ++  RRG  E+DLI G F++     LS  ELT L  I+   D  L     G 
Sbjct: 6  DIAKRKIRFQ-TRRGLLELDLIFGRFMEKEFEHLSDDELTCLVEILAFQDQELLSLINGS 64

Query: 66 EKPPEYLRTPIFKKIY 81
              +    P+ +KI 
Sbjct: 65 RTTDKAHLVPMLEKIR 80


>gi|50119704|ref|YP_048871.1| hypothetical protein ECA0759 [Pectobacterium atrosepticum
          SCRI1043]
 gi|81175089|sp|Q6D960|Y759_ERWCT RecName: Full=UPF0350 protein ECA0759
 gi|49610230|emb|CAG73673.1| conserved hypothetical protein [Pectobacterium atrosepticum
          SCRI1043]
          Length = 88

 Score = 57.7 bits (139), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 20/80 (25%), Positives = 36/80 (45%), Gaps = 4/80 (5%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          +I +   RRG RE+D+ +  F +H    L+  +      +++ DD +LF W     +P  
Sbjct: 8  RIHW-ACRRGMRELDIAIMPFFEHDYDTLNDSDKRAFVRLLQSDDPDLFNWLMNHGEP-- 64

Query: 71 YLRTPIFKKIYDYYSNNLDR 90
               + + I    + N DR
Sbjct: 65 -KDGELKRMISLIQTRNKDR 83


>gi|292487136|ref|YP_003530006.1| hypothetical protein EAMY_0648 [Erwinia amylovora CFBP1430]
 gi|292900482|ref|YP_003539851.1| hypothetical protein EAM_2784 [Erwinia amylovora ATCC 49946]
 gi|291200330|emb|CBJ47458.1| conserved hypothetical protein [Erwinia amylovora ATCC 49946]
 gi|291552553|emb|CBA19598.1| UPF0350 protein plu3555 [Erwinia amylovora CFBP1430]
 gi|312171241|emb|CBX79500.1| UPF0350 protein plu3555 [Erwinia amylovora ATCC BAA-2158]
          Length = 88

 Score = 57.7 bits (139), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 17/72 (23%), Positives = 32/72 (44%), Gaps = 1/72 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          +I +   RRG RE+D+ +  F  +    L+  +  +   ++E DD +LF W     +P +
Sbjct: 8  RIHW-ACRRGMRELDISIMPFFQYEFDSLNDSDKRLFVRLLESDDPDLFNWLMNHGEPAD 66

Query: 71 YLRTPIFKKIYD 82
               +   I  
Sbjct: 67 VELKRMVALIQQ 78


>gi|170720250|ref|YP_001747938.1| hypothetical protein PputW619_1064 [Pseudomonas putida W619]
 gi|169758253|gb|ACA71569.1| protein of unknown function DUF339 [Pseudomonas putida W619]
          Length = 84

 Score = 57.3 bits (138), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 13/61 (21%), Positives = 28/61 (45%), Gaps = 1/61 (1%)

Query: 7  LQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGME 66
           +  ++ +   RRG  E+D++L  F       LS  +  +   ++  +D ++F WF    
Sbjct: 5  TELNRLFWHS-RRGMLELDVLLVPFTQEVYPTLSEADRELYVRLLSCEDQDMFGWFMERT 63

Query: 67 K 67
          +
Sbjct: 64 E 64


>gi|307262003|ref|ZP_07543658.1| hypothetical protein appser12_15530 [Actinobacillus
          pleuropneumoniae serovar 12 str. 1096]
 gi|306868286|gb|EFN00108.1| hypothetical protein appser12_15530 [Actinobacillus
          pleuropneumoniae serovar 12 str. 1096]
          Length = 82

 Score = 57.3 bits (138), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 20/74 (27%), Positives = 34/74 (45%), Gaps = 1/74 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          +I + C RRG RE+D ++  F   +  ELS  +     ++++  D  LF+WF      P 
Sbjct: 8  RIEWEC-RRGMRELDKMIMPFYKEYFDELSEAQQQTFVAMLKYTDPELFRWFMHQAPAPT 66

Query: 71 YLRTPIFKKIYDYY 84
             T + + I    
Sbjct: 67 QEMTDLIELIRSKI 80


>gi|330808066|ref|YP_004352528.1| hypothetical protein PSEBR_a1336 [Pseudomonas brassicacearum
          subsp. brassicacearum NFM421]
 gi|327376174|gb|AEA67524.1| Conserved hypothetical protein [Pseudomonas brassicacearum subsp.
          brassicacearum NFM421]
          Length = 84

 Score = 57.3 bits (138), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 17/80 (21%), Positives = 37/80 (46%), Gaps = 1/80 (1%)

Query: 6  NLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGM 65
          +++  ++ +   RRG  E+D++L  FV      L+ V+      ++E +D ++F WF   
Sbjct: 4  DVELNRLYWHS-RRGMLELDVLLVPFVKEVYPHLNEVDRACYVRLLECEDQDMFGWFMER 62

Query: 66 EKPPEYLRTPIFKKIYDYYS 85
           +  +     + + I D   
Sbjct: 63 SESEDPELQRMVRMILDRVQ 82


>gi|254362741|ref|ZP_04978825.1| hypothetical protein MHA_2334 [Mannheimia haemolytica PHL213]
 gi|261491881|ref|ZP_05988460.1| UPF0350 protein [Mannheimia haemolytica serotype A2 str. BOVINE]
 gi|261494649|ref|ZP_05991129.1| UPF0350 protein MS2227 [Mannheimia haemolytica serotype A2 str.
          OVINE]
 gi|153094366|gb|EDN75221.1| hypothetical protein MHA_2334 [Mannheimia haemolytica PHL213]
 gi|261309614|gb|EEY10837.1| UPF0350 protein MS2227 [Mannheimia haemolytica serotype A2 str.
          OVINE]
 gi|261312536|gb|EEY13660.1| UPF0350 protein [Mannheimia haemolytica serotype A2 str. BOVINE]
          Length = 82

 Score = 57.3 bits (138), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 15/69 (21%), Positives = 27/69 (39%)

Query: 16 CWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPEYLRTP 75
            RRG RE+D ++  F  +   EL+  +      ++   D  LF+W       P      
Sbjct: 12 ACRRGMRELDKMIMPFYQNHFNELNETQQQAFVEMLNYSDPELFRWVMLQAPAPTEEIAE 71

Query: 76 IFKKIYDYY 84
          + + + D  
Sbjct: 72 LIRLMRDKI 80


>gi|253996134|ref|YP_003048198.1| hypothetical protein Mmol_0761 [Methylotenera mobilis JLW8]
 gi|253982813|gb|ACT47671.1| protein of unknown function DUF339 [Methylotenera mobilis JLW8]
          Length = 100

 Score = 57.0 bits (137), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 16/55 (29%), Positives = 31/55 (56%), Gaps = 1/55 (1%)

Query: 5  MNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLF 59
           + + R+  +RC RRG  E+D++L  FV H    L+  EL + ++++   D+  +
Sbjct: 8  RDAEQRRFAWRC-RRGLLELDIVLQDFVQHHYDTLTLEELQVFDALLALPDNEFW 61


>gi|257465598|ref|ZP_05629969.1| hypothetical protein AM202_03735 [Actinobacillus minor 202]
 gi|257451258|gb|EEV25301.1| hypothetical protein AM202_03735 [Actinobacillus minor 202]
          Length = 82

 Score = 57.0 bits (137), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 15/69 (21%), Positives = 28/69 (40%)

Query: 16 CWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPEYLRTP 75
            RRG RE+D ++  F  +    L++V+      ++   D  LF+W       P    T 
Sbjct: 12 ACRRGMRELDKMIMPFYQNHFDSLTAVQQQTFAEMLTYPDPELFRWVMHQLPAPTQEMTD 71

Query: 76 IFKKIYDYY 84
          + + +    
Sbjct: 72 LIELMRSKI 80


>gi|227328390|ref|ZP_03832414.1| hypothetical protein PcarcW_14082 [Pectobacterium carotovorum
          subsp. carotovorum WPP14]
          Length = 88

 Score = 57.0 bits (137), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 17/77 (22%), Positives = 33/77 (42%), Gaps = 1/77 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          +I +   RRG RE+D+ +  F +H    L+  +      +++ DD +LF W     +P +
Sbjct: 8  RIHW-ACRRGMRELDIAIMPFFEHDYDTLNDTDKRTFVRLLQSDDPDLFNWLMNHGEPED 66

Query: 71 YLRTPIFKKIYDYYSNN 87
               +   I     + 
Sbjct: 67 GELKRMISLIQTRNKDR 83


>gi|167854874|ref|ZP_02477651.1| hypothetical protein HPS_03506 [Haemophilus parasuis 29755]
 gi|167854053|gb|EDS25290.1| hypothetical protein HPS_03506 [Haemophilus parasuis 29755]
          Length = 79

