BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780948|ref|YP_003065361.1| DNA repair protein RecO
[Candidatus Liberibacter asiaticus str. psy62]
         (240 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780948|ref|YP_003065361.1| DNA repair protein RecO [Candidatus Liberibacter asiaticus str.
           psy62]
 gi|254040625|gb|ACT57421.1| DNA repair protein RecO [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 240

 Score =  493 bits (1270), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 240/240 (100%), Positives = 240/240 (100%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS
Sbjct: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC
Sbjct: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
           HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA
Sbjct: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180

Query: 181 EKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLELI 240
           EKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLELI
Sbjct: 181 EKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLELI 240


>gi|315122361|ref|YP_004062850.1| DNA repair protein RecO [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313495763|gb|ADR52362.1| DNA repair protein RecO [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 240

 Score =  395 bits (1015), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 182/240 (75%), Positives = 217/240 (90%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M+WQDDAI+LGVRSYGEKNIILEVMTR YGRHLGFVR GQS R+QP+LQ GNLVRVNWRS
Sbjct: 1   MHWQDDAIVLGVRSYGEKNIILEVMTRHYGRHLGFVRYGQSRRIQPVLQVGNLVRVNWRS 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL Q+LGEFR E++E  C+KLLSS++ LYGLQS++P+FRFLPER+PC +LYD+LN+F+N 
Sbjct: 61  RLEQDLGEFRLEIIEYRCSKLLSSAISLYGLQSMIPIFRFLPERDPCPDLYDLLNLFINS 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
           HKI S++GKIF+QIEL+LLKNIGFGL++TKCVVTGV+ DL WVSPKSGGA+C S+GLPYA
Sbjct: 121 HKISSILGKIFIQIELILLKNIGFGLEITKCVVTGVSHDLSWVSPKSGGAICHSLGLPYA 180

Query: 181 EKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLELI 240
            KMLVLP FLWKE+Q IDADSL++AF+LT YFL+KYA QHNIIHC+ LR NFL KL+EL+
Sbjct: 181 SKMLVLPLFLWKEQQNIDADSLRNAFRLTGYFLDKYAFQHNIIHCNSLRINFLNKLIELL 240


>gi|227821417|ref|YP_002825387.1| DNA repair protein RecO [Sinorhizobium fredii NGR234]
 gi|227340416|gb|ACP24634.1| DNA repair protein RecO [Sinorhizobium fredii NGR234]
          Length = 276

 Score =  245 bits (625), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 112/240 (46%), Positives = 162/240 (67%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W D AIILG+R +GE ++I EVMT  +GRHLG VR+G+S  MQP+LQ GN V V WR+
Sbjct: 29  MQWSDQAIILGIRRHGESSVIAEVMTSAHGRHLGLVRSGRSRTMQPVLQPGNSVEVTWRA 88

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LGEFR E LE   A+L+ ++  +YG+Q++  L R LPER+P   LY+ L + ++ 
Sbjct: 89  RLDEHLGEFRLEPLELRAARLMEAATSVYGIQALGALLRLLPERDPHPHLYEALAVIVDH 148

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
            + P+  G++FV+ EL +L ++GFGLDL++C  TG   +L++VSPK+G AV R+ G PYA
Sbjct: 149 LQDPADAGELFVRFELAVLNDLGFGLDLSECAATGHRAELIYVSPKTGRAVSRAAGAPYA 208

Query: 181 EKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLELI 240
           E+ML LP FL       D DSL +AF+LT YFLN++  +   +     R+ F+   L+ +
Sbjct: 209 ERMLALPDFLSGTRSAADHDSLAAAFRLTAYFLNRHVYEPRGVDVSSARDGFVHATLKAL 268


>gi|307320728|ref|ZP_07600140.1| DNA repair protein RecO [Sinorhizobium meliloti AK83]
 gi|306893655|gb|EFN24429.1| DNA repair protein RecO [Sinorhizobium meliloti AK83]
          Length = 259

 Score =  244 bits (624), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 110/240 (45%), Positives = 165/240 (68%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W D+AIILG+R +GE ++I EVMT  +GRHLG VR+G+S  MQP+LQ GN V V+WR+
Sbjct: 13  MQWSDEAIILGIRRHGESSVIAEVMTPGHGRHLGLVRSGRSRTMQPVLQPGNSVEVSWRA 72

