Query         gi|254780948|ref|YP_003065361.1| DNA repair protein RecO [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 240
No_of_seqs    191 out of 1615
Neff          8.4 
Searched_HMMs 13730
Date          Wed Jun  1 10:56:10 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780948.hhm -d /home/congqian_1/database/scop/scop70_1_75.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 d1u5ka2 g.45.1.2 (A:81-237) Re  99.6 1.5E-15 1.1E-19  111.8  11.4  134   83-217     4-146 (157)
  2 d1u5ka1 b.40.4.13 (A:2-80) Rec  99.6   2E-16 1.5E-20  117.0   3.9   75    1-76      3-78  (79)
  3 d1dcqa2 g.45.1.1 (A:247-368) P  62.9       1 7.4E-05   21.1   0.8   63  145-211    12-76  (122)
  4 d3gata_ g.39.1.1 (A:) Erythroi  38.2     3.3 0.00024   18.0   0.1   43  149-191     5-47  (66)
  5 d2vuti1 g.39.1.1 (I:671-712) E  37.9     2.2 0.00016   19.1  -0.9   38  149-186     1-38  (42)
  6 d1y0ja1 g.39.1.1 (A:200-238) E  32.9     3.5 0.00025   17.9  -0.5   32  149-180     3-34  (39)
  7 d1pfta_ g.41.3.1 (A:) Transcri  30.6     8.7 0.00063   15.4   1.2   34  149-184     6-39  (50)
  8 d1dl6a_ g.41.3.1 (A:) Transcri  29.1     8.4 0.00061   15.5   1.0   37  146-184     9-45  (58)
  9 d2fiya1 e.59.1.1 (A:19-308) Fd  22.2      15  0.0011   14.0   1.2   32  149-180   165-201 (290)
 10 d2dloa1 g.39.1.3 (A:8-42) Thyr  12.5      27   0.002   12.4   0.6   14  144-157     4-17  (35)

No 1  
>d1u5ka2 g.45.1.2 (A:81-237) Recombinational repair protein RecO, C-terminal domain {Deinococcus radiodurans [TaxId: 1299]}
Probab=99.63  E-value=1.5e-15  Score=111.78  Aligned_cols=134  Identities=12%  Similarity=0.096  Sum_probs=96.8

Q ss_pred             CCCHHHHHHHHHHHHH-HHHCCCCCCHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHCCCCCHHHHCCCCCCCCCE
Q ss_conf             4405899999999999-962135667678999999999612234301379999999999837676612210235556622
Q gi|254780948|r   83 SSSLFLYGLQSIVPLF-RFLPEREPCLELYDMLNIFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLL  161 (240)
Q Consensus        83 ~~~~~l~~~~~~~~l~-~~l~e~e~~~~lf~~l~~~L~~l~~~~~~~~~~~~fEl~LL~~lGf~p~L~~C~~cg~~~~l~  161 (240)
                      .|..++++++++++++ ++++|++|++.+|+++..+|..++...+.....+.||+++|+.+||+|+++.|+.||..++ .
T Consensus         4 ~D~~r~~~A~~l~El~~~~~~e~~~~~~lf~ll~~~L~~L~~~~~~~~~~~~f~l~ll~~~G~~P~l~~C~~cg~~~~-~   82 (157)
T d1u5ka2           4 AEPERYAFAHLMAEFADALFQEGEFSEQAFDLFAASLRGVAHQPDPEWVALVMSYKLLGLAGVIPQTARCARCGAPDP-E   82 (157)
T ss_dssp             GSHHHHHHHHHHHHHHHHHSCTTCCCHHHHHHHHHHHHHHHHSSCHHHHHHHHHHHHHTTSSSCCCCSBCTTTCCBSC-C
T ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHCCCCCCHHHHHCCCCCCC-C
T ss_conf             029999999999999999823689719999999999999880576159999999999998388877466703899787-7