 Score = 57.0 bits (137), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 18/72 (25%), Positives = 32/72 (44%), Gaps = 1/72 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          +I + C RRG RE+D ++  F       L++ +      ++   D  LF+WF   + PP 
Sbjct: 5  RIEWEC-RRGMRELDKMIMPFYQEHFDSLTAEQQRTFVEMLRYTDPELFRWFMNQDTPPT 63

Query: 71 YLRTPIFKKIYD 82
               + + I  
Sbjct: 64 EALQEMVRLIQS 75


>gi|290476405|ref|YP_003469310.1| hypothetical protein XBJ1_3428 [Xenorhabdus bovienii SS-2004]
 gi|289175743|emb|CBJ82546.1| conserved hypothetical protein [Xenorhabdus bovienii SS-2004]
          Length = 88

 Score = 57.0 bits (137), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 19/86 (22%), Positives = 39/86 (45%), Gaps = 3/86 (3%)

Query: 5  MNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTG 64
          M++  +  ++   RRG RE+D+ +  F ++    L+  +  +   ++E  D +LF W   
Sbjct: 1  MDIDNKARIHWACRRGMRELDISIMPFFEYEYDSLNDDDKQLFVRLLECADPDLFNWLMN 60

Query: 65 MEKPPEYLRTPIFKKIYDYYSNNLDR 90
            +P       +F+ +    S N  R
Sbjct: 61 HGRP---EDDELFRMVQLIQSRNQAR 83


>gi|268591705|ref|ZP_06125926.1| TPR repeat protein [Providencia rettgeri DSM 1131]
 gi|291312664|gb|EFE53117.1| TPR repeat protein [Providencia rettgeri DSM 1131]
          Length = 88

 Score = 57.0 bits (137), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 19/86 (22%), Positives = 42/86 (48%), Gaps = 3/86 (3%)

Query: 5  MNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTG 64
          M+++ +  ++   RRG RE+D+ +  F ++   +L++ +  +   ++E  D +LF W   
Sbjct: 1  MDIENKARIHWACRRGMRELDISIMPFFEYEYDDLTTHDKQVFVRLLECADPDLFNWLMN 60

Query: 65 MEKPPEYLRTPIFKKIYDYYSNNLDR 90
            +P       +F+ I      N +R
Sbjct: 61 HGRP---DDDELFRMIKLIQEKNKNR 83


>gi|197285867|ref|YP_002151739.1| hypothetical protein PMI2016 [Proteus mirabilis HI4320]
 gi|227356368|ref|ZP_03840756.1| conserved hypothetical protein [Proteus mirabilis ATCC 29906]
 gi|194683354|emb|CAR44061.1| conserved hypothetical protein [Proteus mirabilis HI4320]
 gi|227163478|gb|EEI48399.1| conserved hypothetical protein [Proteus mirabilis ATCC 29906]
          Length = 93

 Score = 57.0 bits (137), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 17/67 (25%), Positives = 31/67 (46%)

Query: 16 CWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPEYLRTP 75
            RRG RE+D+ +  F ++    LS  +  +   ++E  D +LF W     +P +     
Sbjct: 14 ACRRGMRELDISIMPFFENEYDTLSDDDKRLFVRLLECADPDLFNWLMNHGRPDDEDLYY 73

Query: 76 IFKKIYD 82
          + K I +
Sbjct: 74 MVKLIQE 80


>gi|219871472|ref|YP_002475847.1| hypothetical protein HAPS_1307 [Haemophilus parasuis SH0165]
 gi|219691676|gb|ACL32899.1| conserved hypothetical protein [Haemophilus parasuis SH0165]
          Length = 79

 Score = 56.6 bits (136), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 18/72 (25%), Positives = 32/72 (44%), Gaps = 1/72 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          +I + C RRG RE+D ++  F       L++ +      ++   D  LF+WF   + PP 
Sbjct: 5  RIEWEC-RRGMRELDKMIMPFYQEHFDSLTAEQQYTFVEMLRYTDPELFRWFMNQDTPPT 63

Query: 71 YLRTPIFKKIYD 82
               + + I  
Sbjct: 64 EALQEMVRLIQS 75


>gi|312959549|ref|ZP_07774066.1| protein of unknown function DUF339 [Pseudomonas fluorescens WH6]
 gi|311286266|gb|EFQ64830.1| protein of unknown function DUF339 [Pseudomonas fluorescens WH6]
          Length = 84

 Score = 56.6 bits (136), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 16/80 (20%), Positives = 36/80 (45%), Gaps = 1/80 (1%)

Query: 6  NLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGM 65
           ++  ++ +   RRG  E+D++L  F       L+ V+  +   ++E +D ++F WF   
Sbjct: 4  EVEINRLYWHS-RRGMLELDVLLVPFTKEVYATLNEVDRDLYVRLLECEDQDMFGWFMER 62

Query: 66 EKPPEYLRTPIFKKIYDYYS 85
           +  +     + + I D   
Sbjct: 63 AESEDPELQRMVRMILDRVQ 82


>gi|221506801|gb|EEE32418.1| N-acetylglucosaminylphosphatidylinositol deacetylase, putative
           [Toxoplasma gondii VEG]
          Length = 394

 Score = 56.6 bits (136), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 12/48 (25%), Positives = 28/48 (58%)

Query: 6   NLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEE 53
           + + ++++YR  +RG  E+DL+LG++ D  +  +S+        ++E 
Sbjct: 111 SERLKRLMYRAKQRGWVELDLLLGAYCDENVPSMSTEASHARRFLLEL 158


>gi|261820172|ref|YP_003258278.1| hypothetical protein Pecwa_0852 [Pectobacterium wasabiae WPP163]
 gi|261604185|gb|ACX86671.1| protein of unknown function DUF339 [Pectobacterium wasabiae
          WPP163]
          Length = 88

 Score = 56.6 bits (136), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 17/77 (22%), Positives = 34/77 (44%), Gaps = 1/77 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          +I +   RRG RE+D+ +  F +H    L+ ++      +++ DD +LF W     +P +
Sbjct: 8  RIHW-ACRRGMRELDIAIMPFFEHDYDTLNDIDKRTFVRLLQSDDPDLFNWLMNHGEPED 66

Query: 71 YLRTPIFKKIYDYYSNN 87
               +   I     + 
Sbjct: 67 GELKRMISLIQTRNKDR 83


>gi|322513354|ref|ZP_08066473.1| hypothetical protein HMPREF0027_0225 [Actinobacillus ureae ATCC
          25976]
 gi|322120844|gb|EFX92704.1| hypothetical protein HMPREF0027_0225 [Actinobacillus ureae ATCC
          25976]
          Length = 82

 Score = 56.6 bits (136), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 18/74 (24%), Positives = 33/74 (44%), Gaps = 1/74 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          +I + C RRG RE+D ++  F      +LS  +     ++++  D  LF+WF      P 
Sbjct: 8  RIEWEC-RRGMRELDKMIMPFYKAHFDDLSETQQQTFVAMLKYTDPELFRWFMHQAPAPT 66

Query: 71 YLRTPIFKKIYDYY 84
             + + + I    
Sbjct: 67 QEMSDLIELIRSKI 80


>gi|188534911|ref|YP_001908708.1| hypothetical protein ETA_27910 [Erwinia tasmaniensis Et1/99]
 gi|188029953|emb|CAO97837.1| UPF0350 protein YgfY [Erwinia tasmaniensis Et1/99]
          Length = 88

 Score = 56.6 bits (136), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 16/58 (27%), Positives = 30/58 (51%), Gaps = 1/58 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKP 68
          +I +   RRG RE+D+ +  F ++    L+  +  +   ++E DD +LF W     +P
Sbjct: 8  RIHW-ACRRGMRELDISIMPFFEYEFDSLNDGDKRLFVRLLESDDPDLFNWLMNHGEP 64


>gi|77457585|ref|YP_347090.1| hypothetical protein Pfl01_1358 [Pseudomonas fluorescens Pf0-1]
 gi|77381588|gb|ABA73101.1| conserved hypothetical protein [Pseudomonas fluorescens Pf0-1]
          Length = 84

 Score = 56.6 bits (136), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 17/79 (21%), Positives = 37/79 (46%), Gaps = 1/79 (1%)

Query: 7  LQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGME 66
          ++  ++ +   RRG  E+D++L  FV      L+ V+  +   ++E +D ++F WF    
Sbjct: 5  VELNRLFWHS-RRGMLELDVLLVPFVKEVYANLNEVDRALYVRLLECEDQDMFGWFMERS 63

Query: 67 KPPEYLRTPIFKKIYDYYS 85
          +  +     + + I D   
Sbjct: 64 ESEDPELQRMVRMILDRVQ 82


>gi|157372132|ref|YP_001480121.1| hypothetical protein Spro_3898 [Serratia proteamaculans 568]
 gi|157323896|gb|ABV42993.1| protein of unknown function DUF339 [Serratia proteamaculans 568]
          Length = 88

 Score = 56.2 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 17/77 (22%), Positives = 33/77 (42%), Gaps = 1/77 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          +I +   RRG RE+D+ +  F ++    L+  +  +   ++E DD +LF W      P +
Sbjct: 8  RIHW-ACRRGMRELDISIMPFFEYEYDLLNDTDKALFIRLLESDDPDLFNWLMNHGAPQD 66

