RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= gi|254780946|ref|YP_003065359.1| hypothetical protein CLIBASIA_04225 [Candidatus Liberibacter asiaticus str. psy62] (98 letters) >1puz_A Conserved hypothetical protein; NMA1147, MR19, structural genomics, PSI, protein structure initiative; NMR {Neisseria meningitidis MC58} SCOP: a.218.1.1 Length = 82 Score = 74.7 bits (184), Expect = 4e-15 Identities = 24/71 (33%), Positives = 35/71 (49%), Gaps = 1/71 (1%) Query: 10 RKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPP 69 RKI ++ RRG E+DLI G F++ LS EL+ I+E D L G + Sbjct: 10 RKIRFQT-RRGLLELDLIFGRFMEKEFEHLSDKELSEFSEILEFQDQELLALINGHSETD 68 Query: 70 EYLRTPIFKKI 80 + P+ +KI Sbjct: 69 KGHLIPMLEKI 79 >2jr5_A UPF0350 protein VC_2471; structure, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Vibrio cholerae} Length = 94 Score = 73.2 bits (180), Expect = 1e-14 Identities = 19/79 (24%), Positives = 36/79 (45%), Gaps = 1/79 (1%) Query: 10 RKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPP 69 +I + C RRG E+D+++ F + L+ E +++E DD +LF W G + Sbjct: 8 ARIKWAC-RRGMLELDVVIMPFFEECFDSLTESEQDDFVALLESDDPDLFAWVMGHGRCE 66 Query: 70 EYLRTPIFKKIYDYYSNNL 88 + KI + + + Sbjct: 67 NLGLAAMVDKIVAHNLSKV 85 >1x6i_A Hypothetical protein YGFY; structural genomics, transcriptional regulation, structure 2 function project, S2F, unknown function; 1.20A {Escherichia coli} PDB: 1x6j_A Length = 91 Score = 70.9 bits (174), Expect = 6e-14 Identities = 22/77 (28%), Positives = 35/77 (45%), Gaps = 1/77 (1%) Query: 10 RKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPP 69 +I + C RRG RE+D+ + F +H LS E + ++E DD +LF W KP Sbjct: 10 ARIHWAC-RRGMRELDISIMPFFEHEYDSLSDDEKRIFIRLLECDDPDLFNWLMNHGKPA 68 Query: 70 EYLRTPIFKKIYDYYSN 86 + + + I Sbjct: 69 DAELEMMVRLIQTRNRE 85 >2pff_B Fatty acid synthase subunit beta; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Length = 2006 Score = 38.0 bits (88), Expect = 6e-04 Identities = 12/67 (17%), Positives = 20/67 (29%), Gaps = 16/67 (23%) Query: 22 REMDLILGSFVDHFILELSSVELTMLESIIEEDDS---------NLFKWFTGMEKPP--E 70 R++ V I + L +I N+ +W P + Sbjct: 174 RDLYQTYHVLVGDLIKFSAE----TLSELIRTTLDAEKVFTQGLNILEWLENPSNTPDKD 229 Query: 71 YLRT-PI 76 YL + PI Sbjct: 230 YLLSIPI 236 >1nt0_A MAsp2, mannose-binding protein associated serine protease-2; CUB domain, EGF like domain., hydrolase, sugar binding protein; HET: NAG EDO; 2.70A {Rattus norvegicus} SCOP: b.23.1.1 b.23.1.1 g.3.11.1 Length = 286 Score = 26.2 bits (56), Expect = 2.1 Identities = 12/56 (21%), Positives = 20/56 (35%) Query: 17 WRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPEYL 72 + E I FV+ F +E+ +S+ + D + F G PP Sbjct: 194 YNIRLEEGFSITLDFVESFDVEMHPEAQCPYDSLKIQTDKREYGPFCGKTLPPRIE 249 >2r7g_A PP110, retinoblastoma-associated protein, P105-RB, RB; retinoblastoma protein, E2F displacement, transcription repressor; 1.67A {Homo sapiens} SCOP: a.74.1.3 a.74.1.3 PDB: 1n4m_A 1gh6_B 1gux_A 1o9k_A 1ad6_A 1gux_B 1o9k_B Length = 347 Score = 24.8 bits (54), Expect = 5.0 Identities = 14/46 (30%), Positives = 20/46 (43%), Gaps = 4/46 (8%) Query: 39 LSSVELTMLESIIEEDDSNLFKWFTGMEKPPEYLRTPI---FKKIY 81 L E ++ES+ DS LF K E T + +KK+Y Sbjct: 171 LERCEHRIMESLAWLSDSPLF-DLIKQSKDREGKSTSLSLFYKKVY 215 >2jyl_A Capsid protein P24 (Ca); HIV-1, carboxy-terminal, dimerization domain, CTD, 3D- NMR, capsid protein (Ca), double mutant; NMR {Human immunodeficiency virus 1} PDB: 2k1c_A* Length = 105 Score = 24.4 bits (53), Expect = 6.5 Identities = 7/24 (29%), Positives = 10/24 (41%), Gaps = 1/24 (4%) Query: 3 KNMNLQCRKIVYRCWRRGT-REMD 25 +N N C+ I+ T EM Sbjct: 66 QNANPDCKTILKALGPGATLEEMM 89 >2eqo_A TNF receptor-associated factor 3-interacting protein 1; STN_TRAF3IP1_ND domain, interleukin 13 receptor alpha 1-binding protein-1 [HOMO sapiens]; NMR {Homo sapiens} Length = 140 Score = 24.0 bits (52), Expect = 8.3 Identities = 9/44 (20%), Positives = 18/44 (40%), Gaps = 6/44 (13%) Query: 46 MLESIIEEDDSNLFKWFTGMEKPP---EYLRTPIFKKIYDYYSN 86 M +++ L K +PP + L P F+ ++D + Sbjct: 8 MNAAVVRRTQEALGKVI---RRPPLTEKLLSKPPFRYLHDIITE 48 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.323 0.139 0.425 Gapped Lambda K H 0.267 0.0623 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 907,954 Number of extensions: 37669 Number of successful extensions: 132 Number of sequences better than 10.0: 1 Number of HSP's gapped: 132 Number of HSP's successfully gapped: 17 Length of query: 98 Length of database: 5,693,230 Length adjustment: 64 Effective length of query: 34 Effective length of database: 4,141,614 Effective search space: 140814876 Effective search space used: 140814876 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 50 (23.3 bits)