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LGEFR E L+   A+L+ ++  +YG+Q++  L R LPER+P   LY+ L + ++ 
Sbjct: 73  RLDEHLGEFRVEPLQLRAARLIETATSVYGIQALGALLRLLPERDPHPHLYEALAVIVDH 132

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
            + P+  G++FV+ EL +L ++GFGLDL++C  TG   +L++VSPKSG A+CR  G PYA
Sbjct: 133 LQDPADAGELFVRFELAVLNDLGFGLDLSRCGATGARSELVYVSPKSGRAICREAGAPYA 192

Query: 181 EKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLELI 240
           ++ML LP FL    +  D +SL +AF+LT YFLN++  +   +     R+ F+   L+ +
Sbjct: 193 DRMLALPDFLSGGSRAADHESLAAAFRLTAYFLNRHVYEPRGVDAASARDGFVHATLKAL 252


>gi|20139557|sp|Q92KH5|RECO_RHIME RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
          Length = 247

 Score =  244 bits (623), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 110/240 (45%), Positives = 164/240 (68%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W D+AIILG+R +GE ++I EVMT  +GRHLG VR+G+S  MQP+LQ GN V V+WR+
Sbjct: 1   MQWSDEAIILGIRRHGESSVIAEVMTPGHGRHLGLVRSGRSRTMQPVLQPGNSVEVSWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LGEFR E L+   A L+ ++  +YG+Q++  L R LPER+P   LY+ L + ++ 
Sbjct: 61  RLDEHLGEFRVEPLQLRAASLIETATSVYGIQALGALLRLLPERDPHPHLYEALAVIVDH 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
            + P+  G++FV+ EL +L ++GFGLDL++C  TG   +L++VSPKSG A+CR  G PYA
Sbjct: 121 LQDPADAGELFVRFELAVLNDLGFGLDLSRCGATGARSELVYVSPKSGRAICREAGAPYA 180

Query: 181 EKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLELI 240
           ++ML LP FL    +  D +SL +AF+LT YFLN++  +   +     R+ F+   L+ +
Sbjct: 181 DRMLALPDFLSGGSRAADHESLAAAFRLTAYFLNRHVYEPRGVDAASARDGFVHATLKAL 240


>gi|150395917|ref|YP_001326384.1| DNA repair protein RecO [Sinorhizobium medicae WSM419]
 gi|166221910|sp|A6U7B9|RECO_SINMW RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|150027432|gb|ABR59549.1| DNA repair protein RecO [Sinorhizobium medicae WSM419]
          Length = 249

 Score =  244 bits (623), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 111/240 (46%), Positives = 164/240 (68%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W D AIILG+R +GE ++I EVMT  +GRHLG VR+G+S  MQP+LQ GN V V WR+
Sbjct: 1   MQWSDQAIILGIRRHGESSVIAEVMTPGHGRHLGLVRSGRSRAMQPVLQPGNSVEVVWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LGEFR E L+   A+L+ ++  +YG+Q++  L R LPER+P   LY+ L + ++ 
Sbjct: 61  RLDEHLGEFRVEPLQLRAARLIETATSVYGIQALGSLLRLLPERDPHPHLYEALAVIVDH 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
            + P+  G++FV+ EL +L ++GFGLDL++C  TG   +L++VSPKSG A+CR  G PYA
Sbjct: 121 LQDPADAGELFVRFELAVLNDLGFGLDLSRCGATGARSELVYVSPKSGRAICREAGAPYA 180

Query: 181 EKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLELI 240
           E+ML LP FL  + +  D +SL +AF+LT YFLN++  +   +     R+ F+   L+ +
Sbjct: 181 ERMLALPDFLSGQNRAADHESLAAAFRLTAYFLNRHVYEPRGVDAASARDGFVHATLKAL 240