Query: 71 YLRTPIFKKIYDYYSNN 87
               +   I     + 
Sbjct: 67 SELQRMVTLIQTRNKDR 83


>gi|325275455|ref|ZP_08141385.1| hypothetical protein G1E_19030 [Pseudomonas sp. TJI-51]
 gi|324099406|gb|EGB97322.1| hypothetical protein G1E_19030 [Pseudomonas sp. TJI-51]
          Length = 84

 Score = 56.2 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 12/61 (19%), Positives = 28/61 (45%), Gaps = 1/61 (1%)

Query: 7  LQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGME 66
           +  ++ +   RRG  E+D++L  F       L+  +  +   ++  +D ++F WF    
Sbjct: 5  TELNRLFWHS-RRGMLELDVLLVPFTQEVYPTLNEADRELYVRLLSCEDQDMFGWFMERT 63

Query: 67 K 67
          +
Sbjct: 64 E 64


>gi|90408991|ref|ZP_01217122.1| hypothetical protein PCNPT3_01463 [Psychromonas sp. CNPT3]
 gi|90309905|gb|EAS38059.1| hypothetical protein PCNPT3_01463 [Psychromonas sp. CNPT3]
          Length = 83

 Score = 56.2 bits (135), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 18/86 (20%), Positives = 38/86 (44%), Gaps = 3/86 (3%)

Query: 1  MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
          M++ +N    ++++   RRG  E+D++   FV     +L   +    + ++  +D +LF 
Sbjct: 1  MQEEIN--KSRLLW-ACRRGMLELDVLFMPFVKEAFDDLKYSQQLTFQRLLTHEDPDLFA 57

Query: 61 WFTGMEKPPEYLRTPIFKKIYDYYSN 86
          WF G +K  +     +   I      
Sbjct: 58 WFMGHDKCVDPDLADMIHVILQRVKA 83


>gi|165976950|ref|YP_001652543.1| hypothetical protein APJL_1547 [Actinobacillus pleuropneumoniae
          serovar 3 str. JL03]
 gi|190150850|ref|YP_001969375.1| hypothetical protein APP7_1581 [Actinobacillus pleuropneumoniae
          serovar 7 str. AP76]
 gi|303250939|ref|ZP_07337129.1| hypothetical protein APP6_2066 [Actinobacillus pleuropneumoniae
          serovar 6 str. Femo]
 gi|303253401|ref|ZP_07339544.1| hypothetical protein APP2_2077 [Actinobacillus pleuropneumoniae
          serovar 2 str. 4226]
 gi|307246438|ref|ZP_07528511.1| hypothetical protein appser1_16360 [Actinobacillus
          pleuropneumoniae serovar 1 str. 4074]
 gi|307248563|ref|ZP_07530578.1| hypothetical protein appser2_15310 [Actinobacillus
          pleuropneumoniae serovar 2 str. S1536]
 gi|307250796|ref|ZP_07532725.1| hypothetical protein appser4_15610 [Actinobacillus
          pleuropneumoniae serovar 4 str. M62]
 gi|307253172|ref|ZP_07535050.1| hypothetical protein appser6_16730 [Actinobacillus
          pleuropneumoniae serovar 6 str. Femo]
 gi|307255421|ref|ZP_07537228.1| hypothetical protein appser9_16480 [Actinobacillus
          pleuropneumoniae serovar 9 str. CVJ13261]
 gi|307257590|ref|ZP_07539350.1| hypothetical protein appser10_15780 [Actinobacillus
          pleuropneumoniae serovar 10 str. D13039]
 gi|307259873|ref|ZP_07541587.1| hypothetical protein appser11_16610 [Actinobacillus
          pleuropneumoniae serovar 11 str. 56153]
 gi|307264200|ref|ZP_07545791.1| hypothetical protein appser13_15960 [Actinobacillus
          pleuropneumoniae serovar 13 str. N273]
 gi|165877051|gb|ABY70099.1| hypothetical protein APJL_1547 [Actinobacillus pleuropneumoniae
          serovar 3 str. JL03]
 gi|189915981|gb|ACE62233.1| hypothetical protein APP7_1581 [Actinobacillus pleuropneumoniae
          serovar 7 str. AP76]
 gi|302647746|gb|EFL77959.1| hypothetical protein APP2_2077 [Actinobacillus pleuropneumoniae
          serovar 2 str. 4226]
 gi|302650211|gb|EFL80377.1| hypothetical protein APP6_2066 [Actinobacillus pleuropneumoniae
          serovar 6 str. Femo]
 gi|306852642|gb|EFM84874.1| hypothetical protein appser1_16360 [Actinobacillus
          pleuropneumoniae serovar 1 str. 4074]
 gi|306854913|gb|EFM87101.1| hypothetical protein appser2_15310 [Actinobacillus
          pleuropneumoniae serovar 2 str. S1536]
 gi|306857155|gb|EFM89282.1| hypothetical protein appser4_15610 [Actinobacillus
          pleuropneumoniae serovar 4 str. M62]
 gi|306859357|gb|EFM91392.1| hypothetical protein appser6_16730 [Actinobacillus
          pleuropneumoniae serovar 6 str. Femo]
 gi|306861605|gb|EFM93592.1| hypothetical protein appser9_16480 [Actinobacillus
          pleuropneumoniae serovar 9 str. CVJ13261]
 gi|306863893|gb|EFM95816.1| hypothetical protein appser10_15780 [Actinobacillus
          pleuropneumoniae serovar 10 str. D13039]
 gi|306866043|gb|EFM97917.1| hypothetical protein appser11_16610 [Actinobacillus
          pleuropneumoniae serovar 11 str. 56153]
 gi|306870446|gb|EFN02199.1| hypothetical protein appser13_15960 [Actinobacillus
          pleuropneumoniae serovar 13 str. N273]
          Length = 82

 Score = 55.8 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 21/74 (28%), Positives = 35/74 (47%), Gaps = 1/74 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          +I + C RRG RE+D ++  F   +  ELS  +   L ++++  D  LF+WF      P 
Sbjct: 8  RIEWEC-RRGMRELDKMIMPFYKEYFDELSEAQQQTLVAMLKYTDPELFRWFMHQAPAPT 66

Query: 71 YLRTPIFKKIYDYY 84
             T + + I    
Sbjct: 67 QEMTDLIELIRSKI 80


>gi|254514103|ref|ZP_05126164.1| TPR repeat region superfamily protein [gamma proteobacterium
          NOR5-3]
 gi|219676346|gb|EED32711.1| TPR repeat region superfamily protein [gamma proteobacterium
          NOR5-3]
          Length = 86

 Score = 55.8 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 19/78 (24%), Positives = 32/78 (41%), Gaps = 1/78 (1%)

Query: 5  MNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTG 64
          M+ + +++ +   RRG  E+DLIL  FV     +L     +    ++   D  LF WF  
Sbjct: 1  MDEEHKRMRW-ASRRGMLELDLILEPFVRLHYAQLDEQGRSRYRELMTCQDQELFDWFLR 59

Query: 65 MEKPPEYLRTPIFKKIYD 82
             P       + + I  
Sbjct: 60 KRVPDNAEHAYMVRTILS 77


>gi|71083685|ref|YP_266405.1| hypothetical protein SAR11_0994 [Candidatus Pelagibacter ubique
          HTCC1062]
 gi|71062798|gb|AAZ21801.1| Protein of unknown function DUF339 [Candidatus Pelagibacter
          ubique HTCC1062]
          Length = 88

 Score = 55.8 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 18/43 (41%), Positives = 24/43 (55%)

Query: 1  MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVE 43
          M  N+     KI YR   RGT+EMD +LGSF   +I + +  E
Sbjct: 1  MTINIKDLKNKITYRANYRGTKEMDKLLGSFTKKYIDQFNEQE 43


>gi|259909559|ref|YP_002649915.1| hypothetical protein EpC_29340 [Erwinia pyrifoliae Ep1/96]
 gi|224965181|emb|CAX56713.1| conserved uncharacterized protein [Erwinia pyrifoliae Ep1/96]
          Length = 88

 Score = 55.8 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 16/58 (27%), Positives = 29/58 (50%), Gaps = 1/58 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKP 68
          +I +   RRG RE+D+ +  F  +    L+  +  +   ++E DD +LF W     +P
Sbjct: 8  RIHW-ACRRGMRELDISIMPFFQYEFDSLNDGDKRLFVRLLESDDPDLFNWLMNHGEP 64


>gi|317049383|ref|YP_004117031.1| hypothetical protein Pat9b_3179 [Pantoea sp. At-9b]
 gi|316951000|gb|ADU70475.1| protein of unknown function DUF339 [Pantoea sp. At-9b]
          Length = 88

 Score = 55.8 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 13/53 (24%), Positives = 26/53 (49%)

Query: 16 CWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKP 68
            RRG  E+D+ +  F  +    L+  +  +  ++++ DD +LF W     +P
Sbjct: 12 ACRRGMLELDIAIMPFFKYEYDSLTDADKQVFVALLKSDDPDLFNWMMNHGEP 64