Q ss_pred             EEEECCCCHHHHCCCCCCCCH--HHHHHHHHHC------CCCCCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             443012100111024753200--0012345522------5678998999999989999998565
Q gi|254780948|r  162 WVSPKSGGAVCRSVGLPYAEK--MLVLPSFLWK------EEQTIDADSLKSAFQLTDYFLNKYA  217 (240)
Q Consensus       162 ~~s~~~g~av~~~~~~~~~~k--ll~lp~fL~~------~~~~~~~~~i~~~l~lt~~fL~k~~  217 (240)
                      ++++..||++|..|+......  ....-..+..      .....+..+..+..++...|+.-|+
T Consensus        83 ~f~~~~Gg~~C~~c~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~r~~l~~~L~~y~~~Hl  146 (157)
T d1u5ka2          83 HPDPLGGQLLCSKCAALPPYPPAVLDFLRHAVRRTVRASFEQPVPSADRPALWRALEKFVTVQV  146 (157)
T ss_dssp             EECTTTSSEECTTTCSSCCCCHHHHHHHHHTTTSCHHHHHHSCCCGGGHHHHHHHHHHHHHHHS
T ss_pred             CCCCCCCEEECCCCCCCCCCCCHHHHHHHHHCCCCHHHHHHCCCCHHHHHHHHHHHHHHHHHHH
T ss_conf             5101679257887787677760388999987115766665102899999999999999999998


No 2  
>d1u5ka1 b.40.4.13 (A:2-80) Recombinational repair protein RecO, N-terminal domain {Deinococcus radiodurans [TaxId: 1299]}
Probab=99.60  E-value=2e-16  Score=117.02  Aligned_cols=75  Identities=17%  Similarity=0.174  Sum_probs=66.8

Q ss_pred             CCEEEEEEEEEECCCCCHHHHHHHCCCCCCEEEEEEECCCCCCCCCCCCCCCEEEEEEECCCCCCCCCCH-HHHHCC
Q ss_conf             9500016998303588024475422721286999996676755320003443147998215777654310-122101
Q gi|254780948|r    1 MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQNLGEFR-FEVLES   76 (240)
Q Consensus         1 M~~~d~giVL~~~~~~E~~~Iv~~~T~~~G~~~~i~rG~~~~k~~~~lq~~~~~~~~~~~k~~~~l~~~~-~e~~~~   76 (240)
                      +.++++||||+++||||+|+||++||++ |+++++||||+++|+++.++|++++.++|..+..+.++.++ +|++..
T Consensus         3 r~~~~~giVL~~~~~~Esd~iv~~~T~~-Gki~~iakG~rr~~~~~~~~~~~~~~~~~~~~~g~~L~~L~qael~~a   78 (79)
T d1u5ka1           3 RTANRSGIVIRRRVTPAGDIIVTLLTPQ-GKLKAIARGGVKGPLSSSLNLFHHVGVQVYQGPHNDLASVKQAVLEGA   78 (79)
T ss_dssp             SEEEEEEEEEEEEECTTSCEEEEEEETT-EEEEEEETTCTTSTTTTTSCTTCEEEEEEECCCC-CCEEEEEEEEEEC
T ss_pred             CEECCEEEEEEEEECCCCCEEEEEEECC-CCEEEEEECCCCCCCCCCEEEEEEEEEEEEECCCCCCCEEEEEEEEEC
T ss_conf             5603028999835638754999998078-858999975656899864900057889999849997760987799403


No 3  
>d1dcqa2 g.45.1.1 (A:247-368) Pyk2-associated protein beta ARF-GAP domain {Mouse (Mus musculus) [TaxId: 10090]}
Probab=62.93  E-value=1  Score=21.12  Aligned_cols=63  Identities=17%  Similarity=0.139  Sum_probs=39.8

Q ss_pred             CCCHHHHCCCCCCCCCEEEEECCCCHHHHCCCCCCCCHHHHHH-HHHHCCC-CCCCHHHHHHHHHHHHH
Q ss_conf             7661221023555662244301210011102475320000123-4552256-78998999999989999
Q gi|254780948|r  145 GLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKMLVLP-SFLWKEE-QTIDADSLKSAFQLTDY  211 (240)
Q Consensus       145 ~p~L~~C~~cg~~~~l~~~s~~~g~av~~~~~~~~~~kll~lp-~fL~~~~-~~~~~~~i~~~l~lt~~  211 (240)
                      .|.=..|+.||.. +..|+|...|..||..|+.-+..  +... .+...-. ...+.+++. .++-.|.
T Consensus        12 ~p~N~~CaDC~~~-~p~w~s~n~GvfvC~~CsgiHR~--lg~~is~VkS~~ld~w~~~~i~-~~~~~GN   76 (122)
T d1dcqa2          12 MTGNDVCCDCGAP-DPTWLSTNLGILTCIECSGIHRE--LGVHYSRMQSLTLDVLGTSELL-LAKNIGN   76 (122)
T ss_dssp             STTTTBCTTTCCB-SCCEEETTTTEEECHHHHHHHHH--HCTTTCCEEETTTSCCCGGGGH-HHHHSCH
T ss_pred             CCCCCCCCCCCCC-CCCEEEECCCEEECHHHHHHHHC--CCCCCEEEEECCCCCCCHHHHH-HHHHHHH
T ss_conf             8997945899878-99969942798870545578756--7988427642555879999999-9999968


