RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254780946|ref|YP_003065359.1| hypothetical protein CLIBASIA_04225 [Candidatus Liberibacter asiaticus str. psy62] (98 letters) >d1puza_ a.218.1.1 (A:) Hypothetical protein NMA1147 {Neisseria meningitidis, mc58 [TaxId: 487]} Length = 82 Score = 71.7 bits (176), Expect = 2e-14 Identities = 24/71 (33%), Positives = 35/71 (49%), Gaps = 1/71 (1%) Query: 10 RKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPP 69 RKI ++ RRG E+DLI G F++ LS EL+ I+E D L G + Sbjct: 10 RKIRFQT-RRGLLELDLIFGRFMEKEFEHLSDKELSEFSEILEFQDQELLALINGHSETD 68 Query: 70 EYLRTPIFKKI 80 + P+ +KI Sbjct: 69 KGHLIPMLEKI 79 >d1gph11 c.61.1.1 (1:235-465) Glutamine PRPP amidotransferase, C-terminal domain {Bacillus subtilis [TaxId: 1423]} Length = 231 Score = 25.4 bits (55), Expect = 1.4 Identities = 10/60 (16%), Positives = 17/60 (28%) Query: 8 QCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFKWFTGMEK 67 R+IV G E+ + + S T E I + + G + Sbjct: 119 TSRRIVTMLREAGATEVHVKISSPPIAHPCFYGIDTSTHEELIASSHSVDEIRQEIGADT 178 >d2o8ra3 d.136.1.4 (A:318-505) Polyphosphate kinase, PPK {Porphyromonas gingivalis [TaxId: 837]} Length = 188 Score = 25.5 bits (56), Expect = 1.4 Identities = 6/21 (28%), Positives = 9/21 (42%) Query: 51 IEEDDSNLFKWFTGMEKPPEY 71 I D LF+ G +P + Sbjct: 167 IVHDVYRLFRILDGDPEPARF 187 >d1u4ga_ d.92.1.2 (A:) Elastase {Pseudomonas aeruginosa [TaxId: 287]} Length = 298 Score = 24.9 bits (54), Expect = 1.7 Identities = 1/14 (7%), Positives = 4/14 (28%) Query: 77 FKKIYDYYSNNLDR 90 ++ Y + Sbjct: 80 GGVVFKLYRDWFGT 93 >d1xdpa3 d.136.1.4 (A:315-501) Polyphosphate kinase, PPK {Escherichia coli [TaxId: 562]} Length = 187 Score = 24.0 bits (52), Expect = 3.5 Identities = 3/21 (14%), Positives = 8/21 (38%) Query: 51 IEEDDSNLFKWFTGMEKPPEY 71 I + +F + +P + Sbjct: 166 ITNEVRRVFNFIENPYRPVTF 186 >d1k1xa2 b.30.5.8 (A:385-659) 4-alpha-glucanotransferase, C-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Length = 275 Score = 24.0 bits (52), Expect = 3.8 Identities = 10/46 (21%), Positives = 15/46 (32%), Gaps = 9/46 (19%) Query: 10 RKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDD 55 R++ Y R DHFI +++ L E D Sbjct: 92 RELAYDWQLRA---------ILQDHFIKPEETLDNYRLVKYHELGD 128 >d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Length = 267 Score = 23.7 bits (50), Expect = 4.7 Identities = 11/35 (31%), Positives = 18/35 (51%) Query: 46 MLESIIEEDDSNLFKWFTGMEKPPEYLRTPIFKKI 80 +LE+I+E D+ L K+ G E E L + + Sbjct: 201 VLEAIVETDEGLLEKYLEGEEVTGEALEKAFHEAV 235 >d2b5ti1 e.1.1.1 (I:6-431) Antithrombin {Human (Homo sapiens) [TaxId: 9606]} Length = 426 Score = 23.6 bits (50), Expect = 4.9 Identities = 19/99 (19%), Positives = 32/99 (32%), Gaps = 9/99 (9%) Query: 1 MKKNMNLQCRKIVYRCWRRGTR--EMDLILGSFVDHFILELSSVELTMLESIIEEDDSNL 58 +M Q K YR GT+ E+ IL L +E + + L Sbjct: 242 CSASMMYQEGKFRYRRVAEGTQVLELPFKGDDITMVLILPKPEKSLAKVEKELTPEV--L 299 Query: 59 FKWFTGMEKPPEYLRTPIFKKIYDYYSNNLDRKNMLGSL 97 +W +E+ + P F+ + K L + Sbjct: 300 QEWLDELEEMMLCVHMPRFRIEDGF-----SLKEQLQDM 333 >d2g9wa1 a.4.5.39 (A:3-124) Hypothetical protein Rv1846c {Mycobacterium tuberculosis [TaxId: 1773]} Length = 122 Score = 22.8 bits (49), Expect = 7.7 Identities = 5/29 (17%), Positives = 13/29 (44%) Query: 28 LGSFVDHFILELSSVELTMLESIIEEDDS 56 + + HF+ + + E L + E ++ Sbjct: 94 RQAALVHFVERVGADEADALRRALAELEA 122 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.323 0.139 0.425 Gapped Lambda K H 0.267 0.0641 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 391,570 Number of extensions: 16449 Number of successful extensions: 62 Number of sequences better than 10.0: 1 Number of HSP's gapped: 62 Number of HSP's successfully gapped: 17 Length of query: 98 Length of database: 2,407,596 Length adjustment: 60 Effective length of query: 38 Effective length of database: 1,583,796 Effective search space: 60184248 Effective search space used: 60184248 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 47 (22.1 bits)