RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780946|ref|YP_003065359.1| hypothetical protein CLIBASIA_04225 [Candidatus Liberibacter asiaticus str. psy62] (98 letters) >gnl|CDD|183713 PRK12740, PRK12740, elongation factor G; Reviewed. Length = 668 Score = 30.5 bits (70), Expect = 0.095 Identities = 10/34 (29%), Positives = 18/34 (52%) Query: 45 TMLESIIEEDDSNLFKWFTGMEKPPEYLRTPIFK 78 +LE++ E DD + K+ G E E ++ + K Sbjct: 196 ELLEALAEFDDELMEKYLEGEELSEEEIKAGLRK 229 >gnl|CDD|184989 PRK15029, PRK15029, arginine decarboxylase; Provisional. Length = 755 Score = 28.7 bits (64), Expect = 0.38 Identities = 13/33 (39%), Positives = 18/33 (54%), Gaps = 6/33 (18%) Query: 71 YLRTPIFKKIYDYYSNNLDRKNM------LGSL 97 + +TP + +DYY NL R +M LGSL Sbjct: 168 FTKTPAGRFYHDYYGENLFRTDMGIERTSLGSL 200 >gnl|CDD|183122 PRK11410, PRK11410, hypothetical protein; Provisional. Length = 561 Score = 27.4 bits (61), Expect = 0.84 Identities = 11/36 (30%), Positives = 18/36 (50%), Gaps = 5/36 (13%) Query: 68 PPEYLRTPIFKKIY-----DYYSNNLDRKNMLGSLQ 98 P + L P+ + + YY N+ DR + GSL+ Sbjct: 69 PKDLLTVPLLRDVLTEDFVFYYENHADRLGLEGSLR 104 >gnl|CDD|162931 TIGR02578, cas_TM1811_Csm1, CRISPR-associated protein, Csm1 family. The family is designated Csm2, for CRISPR/Cas Subtype Mtube Protein 2. A typical example is TM1811 from Thermotoga maritima. CRISPR are Clustered Regularly Interspaced Short Palindromic Repeats. This protein family belongs to a conserved gene cluster regularly found near CRISPR repeats. Length = 648 Score = 26.6 bits (59), Expect = 1.6 Identities = 12/34 (35%), Positives = 15/34 (44%) Query: 33 DHFILELSSVELTMLESIIEEDDSNLFKWFTGME 66 HF L L + E LE + E + L K F G Sbjct: 306 GHFYLLLPNTEEARLEKLRERIEEELLKEFRGEM 339 >gnl|CDD|150567 pfam09909, DUF2138, Uncharacterized protein conserved in bacteria (DUF2138). This domain, found in various hypothetical prokaryotic proteins, has no known function. Length = 552 Score = 26.3 bits (58), Expect = 1.7 Identities = 12/36 (33%), Positives = 19/36 (52%), Gaps = 5/36 (13%) Query: 68 PPEYLRTPIFKKIY-----DYYSNNLDRKNMLGSLQ 98 P + LR P+ + + YY N+ DR + GSL+ Sbjct: 60 PKDLLRVPLLRDVLTEDFVFYYENHADRLGLEGSLR 95 >gnl|CDD|179650 PRK03803, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional. Length = 448 Score = 25.3 bits (56), Expect = 4.0 Identities = 10/25 (40%), Positives = 16/25 (64%), Gaps = 1/25 (4%) Query: 20 GTREMDLILGSFVDHFILELSSVEL 44 GT +DL+ + ++LELSS +L Sbjct: 144 GTPALDLLSDD-PELYVLELSSFQL 167 >gnl|CDD|148339 pfam06679, DUF1180, Protein of unknown function (DUF1180). This family consists of several hypothetical mammalian proteins of around 190 residues in length. The function of this family is unknown. Length = 163 Score = 25.3 bits (55), Expect = 4.1 Identities = 11/21 (52%), Positives = 14/21 (66%) Query: 39 LSSVELTMLESIIEEDDSNLF 59 ++ELT LE E+DDS LF Sbjct: 136 AENMELTPLEQDDEDDDSTLF 156 >gnl|CDD|182803 PRK10878, PRK10878, hypothetical protein; Provisional. Length = 72 Score = 25.1 bits (55), Expect = 4.7 Identities = 16/47 (34%), Positives = 24/47 (51%) Query: 22 REMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKP 68 RE+D+ + F +H LS E + ++E DD +LF W KP Sbjct: 2 RELDISIMPFFEHEYDSLSDDEKRIFIRLLECDDPDLFNWLMNHGKP 48 >gnl|CDD|183221 PRK11595, PRK11595, DNA utilization protein GntX; Provisional. Length = 227 Score = 25.0 bits (55), Expect = 5.1 Identities = 7/13 (53%), Positives = 9/13 (69%) Query: 15 RCWRRGTREMDLI 27 R WRRG + DL+ Sbjct: 125 RHWRRGFNQSDLL 137 >gnl|CDD|163229 TIGR03355, VI_chp_2, type VI secretion protein, EvpB/VC_A0108 family. Work by Mougous, et al. (2006), describes IAHP-related loci as a type VI secretion system (PubMed:16763151). This protein family is associated with type VI secretion loci, although not treated explicitly by Mougous, et al. Length = 473 Score = 24.6 bits (54), Expect = 5.4 Identities = 7/18 (38%), Positives = 13/18 (72%) Query: 66 EKPPEYLRTPIFKKIYDY 83 E PE+ ++ +FKK+Y+ Sbjct: 114 EDAPEFDQSGLFKKVYEE 131 >gnl|CDD|180657 PRK06687, PRK06687, chlorohydrolase; Validated. Length = 419 Score = 24.6 bits (53), Expect = 5.9 Identities = 13/32 (40%), Positives = 15/32 (46%), Gaps = 2/32 (6%) Query: 44 LTMLESIIEEDDSNLFKWFTGMEKPPEYLRTP 75 +T L I DDSNL +W P E TP Sbjct: 69 MTGLRGI--RDDSNLHEWLNDYIWPAESEFTP 98 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.323 0.139 0.425 Gapped Lambda K H 0.267 0.0741 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 1,602,925 Number of extensions: 87458 Number of successful extensions: 184 Number of sequences better than 10.0: 1 Number of HSP's gapped: 184 Number of HSP's successfully gapped: 20 Length of query: 98 Length of database: 5,994,473 Length adjustment: 65 Effective length of query: 33 Effective length of database: 4,589,953 Effective search space: 151468449 Effective search space used: 151468449 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 50 (23.0 bits)