>gi|195970186|ref|NP_385194.3| DNA repair protein RecO [Sinorhizobium meliloti 1021]
 gi|307300911|ref|ZP_07580680.1| DNA repair protein RecO [Sinorhizobium meliloti BL225C]
 gi|15074020|emb|CAC45667.1| Recombinational DNA repair protein (RecF pathway) [Sinorhizobium
           meliloti 1021]
 gi|306903866|gb|EFN34452.1| DNA repair protein RecO [Sinorhizobium meliloti BL225C]
          Length = 259

 Score =  243 bits (621), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 110/240 (45%), Positives = 164/240 (68%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W D+AIILG+R +GE ++I EVMT  +GRHLG VR+G+S  MQP+LQ GN V V+WR+
Sbjct: 13  MQWSDEAIILGIRRHGESSVIAEVMTPGHGRHLGLVRSGRSRTMQPVLQPGNSVEVSWRA 72

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LGEFR E L+   A L+ ++  +YG+Q++  L R LPER+P   LY+ L + ++ 
Sbjct: 73  RLDEHLGEFRVEPLQLRAASLIETATSVYGIQALGALLRLLPERDPHPHLYEALAVIVDH 132

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
            + P+  G++FV+ EL +L ++GFGLDL++C  TG   +L++VSPKSG A+CR  G PYA
Sbjct: 133 LQDPADAGELFVRFELAVLNDLGFGLDLSRCGATGARSELVYVSPKSGRAICREAGAPYA 192

Query: 181 EKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLELI 240
           ++ML LP FL    +  D +SL +AF+LT YFLN++  +   +     R+ F+   L+ +
Sbjct: 193 DRMLALPDFLSGGSRAADHESLAAAFRLTAYFLNRHVYEPRGVDAASARDGFVHATLKAL 252


>gi|325292418|ref|YP_004278282.1| DNA repair protein RecO [Agrobacterium sp. H13-3]
 gi|325060271|gb|ADY63962.1| DNA repair protein RecO [Agrobacterium sp. H13-3]
          Length = 254

 Score =  242 bits (618), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 115/241 (47%), Positives = 167/241 (69%), Gaps = 1/241 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M WQD+AIILGV+ +GE ++I EVMTR  GRHLG VR G+S  MQP+LQAGN V V WR+
Sbjct: 1   MQWQDEAIILGVKRHGETSVIAEVMTRLRGRHLGMVRGGRSRSMQPVLQAGNRVDVIWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL  +LGEFR E L+   A+L+ ++  +YG+Q++  L R LPER+P   LY  L++ L+ 
Sbjct: 61  RLDDHLGEFRIEPLQLRAAQLMETATAVYGVQAMGALLRLLPERDPHPHLYQALDVILDN 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P   G++FV+ EL +L ++GFGLDLT+C  TG+  DL++VSPK+G AVC + G PYA
Sbjct: 121 LHDPVDAGELFVRFELAVLNDLGFGLDLTECAATGLRTDLIYVSPKTGRAVCSTAGAPYA 180

Query: 181 EKMLVLPSFLWK-EEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLEL 239
           E+ML LP+FL + + +  D DSL +AF+LT +FL+++      ++ +  R+ F+   L+ 
Sbjct: 181 ERMLSLPAFLGEGQSKAADRDSLAAAFRLTGHFLHRHVYDPRGLNENAARDGFVQAALKA 240

Query: 240 I 240
           +
Sbjct: 241 L 241


>gi|209548606|ref|YP_002280523.1| DNA repair protein RecO [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|238058646|sp|B5ZW78|RECO_RHILW RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|209534362|gb|ACI54297.1| DNA repair protein RecO [Rhizobium leguminosarum bv. trifolii
           WSM2304]
          Length = 256

 Score =  241 bits (615), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 116/241 (48%), Positives = 162/241 (67%), Gaps = 1/241 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M WQD AIILGV+ +GE ++I EVMTR  GRHLG VR+G+S  MQP+LQAGN V V WR+
Sbjct: 1   MQWQDHAIILGVKRHGETSVIAEVMTRDRGRHLGLVRSGRSRAMQPVLQAGNAVEVIWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LGEFR E +    A+L+ ++  +YG+Q++  L R LPER+P   L+D L + L+ 
Sbjct: 61  RLDEHLGEFRVEPVTLRAARLMETATAVYGVQAMGALLRLLPERDPHPHLFDALEVILDH 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P+  G++FV+ EL +L ++GFGLDL +C  TG   DL +VSPKSG AV RS G P+A
Sbjct: 121 LHNPADAGELFVRFELAVLNDLGFGLDLAECAATGARSDLAYVSPKSGRAVSRSAGAPWA 180

