BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780946|ref|YP_003065359.1| hypothetical protein CLIBASIA_04225 [Candidatus Liberibacter asiaticus str. psy62] (98 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780946|ref|YP_003065359.1| hypothetical protein CLIBASIA_04225 [Candidatus Liberibacter asiaticus str. psy62] Length = 98 Score = 204 bits (518), Expect = 3e-55, Method: Compositional matrix adjust. Identities = 98/98 (100%), Positives = 98/98 (100%) Query: 1 MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60 MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK Sbjct: 1 MKKNMNLQCRKIVYRCWRRGTREMDLILGSFVDHFILELSSVELTMLESIIEEDDSNLFK 60 Query: 61 WFTGMEKPPEYLRTPIFKKIYDYYSNNLDRKNMLGSLQ 98 WFTGMEKPPEYLRTPIFKKIYDYYSNNLDRKNMLGSLQ Sbjct: 61 WFTGMEKPPEYLRTPIFKKIYDYYSNNLDRKNMLGSLQ 98 >gi|254780264|ref|YP_003064677.1| elongation factor G [Candidatus Liberibacter asiaticus str. psy62] Length = 701 Score = 24.3 bits (51), Expect = 0.53, Method: Composition-based stats. Identities = 11/31 (35%), Positives = 18/31 (58%) Query: 46 MLESIIEEDDSNLFKWFTGMEKPPEYLRTPI 76 M+ESI+E DDS + + G + +R+ I Sbjct: 220 MIESIVELDDSAMDSYLQGESFSSDRIRSLI 250 >gi|254780624|ref|YP_003065037.1| ubiquinone/menaquinone biosynthesis methyltransferase [Candidatus Liberibacter asiaticus str. psy62] Length = 265 Score = 23.5 bits (49), Expect = 0.72, Method: Compositional matrix adjust. Identities = 8/14 (57%), Positives = 12/14 (85%) Query: 72 LRTPIFKKIYDYYS 85 ++ P+FKKIYD +S Sbjct: 181 VQGPVFKKIYDMWS 194 >gi|254780271|ref|YP_003064684.1| ATP-dependent protease ATP-binding subunit ClpX [Candidatus Liberibacter asiaticus str. psy62] Length = 424 Score = 23.5 bits (49), Expect = 0.91, Method: Composition-based stats. Identities = 14/32 (43%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Query: 42 VELTMLESIIEEDDSNLFKWFTGMEKPPEYLR 73 VEL M + I EE+ S++ K G+ P E LR Sbjct: 43 VELCM-DIIREENKSSITKSHEGIPNPQEILR 73 >gi|255764467|ref|YP_003064798.2| Type I secretion system ATPase, PrtD [Candidatus Liberibacter asiaticus str. psy62] Length = 565 Score = 21.9 bits (45), Expect = 2.3, Method: Compositional matrix adjust. Identities = 6/31 (19%), Positives = 18/31 (58%) Query: 52 EEDDSNLFKWFTGMEKPPEYLRTPIFKKIYD 82 E D ++LF + +++ +++ +P+ + D Sbjct: 103 EMDGTSLFSIISSLDQLKQFITSPVLPALLD 133 >gi|254780364|ref|YP_003064777.1| ferredoxin-NADP+ reductase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 224 Score = 20.0 bits (40), Expect = 9.0, Method: Compositional matrix adjust. Identities = 14/50 (28%), Positives = 22/50 (44%) Query: 33 DHFILELSSVELTMLESIIEEDDSNLFKWFTGMEKPPEYLRTPIFKKIYD 82 D +L S +L+S+I + LF TG+ +R P K +D Sbjct: 95 DTILLHKKSTGDLILDSLIPGNRLYLFSMGTGIAPFASMIRDPETYKKFD 144 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.323 0.139 0.425 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 65,481 Number of Sequences: 1233 Number of extensions: 2361 Number of successful extensions: 7 Number of sequences better than 100.0: 7 Number of HSP's better than 100.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of query: 98 length of database: 328,796 effective HSP length: 61 effective length of query: 37 effective length of database: 253,583 effective search space: 9382571 effective search space used: 9382571 T: 11 A: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.5 bits) S2: 31 (16.5 bits)