RPS-BLAST 2.2.22 [Sep-27-2009]

Database: mmdb70 
           33,805 sequences; 4,956,049 total letters

Searching..................................................done

Query= gi|254780946|ref|YP_003065359.1| hypothetical protein
CLIBASIA_04225 [Candidatus Liberibacter asiaticus str. psy62]
         (98 letters)



>1x6i_A Hypothetical protein YGFY; structural genomics,
          transcriptional regulation, structure 2 function
          project, S2F, unknown function; 1.20A {Escherichia
          coli} PDB: 1x6j_A (A:)
          Length = 91

 Score = 84.0 bits (208), Expect = 7e-18
 Identities = 21/84 (25%), Positives = 38/84 (45%)

Query: 4  NMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFT 63
          +M++  +  ++   RRG RE+D+ +  F +H    LS  E  +   ++E DD +LF W  
Sbjct: 3  HMDINNKARIHWACRRGMRELDISIMPFFEHEYDSLSDDEKRIFIRLLECDDPDLFNWLM 62

Query: 64 GMEKPPEYLRTPIFKKIYDYYSNN 87
             KP +     + + I       
Sbjct: 63 NHGKPADAELEMMVRLIQTRNRER 86


>1puz_A Conserved hypothetical protein; NMA1147, MR19, structural
          genomics, PSI, protein structure initiative; NMR
          {Neisseria meningitidis MC58} (A:)
          Length = 82

 Score = 77.4 bits (191), Expect = 7e-16
 Identities = 25/80 (31%), Positives = 38/80 (47%), Gaps = 1/80 (1%)

Query: 1  MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60
          M    ++  RKI ++  RRG  E+DLI G F++     LS  EL+    I+E  D  L  
Sbjct: 1  MMVFDDIAKRKIRFQT-RRGLLELDLIFGRFMEKEFEHLSDKELSEFSEILEFQDQELLA 59

Query: 61 WFTGMEKPPEYLRTPIFKKI 80
             G  +  +    P+ +KI
Sbjct: 60 LINGHSETDKGHLIPMLEKI 79


>2jr5_A UPF0350 protein VC_2471; structure, structural genomics,
          PSI, protein structure initiative, northeast structural
          genomics consortium, NESG; NMR {Vibrio cholerae}
          (A:33-94)
          Length = 62

 Score = 30.1 bits (68), Expect = 0.11
 Identities = 11/46 (23%), Positives = 19/46 (41%)

Query: 38 ELSSVELTMLESIIEEDDSNLFKWFTGMEKPPEYLRTPIFKKIYDY 83
           L+  E     +++E DD +LF W  G  +        +  KI  +
Sbjct: 3  SLTESEQDDFVALLESDDPDLFAWVMGHGRCENLGLAAMVDKIVAH 48


>2i1o_A Nicotinate phosphoribosyltransferase; ZIN ION, zinc finger
           motif, structural genomics, PSI, protein structure
           initiative; 2.40A {Thermoplasma acidophilum} PDB:
           1ytd_A* 1yte_A* 1ytk_A (A:39-108,A:304-398)
          Length = 165

 Score = 23.6 bits (51), Expect = 9.4
 Identities = 7/27 (25%), Positives = 10/27 (37%), Gaps = 1/27 (3%)

Query: 1   MKKNMNLQCRKIVYRCWRRGTREMDLI 27
            K+   +  RK V RC      E+   
Sbjct: 89  TKR-GKMSGRKNVLRCTSCHRIEVVPA 114


  Database: mmdb70
    Posted date:  Jun 20, 2010  3:12 AM
  Number of letters in database: 4,956,049
  Number of sequences in database:  33,805
  
Lambda     K      H
   0.323    0.139    0.425 

Gapped
Lambda     K      H
   0.267   0.0668    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 33805
Number of Hits to DB: 789,322
Number of extensions: 31587
Number of successful extensions: 74
Number of sequences better than 10.0: 1
Number of HSP's gapped: 74
Number of HSP's successfully gapped: 10
Length of query: 98
Length of database: 4,956,049
Length adjustment: 57
Effective length of query: 41
Effective length of database: 3,029,164
Effective search space: 124195724
Effective search space used: 124195724
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 50 (23.2 bits)