Query: 181 EKMLVLPSFLWKE-EQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLEL 239
           +KML+LP FL  E     D DSL +AF+LT +FL+++  +   I     R+ F+   L+ 
Sbjct: 181 DKMLLLPPFLGIEGNHAADFDSLSAAFRLTGFFLHRHVYEPRGIEAAAARDGFVQAALKA 240

Query: 240 I 240
           +
Sbjct: 241 L 241


>gi|15888381|ref|NP_354062.1| DNA repair protein RecO [Agrobacterium tumefaciens str. C58]
 gi|42559508|sp|Q8UGJ8|RECO_AGRT5 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|15156061|gb|AAK86847.1| DNA repair protein RecO [Agrobacterium tumefaciens str. C58]
          Length = 254

 Score =  240 bits (613), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 112/241 (46%), Positives = 167/241 (69%), Gaps = 1/241 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M WQD+AIILGV+ +GE ++I EVMT   GRHLG VR+G+S  MQP+LQAGN V V WR+
Sbjct: 1   MQWQDEAIILGVKRHGETSVIAEVMTPSRGRHLGMVRSGRSRTMQPVLQAGNRVDVIWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL  +LGEFR E L+    +L+ ++  +YG+Q++  L R LPER+P   LY  L++ L+ 
Sbjct: 61  RLHDHLGEFRIEPLQLRAGQLMETATAVYGVQAMGALLRLLPERDPHPHLYQALDVILDN 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P   G++FV+ EL +L ++GFGLDL++C  TG+  DL++VSPK+G AVCR+ G PYA
Sbjct: 121 LHDPVDAGELFVRFELAVLNDLGFGLDLSECAATGLRSDLIYVSPKTGRAVCRTAGAPYA 180

Query: 181 EKMLVLPSFLWK-EEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLEL 239
            +ML LP+FL + + +  D +SL +AF+LTD+FL+++      ++ +  R+ F+   L+ 
Sbjct: 181 ARMLALPAFLGEGQSKAADPESLAAAFRLTDHFLHRHVYDPRGLNENAARDGFVQAALKA 240

Query: 240 I 240
           +
Sbjct: 241 L 241


>gi|116251281|ref|YP_767119.1| DNA repair protein RecO [Rhizobium leguminosarum bv. viciae 3841]
 gi|119361476|sp|Q1MJ50|RECO_RHIL3 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|115255929|emb|CAK07010.1| putative DNA repair protein (recombination protein O) [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 256

 Score =  239 bits (610), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 115/241 (47%), Positives = 163/241 (67%), Gaps = 1/241 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M WQD AIILGV+ +GE ++I EVMTR  GRHLG VR+G+S  MQP+LQAGN V V WR+
Sbjct: 1   MQWQDHAIILGVKRHGETSVIAEVMTRDRGRHLGLVRSGRSRAMQPVLQAGNAVEVIWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LGEFR E +    A+L+ ++  +YG+Q++  L R LPER+P   L+D L + L+ 
Sbjct: 61  RLDEHLGEFRVEPVTLRAARLMETATAVYGVQAMGALLRLLPERDPHPHLFDALEVILDH 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P+  G++FV+ EL +L ++GFGLDL +C  TG   DL++VSPKSG AV R+ G P+A
Sbjct: 121 LHNPADAGELFVRFELAVLNDLGFGLDLAECAATGARSDLVYVSPKSGRAVSRAAGAPWA 180

Query: 181 EKMLVLPSFLWKE-EQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLEL 239
           +KML+LP FL  E     D DSL +AF+LT +FL+++  +   I     R+ F+   L+ 
Sbjct: 181 DKMLLLPPFLSIEGNHAADFDSLSAAFRLTGFFLHRHVYEPRGIEAVAARDGFVQAALKA 240

