RPSBLAST alignment for GI: 254780946 and conserved domain: pfam03937

>gnl|CDD|146523 pfam03937, Sdh5, Protein of unknown function (DUF339). This family of uncharacterized proteins. Based on personal observation it was previously annotated in Pfam as being a divergent TPR repeat but structural evidence has indicated this is not true. Length = 51
 Score = 69.4 bits (171), Expect = 2e-13
 Identities = 23/51 (45%), Positives = 32/51 (62%)

Query: 14 YRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTG 64
          +R WRRG  E+DL+LG F D  +  LS  EL   E +++ +D +LF W TG
Sbjct: 1  WRSWRRGMLELDLLLGRFADAHLDTLSEEELDAFERLLDLEDPDLFDWLTG 51