>gi|310766533|gb|ADP11483.1| hypothetical protein EJP617_18020 [Erwinia sp. Ejp617]
          Length = 88

 Score = 55.4 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 16/58 (27%), Positives = 29/58 (50%), Gaps = 1/58 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKP 68
          +I +   RRG RE+D+ +  F  +    L+  +  +   ++E DD +LF W     +P
Sbjct: 8  RIHW-ACRRGMRELDISIMPFFQYEFDSLNDDDKRLFVRLLESDDPDLFNWLMNHGEP 64


>gi|327395067|dbj|BAK12489.1| cytoplasmic protein YgfY [Pantoea ananatis AJ13355]
          Length = 95

 Score = 55.4 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 16/82 (19%), Positives = 38/82 (46%), Gaps = 2/82 (2%)

Query: 2  KKNMNLQCR-KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
           + M++  + ++ +   RRG  E+D+ +  F  +    L+  +  +  ++++ DD +LF 
Sbjct: 5  NECMDIHNKSRVQW-ACRRGMLELDVAIMPFFKYEYDTLNDTDKQVFIALLKSDDPDLFN 63

Query: 61 WFTGMEKPPEYLRTPIFKKIYD 82
          W     +P +     + K I  
Sbjct: 64 WMMNHGEPADPELKRMVKLIQQ 85


>gi|294787723|ref|ZP_06752967.1| TPR repeat protein [Simonsiella muelleri ATCC 29453]
 gi|294484016|gb|EFG31699.1| TPR repeat protein [Simonsiella muelleri ATCC 29453]
          Length = 83

 Score = 55.4 bits (133), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 21/82 (25%), Positives = 36/82 (43%), Gaps = 1/82 (1%)

Query: 1  MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
          M +  +   R+I ++  RRG  E+D++L  F+     +LS  EL +   I+  +D     
Sbjct: 1  MAQFDDTAKRRIRFQ-TRRGLLELDIVLKRFMATEFDQLSDEELAIFVDILALEDQEFLA 59

Query: 61 WFTGMEKPPEYLRTPIFKKIYD 82
              +E P      P+  KI  
Sbjct: 60 LVNQVESPKRTDFEPLLAKIRH 81


>gi|291086197|ref|ZP_06571393.1| putative cytoplasmic protein [Citrobacter youngae ATCC 29220]
 gi|291068507|gb|EFE06616.1| putative cytoplasmic protein [Citrobacter youngae ATCC 29220]
          Length = 72

 Score = 55.4 bits (133), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 17/62 (27%), Positives = 28/62 (45%)

Query: 21 TREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPEYLRTPIFKKI 80
           RE+D+ +  F +H    LS  E  +   ++E DD +LF W     KP +     + + I
Sbjct: 1  MRELDISIMPFFEHEYDSLSDEEKRIFIRLLECDDPDLFNWLMNHGKPADAQLEQMVRLI 60

Query: 81 YD 82
            
Sbjct: 61 QT 62


>gi|302188266|ref|ZP_07264939.1| hypothetical protein Psyrps6_18055 [Pseudomonas syringae pv.
          syringae 642]
          Length = 84

 Score = 55.4 bits (133), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 15/80 (18%), Positives = 36/80 (45%), Gaps = 1/80 (1%)

Query: 6  NLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGM 65
          +++  ++ +   RRG  E+D++L  FV      L+  +  +   ++  +D ++F WF   
Sbjct: 4  DVELNRLYWHS-RRGMLELDVLLVPFVREVYPHLNDADRDLYRRLLTCEDQDMFGWFMQR 62

Query: 66 EKPPEYLRTPIFKKIYDYYS 85
           +  +     + + I D   
Sbjct: 63 AESEDAELQRMVRMILDRVQ 82


>gi|238897776|ref|YP_002923455.1| hypothetical protein HDEF_0560 [Candidatus Hamiltonella defensa
          5AT (Acyrthosiphon pisum)]
 gi|229465533|gb|ACQ67307.1| conserved hypothetical protein [Candidatus Hamiltonella defensa
          5AT (Acyrthosiphon pisum)]
          Length = 88

 Score = 55.0 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 15/53 (28%), Positives = 26/53 (49%)

Query: 16 CWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKP 68
            RRG  E+D+ +  F ++    LS  E  +   ++  DD++L  W    +KP
Sbjct: 12 ACRRGILELDISIMPFFEYEYDSLSDKEKNLFIRLLVCDDADLLDWLMNKKKP 64


>gi|157148434|ref|YP_001455753.1| hypothetical protein CKO_04259 [Citrobacter koseri ATCC BAA-895]
 gi|157085639|gb|ABV15317.1| hypothetical protein CKO_04259 [Citrobacter koseri ATCC BAA-895]
          Length = 72

 Score = 55.0 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 18/62 (29%), Positives = 28/62 (45%)

Query: 21 TREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPEYLRTPIFKKI 80
           RE+D+ +  F +H    LS  E  +   ++E DD +LF W     KP +     + K I
Sbjct: 1  MRELDISIMPFFEHEYDNLSDEEKCIFVRLLECDDPDLFNWLMNHGKPGDAELEQMVKLI 60

Query: 81 YD 82
            
Sbjct: 61 QT 62


>gi|26988157|ref|NP_743582.1| hypothetical protein PP_1424 [Pseudomonas putida KT2440]
 gi|148549503|ref|YP_001269605.1| hypothetical protein Pput_4297 [Pseudomonas putida F1]
 gi|167035380|ref|YP_001670611.1| hypothetical protein PputGB1_4387 [Pseudomonas putida GB-1]
 gi|81175062|sp|Q88MZ4|Y1424_PSEPK RecName: Full=UPF0350 protein PP_1424
 gi|24982890|gb|AAN67046.1|AE016333_7 conserved hypothetical protein [Pseudomonas putida KT2440]
 gi|148513561|gb|ABQ80421.1| protein of unknown function DUF339 [Pseudomonas putida F1]
 gi|166861868|gb|ABZ00276.1| protein of unknown function DUF339 [Pseudomonas putida GB-1]
 gi|313500348|gb|ADR61714.1| Hypothetical protein, conserved [Pseudomonas putida BIRD-1]
          Length = 84

 Score = 55.0 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 12/61 (19%), Positives = 28/61 (45%), Gaps = 1/61 (1%)

Query: 7  LQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGME 66
           +  ++ +   RRG  E+D++L  F       L+  +  +   ++  +D ++F WF    
Sbjct: 5  TELNRLFWHS-RRGMLELDVLLVPFTQEVYPTLNETDRELYVRLLSCEDQDMFGWFMERT 63

Query: 67 K 67
          +
Sbjct: 64 E 64


>gi|294634848|ref|ZP_06713370.1| TPR repeat protein [Edwardsiella tarda ATCC 23685]
 gi|291091721|gb|EFE24282.1| TPR repeat protein [Edwardsiella tarda ATCC 23685]
          Length = 72

 Score = 55.0 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 14/62 (22%), Positives = 24/62 (38%)

Query: 21 TREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPEYLRTPIFKKI 80
           RE+D+ +  F +H    +S  +      ++  DD  LFKW      P +     +   I
Sbjct: 1  MRELDIAIMPFFEHEYDAMSDADKQTFVRLLNCDDPELFKWLMNQGVPEDADLARMITLI 60

Query: 81 YD 82
            
Sbjct: 61 QT 62


>gi|300113367|ref|YP_003759942.1| hypothetical protein Nwat_0665 [Nitrosococcus watsonii C-113]
 gi|299539304|gb|ADJ27621.1| protein of unknown function DUF339 [Nitrosococcus watsonii C-113]
          Length = 82

 Score = 55.0 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 21/72 (29%), Positives = 40/72 (55%), Gaps = 1/72 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          ++ +RC RRG  E+DL+LG+F++ F   +   E    E+++   D +L+++  G E  P+
Sbjct: 8  RLRWRC-RRGLLELDLLLGNFLEAFYESIPDEEKRAFETLLYSSDPDLWRYCLGEEPHPD 66

Query: 71 YLRTPIFKKIYD 82
           +   +  KI  
Sbjct: 67 PVTAHVIAKIRH 78


>gi|70728824|ref|YP_258573.1| TPR repeat-containing protein [Pseudomonas fluorescens Pf-5]
 gi|81175063|sp|Q4KGR0|Y1445_PSEF5 RecName: Full=UPF0350 protein PFL_1445
 gi|68343123|gb|AAY90729.1| TPR repeat region superfamily [Pseudomonas fluorescens Pf-5]
          Length = 84

 Score = 54.6 bits (131), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 16/80 (20%), Positives = 36/80 (45%), Gaps = 1/80 (1%)

Query: 6  NLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGM 65
          +++  ++ +   RRG  E+D++L  FV      L+  +      ++E +D ++F WF   
Sbjct: 4  DVELNRLYWHS-RRGMLELDVLLVPFVREVYPHLNETDRECYRKLLECEDQDMFGWFMER 62