Query: 240 I 240
           +
Sbjct: 241 L 241


>gi|222085393|ref|YP_002543923.1| DNA repair protein RecO [Agrobacterium radiobacter K84]
 gi|254790503|sp|B9JC76|RECO_AGRRK RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|221722841|gb|ACM25997.1| DNA repair protein RecO [Agrobacterium radiobacter K84]
          Length = 259

 Score =  239 bits (609), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 113/241 (46%), Positives = 161/241 (66%), Gaps = 1/241 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M WQD AIILGV+  GE ++I EVMTR  GRH+G VR+G+S  MQP+LQ GNLV V WR+
Sbjct: 1   MQWQDHAIILGVKRLGETSVIAEVMTRDRGRHMGLVRSGRSRSMQPVLQPGNLVEVTWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LGEFR E +    A+L+ ++  +YG+Q++  L R LPER+P   LYD L++ L  
Sbjct: 61  RLHEHLGEFRMEPVRLRAARLMETATAVYGVQAMGALLRLLPERDPHPYLYDALDVILEN 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
            + P   G++FV+ EL +L  +G+GLDL +C  TGV  DL +VSPK+G AVCR+ G P+A
Sbjct: 121 MQNPMDAGELFVRFELAVLNELGYGLDLGECAATGVRDDLAFVSPKTGRAVCRTAGAPWA 180

Query: 181 EKMLVLPSFLWKEE-QTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLEL 239
           +KML LP FL     +  + +SL +AF+LT +FL+++  +   I     RE F+   L+ 
Sbjct: 181 DKMLALPPFLAAGTVEAANGESLAAAFRLTGFFLHRHVYEPRGIEIAAAREGFIQAALKA 240

Query: 240 I 240
           +
Sbjct: 241 V 241


>gi|241203893|ref|YP_002974989.1| DNA repair protein RecO [Rhizobium leguminosarum bv. trifolii
           WSM1325]
 gi|240857783|gb|ACS55450.1| DNA repair protein RecO [Rhizobium leguminosarum bv. trifolii
           WSM1325]
          Length = 256

 Score =  238 bits (607), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 114/241 (47%), Positives = 164/241 (68%), Gaps = 1/241 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M WQD AIILGV+ +GE ++I+EVMTR  GRHLG VR+G+S  MQP+LQAGN V V WR+
Sbjct: 1   MQWQDHAIILGVKRHGETSVIVEVMTRDRGRHLGLVRSGRSRAMQPVLQAGNAVEVIWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LGEFR E +    A+L+ ++  +YG+Q++  L R LPER+P   L+D L + L+ 
Sbjct: 61  RLDEHLGEFRVEPVTLRAARLMETATAVYGVQAMGALLRLLPERDPHPHLFDALEVILDH 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P+  G++FV+ EL +L ++GFGLDL +C  TG   DL++VSPKSG AV R+ G P+A
Sbjct: 121 LHNPADAGELFVRFELAVLNDLGFGLDLAECAATGARSDLVYVSPKSGRAVSRAAGAPWA 180

Query: 181 EKMLVLPSFLWKE-EQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLEL 239
           +KML+LP FL  E     D +SL +AF+LT +FL+++  +   I     R+ F+   L+ 
Sbjct: 181 DKMLLLPPFLRIEGNHAADFESLSAAFRLTGFFLHRHVYEPRGIEAVAARDGFVQAALKA 240

Query: 240 I 240
           +
Sbjct: 241 L 241


>gi|86357032|ref|YP_468924.1| DNA repair protein RecO [Rhizobium etli CFN 42]
 gi|119361475|sp|Q2KAD9|RECO_RHIEC RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|86281134|gb|ABC90197.1| DNA repair protein [Rhizobium etli CFN 42]
          Length = 256

 Score =  238 bits (607), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 114/241 (47%), Positives = 161/241 (66%), Gaps = 1/241 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M WQD AIILGV+ +GE ++I EVMTR  GRHLG VR+G+S  M+P+LQ GN V V WR+
Sbjct: 1   MQWQDQAIILGVKRHGETSVIAEVMTRGRGRHLGLVRSGRSRAMRPVLQPGNAVEVVWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LGEFR E +    A+L+ ++  +YG+Q++  L R LPER+P   L+D L + L+ 
Sbjct: 61  RLDEHLGEFRVEPVTLRAARLMDTATAVYGVQAMGALLRLLPERDPHPHLFDALEVILDH 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P+  G++FV+ EL +L ++GFGLDL +C  TG   DL +VSPKSG AV RS G P+A
Sbjct: 121 LHNPADAGELFVRFELAVLNDLGFGLDLAECAATGARSDLAYVSPKSGRAVSRSAGAPWA 180

