RPSBLAST alignment of GI: 254780946 and MMDB domain: 1x6i_A_

>1x6i_A (A:) Hypothetical protein YGFY; structural genomics, transcriptional regulation, structure 2 function project, S2F, unknown function; 1.20A {Escherichia coli} PDB: 1x6j_ALength = 91
 Score = 84.0 bits (208), Expect = 7e-18
 Identities = 21/84 (25%), Positives = 38/84 (45%)

Query: 4  NMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFT 63
          +M++  +  ++   RRG RE+D+ +  F +H    LS  E  +   ++E DD +LF W  
Sbjct: 3  HMDINNKARIHWACRRGMRELDISIMPFFEHEYDSLSDDEKRIFIRLLECDDPDLFNWLM 62

Query: 64 GMEKPPEYLRTPIFKKIYDYYSNN 87
             KP +     + + I       
Sbjct: 63 NHGKPADAELEMMVRLIQTRNRER 86