Query: 66 EKPPEYLRTPIFKKIYDYYS 85
           +  +     + + I D   
Sbjct: 63 SESEDPELQRMVRMILDRVQ 82


>gi|291618734|ref|YP_003521476.1| YgfY [Pantoea ananatis LMG 20103]
 gi|291153764|gb|ADD78348.1| YgfY [Pantoea ananatis LMG 20103]
          Length = 95

 Score = 54.6 bits (131), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 15/82 (18%), Positives = 37/82 (45%), Gaps = 2/82 (2%)

Query: 2  KKNMNLQCR-KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
           + M++  + ++ +   RRG  E+D+ +  F  +    L+  +  +  ++++ DD +LF 
Sbjct: 5  NECMDIHNKSRVQW-ACRRGMLELDVAIMPFFKYEYDTLNDTDKQVFIALLKSDDPDLFN 63

Query: 61 WFTGMEKPPEYLRTPIFKKIYD 82
          W     +P +     +   I  
Sbjct: 64 WMMNHGEPADPELKRMVNLIQQ 85


>gi|152977933|ref|YP_001343562.1| hypothetical protein Asuc_0248 [Actinobacillus succinogenes 130Z]
 gi|150839656|gb|ABR73627.1| protein of unknown function DUF339 [Actinobacillus succinogenes
          130Z]
          Length = 83

 Score = 54.6 bits (131), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 15/72 (20%), Positives = 29/72 (40%), Gaps = 1/72 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          ++ + C RRG  E+D ++  F       L   +  +   ++   D  LF WF      P+
Sbjct: 7  RLEWDC-RRGMLELDKVIMPFYQQHFEALPDEKKAVFVRLLACSDLQLFSWFFNRTSAPD 65

Query: 71 YLRTPIFKKIYD 82
               +  +I+ 
Sbjct: 66 AELQAMVDEIHQ 77


>gi|145517492|ref|XP_001444629.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 gi|124412051|emb|CAK77232.1| unnamed protein product [Paramecium tetraurelia]
          Length = 116

 Score = 54.6 bits (131), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 14/58 (24%), Positives = 35/58 (60%), Gaps = 1/58 (1%)

Query: 4  NMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLE-SIIEEDDSNLFK 60
          +++   + +++RC   G +E+D+ILG +   F+ +++  EL  +E  I++ D  +++ 
Sbjct: 27 DLHSYQKMLMHRCTNLGMKELDIILGRWSQEFVPKMNYEELNQMESEILDLDTIDIYN 84


>gi|104783272|ref|YP_609770.1| hypothetical protein PSEEN4299 [Pseudomonas entomophila L48]
 gi|95112259|emb|CAK16986.1| conserved hypothetical protein [Pseudomonas entomophila L48]
          Length = 84

 Score = 54.6 bits (131), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 13/61 (21%), Positives = 28/61 (45%), Gaps = 1/61 (1%)

Query: 7  LQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGME 66
           +  ++ +   RRG  E+D++L  F       LS  +  +   ++  +D ++F WF    
Sbjct: 5  TELNRLFWHS-RRGMLELDVLLVPFTQEVYPSLSEDDRALYRRLLTCEDQDMFGWFMERS 63

Query: 67 K 67
          +
Sbjct: 64 E 64


>gi|56479260|ref|YP_160849.1| hypothetical protein ebA6688 [Aromatoleum aromaticum EbN1]
 gi|56315303|emb|CAI09948.1| conserved hypothetical protein [Aromatoleum aromaticum EbN1]
          Length = 78

 Score = 54.3 bits (130), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 16/78 (20%), Positives = 34/78 (43%), Gaps = 1/78 (1%)

Query: 5  MNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTG 64
          M++   ++ ++C RR   E+DL+   F++     L+  +L  LE ++  +D  L+    G
Sbjct: 1  MSIDRGRLRWQC-RRAFLELDLVFARFLERDFDRLTDGQLADLEDLLRCEDHELWAMVNG 59

Query: 65 MEKPPEYLRTPIFKKIYD 82
           E         +   +  
Sbjct: 60 SEPCGNDRWKEMIGLLRQ 77


>gi|308188000|ref|YP_003932131.1| UPF0350 protein [Pantoea vagans C9-1]
 gi|308058510|gb|ADO10682.1| UPF0350 protein [Pantoea vagans C9-1]
          Length = 88

 Score = 54.3 bits (130), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 16/72 (22%), Positives = 32/72 (44%), Gaps = 1/72 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          +I +   RRG  E+D+ +  F       L+  +  +  ++++ DD +LF W     +P +
Sbjct: 8  RIQW-ACRRGMLELDVAIMPFFKFEYDTLNDTDKQVFVALLKSDDPDLFNWLMNHGEPAD 66

Query: 71 YLRTPIFKKIYD 82
               + K I  
Sbjct: 67 PELKRMVKLIQQ 78


>gi|329296871|ref|ZP_08254207.1| hypothetical protein Pstas_10445 [Plautia stali symbiont]
          Length = 88

 Score = 54.3 bits (130), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 16/67 (23%), Positives = 30/67 (44%)

Query: 16 CWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPEYLRTP 75
            RRG  E+D+ +  F  +    LS  +  +  ++++ DD +LF W     +P +     
Sbjct: 12 ACRRGMLELDVSIMPFFKYEYDSLSDSDKQVFVALLKSDDPDLFNWMMNHGEPADPEFKR 71

Query: 76 IFKKIYD 82
          + K I  
Sbjct: 72 MVKLIQQ 78


>gi|224824509|ref|ZP_03697616.1| protein of unknown function DUF339 [Lutiella nitroferrum 2002]
 gi|224603002|gb|EEG09178.1| protein of unknown function DUF339 [Lutiella nitroferrum 2002]
          Length = 82

 Score = 54.3 bits (130), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 16/66 (24%), Positives = 32/66 (48%), Gaps = 1/66 (1%)

Query: 1  MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
          M     ++ ++I +   RRG  E+DL+L  F+      LS  E++  ++++E  D++   
Sbjct: 1  MTDFDPVELKRIRWHS-RRGLLELDLVLERFLAQRFDSLSPAEMSAYKALLELPDNDFLD 59

Query: 61 WFTGME 66
             G  
Sbjct: 60 VVNGKT 65


>gi|325266129|ref|ZP_08132813.1| TPR repeat protein [Kingella denitrificans ATCC 33394]
 gi|324982359|gb|EGC17987.1| TPR repeat protein [Kingella denitrificans ATCC 33394]
          Length = 82

 Score = 54.3 bits (130), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 20/83 (24%), Positives = 36/83 (43%), Gaps = 3/83 (3%)

Query: 1  MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
          M +      R+I ++  RRG  E+D++L  F+ +    LS  EL +  +I+  +D     
Sbjct: 1  MAQFDETAKRRIRFQ-TRRGLLELDIVLRKFMANHFDRLSDDELEIFTAILALEDQEFLA 59

Query: 61 WFTGMEKPPEYLR-TPIFKKIYD 82
                + P+     P+  KI  
Sbjct: 60 -LINQTETPQRSDFEPLLAKIRA 81


>gi|229588984|ref|YP_002871103.1| hypothetical protein PFLU1455 [Pseudomonas fluorescens SBW25]
 gi|229360850|emb|CAY47708.1| conserved hypothetical protein [Pseudomonas fluorescens SBW25]
          Length = 84

 Score = 54.3 bits (130), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 15/80 (18%), Positives = 35/80 (43%), Gaps = 1/80 (1%)

Query: 6  NLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGM 65
           ++  ++ +   RRG  E+D++L  F       L+ V+  +   ++  +D ++F WF   
Sbjct: 4  EVEINRLYWHS-RRGMLELDVLLVPFTKEVYATLNQVDRDLYVRLLTCEDQDMFGWFMER 62

Query: 66 EKPPEYLRTPIFKKIYDYYS 85
           +  +     + + I D   
Sbjct: 63 AESEDPELQRMVRMILDRVQ 82


>gi|332289723|ref|YP_004420575.1| hypothetical protein UMN179_01661 [Gallibacterium anatis UMN179]
 gi|330432619|gb|AEC17678.1| hypothetical protein UMN179_01661 [Gallibacterium anatis UMN179]
          Length = 83

 Score = 54.3 bits (130), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 18/71 (25%), Positives = 29/71 (40%), Gaps = 1/71 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          +I + C RRG  E+D ++  F  +    LS  +      ++   D  LF+W    EK P 
Sbjct: 8  RIEWDC-RRGMLELDKMIMPFYKNEFDHLSDEQKDTFLELLTFTDPQLFRWLMNQEKAPT 66

Query: 71 YLRTPIFKKIY 81
               +   I 
Sbjct: 67 DKLQQMVNLIK 77


>gi|316966329|gb|EFV50923.1| putative integrase core domain protein [Trichinella spiralis]
          Length = 1378

 Score = 54.3 bits (130), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 12/58 (20%), Positives = 29/58 (50%), Gaps = 2/58 (3%)