Query: 181 EKMLVLPSFLWKE-EQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLEL 239
           +KML+LP FL  E     D DSL +AF+LT +FL+++  +   I     R+ F+   L+ 
Sbjct: 181 DKMLLLPPFLGVEGNHAADVDSLAAAFRLTGFFLHRHVYEPRGIEAVAARDGFVQAALKA 240

Query: 240 I 240
           +
Sbjct: 241 L 241


>gi|218461899|ref|ZP_03501990.1| DNA repair protein RecO [Rhizobium etli Kim 5]
          Length = 256

 Score =  238 bits (606), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 113/241 (46%), Positives = 162/241 (67%), Gaps = 1/241 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M WQD AIILGV+ +GE ++I+EVMTR  GRHLG VR+G+S  MQP+LQ GN V V WR+
Sbjct: 1   MQWQDHAIILGVKRHGETSVIVEVMTRDRGRHLGLVRSGRSRAMQPVLQPGNAVEVIWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LGEFR E +    A+L+ ++  +YG+Q++  L R LPER+P   L+D L + L+ 
Sbjct: 61  RLDEHLGEFRVEPVTLRAARLMETATAVYGVQAMGALLRLLPERDPHPHLFDALEVILDH 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P+  G++FV+ EL +L ++GFGLDL +C  TG   DL +VSPKSG AV RS G P+A
Sbjct: 121 LHNPADAGELFVRFELAVLNDLGFGLDLAECAATGARSDLAYVSPKSGRAVSRSAGAPWA 180

Query: 181 EKMLVLPSFLWKE-EQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLEL 239
           +KML+LP FL  +     D DSL +AF+LT +FL+++  +   +     R+ F+   L+ 
Sbjct: 181 DKMLLLPPFLGVDGNHAADFDSLAAAFRLTGFFLHRHVYEPRGMEASAARDGFVQAALKA 240

Query: 240 I 240
           +
Sbjct: 241 L 241


>gi|190891077|ref|YP_001977619.1| DNA repair protein (recombination protein O) [Rhizobium etli CIAT
           652]
 gi|238692513|sp|B3PUP2|RECO_RHIE6 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|190696356|gb|ACE90441.1| DNA repair protein (recombination protein O) [Rhizobium etli CIAT
           652]
          Length = 256

 Score =  237 bits (604), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 113/241 (46%), Positives = 161/241 (66%), Gaps = 1/241 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M WQD AIILG++ +GE ++I EVMTR  GRHLG VR+G+S  MQP+LQ GN V V WR+
Sbjct: 1   MQWQDHAIILGIKRHGETSVIAEVMTRDRGRHLGLVRSGRSRAMQPVLQPGNAVEVIWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LGEFR E +    A+L+ ++  +YG+Q++  L R LPER+P   L+D L + L+ 
Sbjct: 61  RLDEHLGEFRVEPVTLRAARLMETATAVYGVQAMGALLRLLPERDPHPHLFDALEVILDH 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P+  G++FV+ EL +L ++GFGLDL +C  TG   DL +VSPKSG AV RS G P+A
Sbjct: 121 LHNPADAGELFVRFELAVLNDLGFGLDLGECAATGARSDLAYVSPKSGRAVSRSAGAPWA 180

Query: 181 EKMLVLPSFLWKE-EQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLEL 239
           +KML+LP FL  E     D DSL +AF+LT +FL+++  +   +     R+ F+   L+ 
Sbjct: 181 DKMLLLPPFLGVEGNHAADFDSLAAAFRLTGFFLHRHVYEPRGMEAAAARDGFVQAALKA 240

Query: 240 I 240
           +
Sbjct: 241 L 241


>gi|218509904|ref|ZP_03507782.1| DNA repair protein RecO [Rhizobium etli Brasil 5]
          Length = 245