No 4  
>d3gata_ g.39.1.1 (A:) Erythroid transcription factor GATA-1 {Chicken (Gallus gallus) [TaxId: 9031]}
Probab=38.25  E-value=3.3  Score=17.96  Aligned_cols=43  Identities=26%  Similarity=0.459  Sum_probs=34.8

Q ss_pred             HHHCCCCCCCCCEEEEECCCCHHHHCCCCCCCCHHHHHHHHHH
Q ss_conf             2210235556622443012100111024753200001234552
Q gi|254780948|r  149 TKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKMLVLPSFLW  191 (240)
Q Consensus       149 ~~C~~cg~~~~l~~~s~~~g~av~~~~~~~~~~kll~lp~fL~  191 (240)
                      ..|+.||.++-..|=.-..|..+|..+|.-|......-|.-+.
T Consensus         5 ~~C~nCgt~~Tp~WRr~~~G~~lCNACGl~~~~~~~~RP~~~~   47 (66)
T d3gata_           5 TVCSNCQTSTTTLWRRSPMGDPVCNACGLYYKLHQVNRPLTMR   47 (66)
T ss_dssp             CCCTTTCCCCCSSEEECTTSCEEEHHHHHHHHHHCSCCCGGGC
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCC
T ss_conf             9988989988855331899980320467899971876785555


No 5  
>d2vuti1 g.39.1.1 (I:671-712) Erythroid transcription factor GATA-1 {Emericella nidulans [TaxId: 162425]}
Probab=37.88  E-value=2.2  Score=19.09  Aligned_cols=38  Identities=24%  Similarity=0.378  Sum_probs=29.2

Q ss_pred             HHHCCCCCCCCCEEEEECCCCHHHHCCCCCCCCHHHHH
Q ss_conf             22102355566224430121001110247532000012
Q gi|254780948|r  149 TKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKMLVL  186 (240)
Q Consensus       149 ~~C~~cg~~~~l~~~s~~~g~av~~~~~~~~~~kll~l  186 (240)
                      +.|+.||.++-..|=.-..|..+|..+|.-|...--+-
T Consensus         1 t~C~nC~tt~Tp~WRr~~~G~~lCNACGl~~k~~g~~R   38 (42)
T d2vuti1           1 TTCTNCFTQTTPLWRRNPEGQPLCNACGLFLKLHGVVR   38 (42)
T ss_dssp             CCCSSSCCCCCSCCEECTTSCEECHHHHHHHHHHSSCC
T ss_pred             CCCCCCCCCCCCCCEECCCCCCCHHHHHHHHHHCCCCC
T ss_conf             94878899779644008999882245658999719988


No 6  
>d1y0ja1 g.39.1.1 (A:200-238) Erythroid transcription factor GATA-1 {Mouse (Mus musculus) [TaxId: 10090]}
Probab=32.93  E-value=3.5  Score=17.88  Aligned_cols=32  Identities=31%  Similarity=0.646  Sum_probs=26.3

Q ss_pred             HHHCCCCCCCCCEEEEECCCCHHHHCCCCCCC
Q ss_conf             22102355566224430121001110247532
Q gi|254780948|r  149 TKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA  180 (240)
Q Consensus       149 ~~C~~cg~~~~l~~~s~~~g~av~~~~~~~~~  180 (240)
                      ..|+.||.++-..|=...+|..+|..+|.-|.
T Consensus         3 r~C~~Cgtt~Tp~WR~gp~G~~LCNACGl~~r   34 (39)
T d1y0ja1           3 RECVNCGATATPLWRRDRTGHYLCNACGLYHK   34 (39)
T ss_dssp             CCCSSSCCCCCSCCEECTTSCEECSSHHHHHH
T ss_pred             CCCCCCCCCCCCCCCCCCCCCEEEHHHHHHHH
T ss_conf             99879989789654329999983177678898


No 7  
>d1pfta_ g.41.3.1 (A:) Transcription initiation factor TFIIB, N-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]}
Probab=30.57  E-value=8.7  Score=15.44  Aligned_cols=34  Identities=24%  Similarity=0.507  Sum_probs=26.1