Query: 30   SFVDHFILELSSVELTMLESII--EEDDSNLFKWFTGMEKPPEYLRTPIFKKIYDYYS 85
             F +  +  L++ +L   + +I  E ++ +++ W TG +  PE L + + + +  Y  
Sbjct: 1311 KFYEEHVNSLTADDLNTYDQLINGEYNEWDIYYWITGKKTVPENLESNVMQMLKSYVK 1368


>gi|77165927|ref|YP_344452.1| hypothetical protein Noc_2469 [Nitrosococcus oceani ATCC 19707]
 gi|76884241|gb|ABA58922.1| Protein of unknown function DUF339 [Nitrosococcus oceani ATCC
          19707]
          Length = 82

 Score = 53.9 bits (129), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 20/71 (28%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          ++ +RC RRG  E+DL+LG+F++     +   E    E+++   D +L+++  G E  P+
Sbjct: 8  RLRWRC-RRGLLELDLLLGNFLEISYESIPDEEKRAFETLLYHSDPDLWRYCLGEEPHPD 66

Query: 71 YLRTPIFKKIY 81
           +   +  KI 
Sbjct: 67 PVTANVIAKIR 77


>gi|66047188|ref|YP_237029.1| hypothetical protein Psyr_3961 [Pseudomonas syringae pv. syringae
          B728a]
 gi|289676643|ref|ZP_06497533.1| hypothetical protein PsyrpsF_25413 [Pseudomonas syringae pv.
          syringae FF5]
 gi|75500891|sp|Q4ZPD1|Y3961_PSEU2 RecName: Full=UPF0350 protein Psyr_3961
 gi|63257895|gb|AAY38991.1| Protein of unknown function DUF339 [Pseudomonas syringae pv.
          syringae B728a]
 gi|330937665|gb|EGH41569.1| hypothetical protein PSYPI_03717 [Pseudomonas syringae pv. pisi
          str. 1704B]
 gi|330950067|gb|EGH50327.1| hypothetical protein PSYCIT7_01415 [Pseudomonas syringae Cit 7]
 gi|330973021|gb|EGH73087.1| hypothetical protein PSYAR_21292 [Pseudomonas syringae pv. aceris
          str. M302273PT]
 gi|330981455|gb|EGH79558.1| hypothetical protein PSYAP_23229 [Pseudomonas syringae pv. aptata
          str. DSM 50252]
          Length = 84

 Score = 53.9 bits (129), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 16/80 (20%), Positives = 37/80 (46%), Gaps = 1/80 (1%)

Query: 6  NLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGM 65
          +++  ++ +   RRG  E+D++L  FV      L+ V+  +   ++  +D ++F WF   
Sbjct: 4  DVELNRLYWHS-RRGMLELDVLLVPFVREVYPHLNDVDRDLYRRLLTCEDQDMFGWFMQR 62

Query: 66 EKPPEYLRTPIFKKIYDYYS 85
           +  +     + + I D   
Sbjct: 63 AESEDAELQRMVRMILDRVQ 82


>gi|330898495|gb|EGH29914.1| hypothetical protein PSYJA_13457 [Pseudomonas syringae pv.
          japonica str. M301072PT]
          Length = 84

 Score = 53.9 bits (129), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 16/80 (20%), Positives = 37/80 (46%), Gaps = 1/80 (1%)

Query: 6  NLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGM 65
          +++  ++ +   RRG  E+D++L  FV      L+ V+  +   ++  +D ++F WF   
Sbjct: 4  DVELNRLYWHS-RRGMLELDVLLVPFVREVYPHLNDVDRDLYRRLLTCEDQDMFGWFMQR 62

Query: 66 EKPPEYLRTPIFKKIYDYYS 85
           +  +     + + I D   
Sbjct: 63 AESEDAELQRMVRMILDRVQ 82


>gi|28871369|ref|NP_793988.1| hypothetical protein PSPTO_4227 [Pseudomonas syringae pv. tomato
          str. DC3000]
 gi|71736155|ref|YP_276094.1| hypothetical protein PSPPH_3958 [Pseudomonas syringae pv.
          phaseolicola 1448A]
 gi|213971129|ref|ZP_03399248.1| conserved hypothetical protein [Pseudomonas syringae pv. tomato
          T1]
 gi|257486553|ref|ZP_05640594.1| hypothetical protein PsyrptA_24985 [Pseudomonas syringae pv.
          tabaci ATCC 11528]
 gi|289628134|ref|ZP_06461088.1| hypothetical protein PsyrpaN_23893 [Pseudomonas syringae pv.
          aesculi str. NCPPB3681]
 gi|289649900|ref|ZP_06481243.1| hypothetical protein Psyrpa2_19439 [Pseudomonas syringae pv.
          aesculi str. 2250]
 gi|301381855|ref|ZP_07230273.1| hypothetical protein PsyrptM_04445 [Pseudomonas syringae pv.
          tomato Max13]
 gi|302059024|ref|ZP_07250565.1| hypothetical protein PsyrptK_03472 [Pseudomonas syringae pv.
          tomato K40]
 gi|302132823|ref|ZP_07258813.1| hypothetical protein PsyrptN_15602 [Pseudomonas syringae pv.
          tomato NCPPB 1108]
 gi|81175084|sp|Q48EU3|Y3958_PSE14 RecName: Full=UPF0350 protein PSPPH_3958
 gi|81175086|sp|Q87XF1|Y4227_PSESM RecName: Full=UPF0350 protein PSPTO_4227
 gi|28854620|gb|AAO57683.1| conserved protein of unknown function [Pseudomonas syringae pv.
          tomato str. DC3000]
 gi|71556708|gb|AAZ35919.1| Uncharacterized conserved protein [Pseudomonas syringae pv.
          phaseolicola 1448A]
 gi|213924118|gb|EEB57694.1| conserved hypothetical protein [Pseudomonas syringae pv. tomato
          T1]
 gi|320325558|gb|EFW81620.1| hypothetical protein PsgB076_06020 [Pseudomonas syringae pv.
          glycinea str. B076]
 gi|320327156|gb|EFW83170.1| hypothetical protein PsgRace4_25451 [Pseudomonas syringae pv.
          glycinea str. race 4]
 gi|330871251|gb|EGH05960.1| hypothetical protein PSYAE_29163 [Pseudomonas syringae pv.
          aesculi str. 0893_23]
 gi|330877445|gb|EGH11594.1| hypothetical protein PSYMP_17895 [Pseudomonas syringae pv.
          morsprunorum str. M302280PT]
 gi|330889492|gb|EGH22153.1| hypothetical protein PSYMO_11832 [Pseudomonas syringae pv. mori
          str. 301020]
 gi|330964531|gb|EGH64791.1| hypothetical protein PSYAC_07735 [Pseudomonas syringae pv.
          actinidiae str. M302091]
 gi|330989042|gb|EGH87145.1| hypothetical protein PLA107_28745 [Pseudomonas syringae pv.
          lachrymans str. M301315]
 gi|331010036|gb|EGH90092.1| hypothetical protein PSYTB_10143 [Pseudomonas syringae pv. tabaci
          ATCC 11528]
 gi|331015592|gb|EGH95648.1| hypothetical protein PLA106_06435 [Pseudomonas syringae pv.
          lachrymans str. M302278PT]
          Length = 84

 Score = 53.9 bits (129), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 16/80 (20%), Positives = 37/80 (46%), Gaps = 1/80 (1%)

Query: 6  NLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGM 65
          +++  ++ +   RRG  E+D++L  FV      L+ V+  +   ++  +D ++F WF   
Sbjct: 4  DVELNRLYWHS-RRGMLELDVLLVPFVREVYPHLNDVDRDLYRRLLTCEDQDMFGWFMQR 62

Query: 66 EKPPEYLRTPIFKKIYDYYS 85
           +  +     + + I D   
Sbjct: 63 AESEDAELQRMVRMILDRVQ 82


>gi|330957817|gb|EGH58077.1| hypothetical protein PMA4326_04464 [Pseudomonas syringae pv.
          maculicola str. ES4326]
          Length = 84

 Score = 53.9 bits (129), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 16/80 (20%), Positives = 37/80 (46%), Gaps = 1/80 (1%)

Query: 6  NLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGM 65
          +++  ++ +   RRG  E+D++L  FV      L+ V+  +   ++  +D ++F WF   
Sbjct: 4  DVELNRLYWHS-RRGMLELDVLLVPFVREVYPHLNDVDRDLYRRLLTCEDQDMFGWFMQR 62

Query: 66 EKPPEYLRTPIFKKIYDYYS 85
           +  +     + + I D   
Sbjct: 63 AESEDPELQRMVRMILDRVQ 82


>gi|167628133|ref|YP_001678633.1| hypothetical protein Fphi_1908 [Francisella philomiragia subsp.
          philomiragia ATCC 25017]
 gi|167598134|gb|ABZ88132.1| conserved hypothetical protein [Francisella philomiragia subsp.
          philomiragia ATCC 25017]
          Length = 95

 Score = 53.9 bits (129), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 20/80 (25%), Positives = 37/80 (46%), Gaps = 1/80 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          KI Y   RRG  E+D+IL  ++++  ++       +    +  +D+++F W      PP+
Sbjct: 15 KIKY-SARRGMLELDIILAPYLNNCYMQEDLAGKKLFVEFLTSEDNDMFDWLFKGVTPPD 73

Query: 71 YLRTPIFKKIYDYYSNNLDR 90
               I K I +    N +R
Sbjct: 74 RYSELINKIILEKKKFNKNR 93


>gi|237798704|ref|ZP_04587165.1| hypothetical protein POR16_07697 [Pseudomonas syringae pv. oryzae
          str. 1_6]
 gi|237806137|ref|ZP_04592841.1| hypothetical protein POR16_36749 [Pseudomonas syringae pv. oryzae
          str. 1_6]
 gi|331021557|gb|EGI01614.1| hypothetical protein POR16_07697 [Pseudomonas syringae pv. oryzae
          str. 1_6]
 gi|331027250|gb|EGI07305.1| hypothetical protein POR16_36749 [Pseudomonas syringae pv. oryzae
          str. 1_6]
          Length = 84

 Score = 53.5 bits (128), Expect = 9e-06,   Method: Composition-based stats.
 Identities = 16/80 (20%), Positives = 37/80 (46%), Gaps = 1/80 (1%)

Query: 6  NLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGM 65
          +++  ++ +   RRG  E+D++L  FV      L+ V+  +   ++  +D ++F WF   
Sbjct: 4  DVELNRLYWHS-RRGMLELDVLLVPFVREVYPHLNDVDRDLYRRLLTCEDQDMFGWFMQR 62

Query: 66 EKPPEYLRTPIFKKIYDYYS 85
           +  +     + + I D   
Sbjct: 63 AESEDAELQRMVRMILDRVQ 82


>gi|298488668|ref|ZP_07006697.1| hypothetical protein PSA3335_4149 [Pseudomonas savastanoi pv.
          savastanoi NCPPB 3335]
 gi|298156741|gb|EFH97832.1| hypothetical protein PSA3335_4149 [Pseudomonas savastanoi pv.
          savastanoi NCPPB 3335]
          Length = 84

 Score = 53.5 bits (128), Expect = 9e-06,   Method: Composition-based stats.
 Identities = 16/80 (20%), Positives = 38/80 (47%), Gaps = 1/80 (1%)

Query: 6  NLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGM 65
          +++  ++ +   RRG  E+D++L +FV      L+ V+  +   ++  +D ++F WF   
Sbjct: 4  DVELNRLYWHS-RRGMLELDVLLVTFVREVYPHLNDVDRDLYRRLLTCEDQDMFGWFMQR 62

Query: 66 EKPPEYLRTPIFKKIYDYYS 85
           +  +     + + I D   
Sbjct: 63 AESEDAELQRMVRMILDRVQ 82


>gi|254448814|ref|ZP_05062271.1| hypothetical protein GP5015_796 [gamma proteobacterium HTCC5015]
 gi|198261655|gb|EDY85943.1| hypothetical protein GP5015_796 [gamma proteobacterium HTCC5015]
          Length = 106

 Score = 53.5 bits (128), Expect = 9e-06,   Method: Composition-based stats.
 Identities = 22/81 (27%), Positives = 43/81 (53%), Gaps = 2/81 (2%)

Query: 3  KNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESII-EEDDSNLFKW 61
           N   +  ++ +RC RRG +E+D ++  ++D + LE SS E    E+++ + ++  LF+ 
Sbjct: 20 SNTENKVAQLKWRC-RRGMKELDQLMLRYLDLYYLEASSSEQQAFETLLNDYEEPLLFRL 78

Query: 62 FTGMEKPPEYLRTPIFKKIYD 82
            G E+  E     + +KI  
Sbjct: 79 LNGQEQAEEASIAEVIEKIRQ 99


>gi|241668663|ref|ZP_04756241.1| hypothetical protein FphipA2_07841 [Francisella philomiragia
          subsp. philomiragia ATCC 25015]
 gi|254877196|ref|ZP_05249906.1| conserved hypothetical protein [Francisella philomiragia subsp.
          philomiragia ATCC 25015]
 gi|254843217|gb|EET21631.1| conserved hypothetical protein [Francisella philomiragia subsp.
          philomiragia ATCC 25015]
          Length = 95

 Score = 53.5 bits (128), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 21/80 (26%), Positives = 38/80 (47%), Gaps = 1/80 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          KI Y   RRG  E+D+IL  ++++  ++       +    +  +D+++F W      PP+
Sbjct: 15 KIKY-SARRGMLELDIILAPYLNNCYMQEDLAGKKLFVEFLTSEDNDMFDWLFKGVTPPD 73

Query: 71 YLRTPIFKKIYDYYSNNLDR 90
            R  I K I +    N +R
Sbjct: 74 RYRELINKIILEKKKFNKNR 93


>gi|288941376|ref|YP_003443616.1| hypothetical protein Alvin_1652 [Allochromatium vinosum DSM 180]
 gi|288896748|gb|ADC62584.1| protein of unknown function DUF339 [Allochromatium vinosum DSM
          180]
          Length = 71

 Score = 53.5 bits (128), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 19/67 (28%), Positives = 31/67 (46%)

Query: 21 TREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPEYLRTPIFKKI 80
            E+D +L  F+D    ELS  E     +++ E D +L  WF    +PPE  +  +  +I
Sbjct: 1  MLELDHLLARFLDLGYAELSESERQDFLALLGEPDPHLSDWFMERSEPPEPRQRALVARI 60

Query: 81 YDYYSNN 87
              S +
Sbjct: 61 LAVVSES 67


>gi|326571375|gb|EGE21390.1| hypothetical protein E9S_02074 [Moraxella catarrhalis BC7]
          Length = 74

 Score = 53.5 bits (128), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 17/64 (26%), Positives = 30/64 (46%), Gaps = 3/64 (4%)

Query: 1  MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNL-- 58
          M        R+I+Y+  RRG +E+D  +  +V    L   + E    E+++  +D +L  
Sbjct: 1  MTIQPTDAQRRIIYQA-RRGLKELDFYIDYYVKSHYLSADADEQQAFETLLSYEDPDLLV 59

Query: 59 FKWF 62
          F W 
Sbjct: 60 FFWV 63


>gi|329120249|ref|ZP_08248917.1| TPR repeat protein [Neisseria bacilliformis ATCC BAA-1200]
 gi|327462590|gb|EGF08913.1| TPR repeat protein [Neisseria bacilliformis ATCC BAA-1200]
          Length = 82

 Score = 53.1 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 21/81 (25%), Positives = 34/81 (41%), Gaps = 1/81 (1%)

Query: 1  MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
          M +      R+I +   RRG  E+D++L  F++     LS  EL++   I++  D     
Sbjct: 1  MTQFDETAKRRIRFL-TRRGLLELDIVLKRFMETEFRHLSDEELSVFVEILDLPDQEFLA 59