Q ss_pred             HHHCCCCCCCCCEEEEECCCCHHHHCCCCCCCCHHH
Q ss_conf             221023555662244301210011102475320000
Q gi|254780948|r  149 TKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKML  184 (240)
Q Consensus       149 ~~C~~cg~~~~l~~~s~~~g~av~~~~~~~~~~kll  184 (240)
                      ..|-.||+.+  .-+...+|-.||..+|.-.+++++
T Consensus         6 ~~Cp~Cgs~~--iv~D~~~Ge~vC~~CG~Viee~~i   39 (50)
T d1pfta_           6 KVCPACESAE--LIYDPERGEIVCAKCGYVIEENII   39 (50)
T ss_dssp             CSCTTTSCCC--EEEETTTTEEEESSSCCBCCCCCC
T ss_pred             CCCCCCCCCC--EEEECCCCEEECCCCCCEECCCCC
T ss_conf             3484887983--788878790850049869252434


No 8  
>d1dl6a_ g.41.3.1 (A:) Transcription initiation factor TFIIB, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
Probab=29.09  E-value=8.4  Score=15.52  Aligned_cols=37  Identities=19%  Similarity=0.372  Sum_probs=27.4

Q ss_pred             CCHHHHCCCCCCCCCEEEEECCCCHHHHCCCCCCCCHHH
Q ss_conf             661221023555662244301210011102475320000
Q gi|254780948|r  146 LDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKML  184 (240)
Q Consensus       146 p~L~~C~~cg~~~~l~~~s~~~g~av~~~~~~~~~~kll  184 (240)
                      ++-.+|-.||+.+  .-+..++|-.||..+|.-..++.+
T Consensus         9 ~~~~~Cp~Cgs~~--ii~D~~~Ge~vC~~CG~Vlee~~I   45 (58)
T d1dl6a_           9 LPRVTCPNHPDAI--LVEDYRAGDMICPECGLVVGDRVI   45 (58)
T ss_dssp             CSCCSBTTBSSSC--CEECSSSCCEECTTTCCEECCSCC
T ss_pred             CCCCCCCCCCCCC--EEEECCCCCEECCCCCCEECCCCC
T ss_conf             5666897997987--778878882850359989054133


No 9  
>d2fiya1 e.59.1.1 (A:19-308) FdhE homolog PA4809 {Pseudomonas aeruginosa [TaxId: 287]}
Probab=22.17  E-value=15  Score=13.97  Aligned_cols=32  Identities=16%  Similarity=0.235  Sum_probs=15.6

Q ss_pred             HHHCCCCCCCCCEEEEE---CCC--CHHHHCCCCCCC
Q ss_conf             22102355566224430---121--001110247532
Q gi|254780948|r  149 TKCVVTGVTQDLLWVSP---KSG--GAVCRSVGLPYA  180 (240)
Q Consensus       149 ~~C~~cg~~~~l~~~s~---~~g--~av~~~~~~~~~  180 (240)
                      ..|=+||+.--...+..   ..|  -..|.-|+..|.
T Consensus       165 ~~CPvCGs~P~~s~l~~~~~~~G~R~l~C~~C~teW~  201 (290)
T d2fiya1         165 TLCPACGSPPMAGMIRQGGKETGLRYLSCSLCACEWH  201 (290)
T ss_dssp             SSCTTTCCCEEEEEEEC----CCEEEEEETTTCCEEE
T ss_pred             CCCCCCCCCCHHHEEECCCCCCCCEEEECCCCCCCCC
T ss_conf             9699999802114032367778856887899988542


No 10 
>d2dloa1 g.39.1.3 (A:8-42) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]}
Probab=12.54  E-value=27  Score=12.42  Aligned_cols=14  Identities=21%  Similarity=0.425  Sum_probs=11.1

Q ss_pred             CCCCHHHHCCCCCC
Q ss_conf             67661221023555
Q gi|254780948|r  144 FGLDLTKCVVTGVT  157 (240)
Q Consensus       144 f~p~L~~C~~cg~~  157 (240)
                      |.-.|++|.+||..
T Consensus         4 y~~tlEkC~~C~~~   17 (35)
T d2dloa1           4 YVATLEKCATCSQP   17 (35)
T ss_dssp             CCSSCCBCTTTCCB
T ss_pred             HHHHHHHHHHHCHH
T ss_conf             89899999983659


Done!