Query: 61 WFTGMEKPPEYLRTPIFKKIY 81
             G E        P+  KI 
Sbjct: 60 LVNGKETTDRPQFEPLLDKIR 80


>gi|300815651|ref|ZP_07095875.1| TPR repeat region protein [Escherichia coli MS 107-1]
 gi|300820701|ref|ZP_07100852.1| TPR repeat region protein [Escherichia coli MS 119-7]
 gi|300896207|ref|ZP_07114756.1| TPR repeat region protein [Escherichia coli MS 198-1]
 gi|300906553|ref|ZP_07124244.1| TPR repeat region protein [Escherichia coli MS 84-1]
 gi|300921229|ref|ZP_07137602.1| TPR repeat region protein [Escherichia coli MS 115-1]
 gi|300925122|ref|ZP_07141036.1| TPR repeat region protein [Escherichia coli MS 182-1]
 gi|300928167|ref|ZP_07143709.1| TPR repeat region protein [Escherichia coli MS 187-1]
 gi|300936037|ref|ZP_07150985.1| TPR repeat region protein [Escherichia coli MS 21-1]
 gi|300947620|ref|ZP_07161791.1| TPR repeat region [Escherichia coli MS 116-1]
 gi|300954263|ref|ZP_07166726.1| TPR repeat region protein [Escherichia coli MS 175-1]
 gi|300980309|ref|ZP_07174963.1| TPR repeat region protein [Escherichia coli MS 45-1]
 gi|300995671|ref|ZP_07181199.1| TPR repeat region protein [Escherichia coli MS 200-1]
 gi|301049319|ref|ZP_07196289.1| TPR repeat region [Escherichia coli MS 185-1]
 gi|301303055|ref|ZP_07209182.1| TPR repeat region protein [Escherichia coli MS 124-1]
 gi|301327298|ref|ZP_07220554.1| TPR repeat region protein [Escherichia coli MS 78-1]
 gi|301643753|ref|ZP_07243791.1| TPR repeat region protein [Escherichia coli MS 146-1]
 gi|309793969|ref|ZP_07688394.1| TPR repeat region [Escherichia coli MS 145-7]
 gi|300298918|gb|EFJ55303.1| TPR repeat region [Escherichia coli MS 185-1]
 gi|300304779|gb|EFJ59299.1| TPR repeat region protein [Escherichia coli MS 200-1]
 gi|300318724|gb|EFJ68508.1| TPR repeat region protein [Escherichia coli MS 175-1]
 gi|300359941|gb|EFJ75811.1| TPR repeat region protein [Escherichia coli MS 198-1]
 gi|300401592|gb|EFJ85130.1| TPR repeat region protein [Escherichia coli MS 84-1]
 gi|300409317|gb|EFJ92855.1| TPR repeat region protein [Escherichia coli MS 45-1]
 gi|300411835|gb|EFJ95145.1| TPR repeat region protein [Escherichia coli MS 115-1]
 gi|300418724|gb|EFK02035.1| TPR repeat region protein [Escherichia coli MS 182-1]
 gi|300452795|gb|EFK16415.1| TPR repeat region [Escherichia coli MS 116-1]
 gi|300458829|gb|EFK22322.1| TPR repeat region protein [Escherichia coli MS 21-1]
 gi|300463807|gb|EFK27300.1| TPR repeat region protein [Escherichia coli MS 187-1]
 gi|300526965|gb|EFK48034.1| TPR repeat region protein [Escherichia coli MS 119-7]
 gi|300531580|gb|EFK52642.1| TPR repeat region protein [Escherichia coli MS 107-1]
 gi|300841719|gb|EFK69479.1| TPR repeat region protein [Escherichia coli MS 124-1]
 gi|300846161|gb|EFK73921.1| TPR repeat region protein [Escherichia coli MS 78-1]
 gi|301077852|gb|EFK92658.1| TPR repeat region protein [Escherichia coli MS 146-1]
 gi|308122376|gb|EFO59638.1| TPR repeat region [Escherichia coli MS 145-7]
 gi|315256780|gb|EFU36748.1| TPR repeat region [Escherichia coli MS 85-1]
 gi|315289440|gb|EFU48835.1| TPR repeat region [Escherichia coli MS 110-3]
 gi|315293870|gb|EFU53222.1| TPR repeat region [Escherichia coli MS 153-1]
 gi|315295685|gb|EFU55005.1| TPR repeat region [Escherichia coli MS 16-3]
 gi|323180341|gb|EFZ65893.1| hypothetical protein ECOK1180_1023 [Escherichia coli 1180]
 gi|324005549|gb|EGB74768.1| TPR repeat region [Escherichia coli MS 57-2]
 gi|324011753|gb|EGB80972.1| TPR repeat region protein [Escherichia coli MS 60-1]
 gi|324017294|gb|EGB86513.1| TPR repeat region [Escherichia coli MS 117-3]
          Length = 72

 Score = 53.1 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 16/62 (25%), Positives = 27/62 (43%), Gaps = 1/62 (1%)

Query: 21 TREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPEYLRTPIFKKI 80
           RE+D+ +  F +H    LS  E  +   ++E DD +LF W     K P      +  ++
Sbjct: 1  MRELDISIMPFFEHEYDSLSDDEKRIFIRLLECDDPDLFNWLMNHGK-PADAELEMMVRL 59

Query: 81 YD 82
            
Sbjct: 60 IQ 61


>gi|34496524|ref|NP_900739.1| hypothetical protein CV_1069 [Chromobacterium violaceum ATCC
          12472]
 gi|34102378|gb|AAQ58744.1| conserved hypothetical protein [Chromobacterium violaceum ATCC
          12472]
          Length = 82

 Score = 52.7 bits (126), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 14/66 (21%), Positives = 30/66 (45%), Gaps = 1/66 (1%)

Query: 1  MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
          M     ++ ++I +R  RRG  E+DL+L  F      +L+  ++     +++  D++   
Sbjct: 1  MTAYDPIELKRIRWRS-RRGLLELDLVLEKFFAGPFDQLAPAQIDAYRRLLDLPDTDFLD 59

Query: 61 WFTGME 66
             G  
Sbjct: 60 VVNGKA 65


>gi|304396718|ref|ZP_07378598.1| protein of unknown function DUF339 [Pantoea sp. aB]
 gi|304355514|gb|EFM19881.1| protein of unknown function DUF339 [Pantoea sp. aB]
          Length = 88

 Score = 52.7 bits (126), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 16/77 (20%), Positives = 34/77 (44%), Gaps = 5/77 (6%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPE 70
          +I +   RRG  E+D+ +  F       L+  +  +  ++++ DD +LF W     +P  
Sbjct: 8  RIQW-ACRRGMLELDVAIMPFFKFEYDTLNDTDKQVFVNLLKSDDPDLFNWLMNHGEP-- 64

Query: 71 YLRTPIFKKIYDYYSNN 87
            + P  K++ +     
Sbjct: 65 --KDPELKRMVNLIQQR 79


>gi|126667165|ref|ZP_01738139.1| TPR repeat region superfamily protein [Marinobacter sp. ELB17]
 gi|126628321|gb|EAZ98944.1| TPR repeat region superfamily protein [Marinobacter sp. ELB17]
          Length = 90

 Score = 52.3 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 14/58 (24%), Positives = 33/58 (56%), Gaps = 1/58 (1%)

Query: 6  NLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFT 63
          + + +++ +   RRG  E+D +L  F++    +L+  +    E ++  +DS++F+WF 
Sbjct: 10 SPEFKRLWWHS-RRGMLELDNLLVPFLEQAYCDLNPNDQACYEKLLTCEDSDMFEWFM 66


>gi|242207871|ref|XP_002469788.1| predicted protein [Postia placenta Mad-698-R]
 gi|220731208|gb|EED85055.1| predicted protein [Postia placenta Mad-698-R]
          Length = 136

 Score = 52.3 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 14/40 (35%), Positives = 24/40 (60%)

Query: 11  KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESI 50
           + +Y+  RRGT E DL+L +F    +  ++  ELT L+ +
Sbjct: 64  RAMYQSRRRGTLESDLLLSTFAKEQLYTMNEAELTELDIL 103


>gi|88797937|ref|ZP_01113524.1| hypothetical protein MED297_00835 [Reinekea sp. MED297]
 gi|88779134|gb|EAR10322.1| hypothetical protein MED297_00835 [Reinekea sp. MED297]
          Length = 67

 Score = 52.3 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 14/66 (21%), Positives = 28/66 (42%)

Query: 21 TREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPEYLRTPIFKKI 80
            E+D+IL  F +    +LS  +     ++I  +D +LF WF      P+     +   +
Sbjct: 1  MLELDVILLPFTEKRYRDLSPEDQRDYHALINCEDQDLFNWFMEKAVCPDPSIRRMVNLV 60

Query: 81 YDYYSN 86
           ++   
Sbjct: 61 LEHARQ 66


>gi|220934654|ref|YP_002513553.1| protein of unknown function DUF339 [Thioalkalivibrio sp.
          HL-EbGR7]
 gi|219995964|gb|ACL72566.1| protein of unknown function DUF339 [Thioalkalivibrio sp.
          HL-EbGR7]
          Length = 93

 Score = 52.3 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 16/78 (20%), Positives = 36/78 (46%), Gaps = 1/78 (1%)

Query: 9  CRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKP 68
           R++ +   RRG  E+DL+L +F+ H  ++L +      E +++  D+ L +   G  + 
Sbjct: 15 LRRLRW-SCRRGMLELDLLLDAFLKHGFVKLDARGRETFERLLDYPDTTLLQLLMGQMQS 73

Query: 69 PEYLRTPIFKKIYDYYSN 86
           +     + + I     +
Sbjct: 74 SDRDVAHVVEFIRQTARH 91


>gi|261856933|ref|YP_003264216.1| hypothetical protein Hneap_2360 [Halothiobacillus neapolitanus
          c2]
 gi|261837402|gb|ACX97169.1| protein of unknown function DUF339 [Halothiobacillus neapolitanus
          c2]
          Length = 82

 Score = 51.9 bits (124), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 15/53 (28%), Positives = 30/53 (56%), Gaps = 1/53 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFT 63
          +I + C RRG  E+D++L  F++  I  L++ +    E ++  +D  L++  T
Sbjct: 12 RIRWHC-RRGMLELDMVLARFLEEHIDRLATPQWQEFERLVALEDQVLWQRIT 63


>gi|289209037|ref|YP_003461103.1| hypothetical protein TK90_1876 [Thioalkalivibrio sp. K90mix]
 gi|288944668|gb|ADC72367.1| protein of unknown function DUF339 [Thioalkalivibrio sp. K90mix]
          Length = 84

 Score = 51.9 bits (124), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 15/56 (26%), Positives = 25/56 (44%), Gaps = 1/56 (1%)

Query: 11 KIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGME 66
          +  +RC RRG  E D +LG F+     +L        E +++  D+ L     G +
Sbjct: 6  RTRWRC-RRGMLENDWLLGQFLAQGYAQLDQEGRDAFERLLDYPDNVLLDVVMGRQ 60


>gi|113461740|ref|YP_719809.1| hypothetical protein HS_1604 [Haemophi