 Score =  236 bits (603), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 113/241 (46%), Positives = 161/241 (66%), Gaps = 1/241 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M WQD AIILG++ +GE ++I EVMTR  GRHLG VR+G+S  MQP+LQ GN V V WR+
Sbjct: 1   MQWQDHAIILGIKRHGETSVIAEVMTRDRGRHLGLVRSGRSRAMQPVLQPGNAVEVIWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LGEFR E +    A+L+ ++  +YG+Q++  L R LPER+P   L+D L + L+ 
Sbjct: 61  RLDEHLGEFRVEPVTLRAARLMETATAVYGVQAMGALLRLLPERDPHPHLFDALEVILDH 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P+  G++FV+ EL +L ++GFGLDL +C  TG   DL +VSPKSG AV RS G P+A
Sbjct: 121 LHNPADAGELFVRFELAVLNDLGFGLDLGECAATGARSDLAYVSPKSGRAVSRSAGAPWA 180

Query: 181 EKMLVLPSFLWKE-EQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLEL 239
           +KML+LP FL  E     D DSL +AF+LT +FL+++  +   +     R+ F+   L+ 
Sbjct: 181 DKMLLLPPFLGVEGNHAADFDSLAAAFRLTGFFLHRHVYEPRGMEAAAARDGFVQAALKA 240

Query: 240 I 240
           +
Sbjct: 241 L 241


>gi|327191326|gb|EGE58359.1| DNA repair protein (recombination protein O) [Rhizobium etli
           CNPAF512]
          Length = 281

 Score =  236 bits (601), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 113/241 (46%), Positives = 161/241 (66%), Gaps = 1/241 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M WQD AIILG++ +GE ++I EVMTR  GRHLG VR+G+S  MQP+LQ GN V V WR+
Sbjct: 26  MQWQDHAIILGIKRHGETSVIAEVMTRDRGRHLGLVRSGRSRAMQPVLQPGNAVEVIWRA 85

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LGEFR E +    A+L+ ++  +YG+Q++  L R LPER+P   L+D L + L+ 
Sbjct: 86  RLDEHLGEFRVEPVTLRAARLMETATAVYGVQAMGALLRLLPERDPHPHLFDALEVILDH 145

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P+  G++FV+ EL +L ++GFGLDL +C  TG   DL +VSPKSG AV RS G P+A
Sbjct: 146 LHNPADAGELFVRFELAVLNDLGFGLDLGECAATGARSDLAYVSPKSGRAVSRSAGAPWA 205

Query: 181 EKMLVLPSFLWKE-EQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLEL 239
           +KML+LP FL  E     D DSL +AF+LT +FL+++  +   +     R+ F+   L+ 
Sbjct: 206 DKMLLLPPFLGVEGNHAADFDSLAAAFRLTGFFLHRHVYEPRGMEAAAARDGFVQAALKA 265

Query: 240 I 240
           +
Sbjct: 266 L 266


>gi|163760593|ref|ZP_02167674.1| DNA repair protein [Hoeflea phototrophica DFL-43]
 gi|162282208|gb|EDQ32498.1| DNA repair protein [Hoeflea phototrophica DFL-43]
          Length = 256

 Score =  226 bits (576), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 101/241 (41%), Positives = 160/241 (66%), Gaps = 1/241 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D+ IILG+R +GE ++I EVMT  +GRH+G VR G+S R+QP+LQ GN V + WR+
Sbjct: 1   MEWRDEGIILGLRKHGETSVIAEVMTHAHGRHMGIVRGGRSKRLQPVLQPGNSVDLVWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG+++ E++ +   +L+ S++ ++G+Q++  L R LPER+    L+D   + L+ 
Sbjct: 61  RLDEHLGQYQVELINARAGRLMQSAIGVHGVQAMAALLRLLPERDSHPRLHDAFAVILDS 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P   G ++V+ EL +L+++GFGLDLT C  TG ++DL++VSPKSG AV  + G P+A
Sbjct: 121 FDAPEEAGALYVRFELAVLEDLGFGLDLTACAATGASEDLVYVSPKSGRAVSAAAGAPWA 180

Query: 181 EKMLVLPSFLWKEEQTI-DADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLEL 239
           E+ML LP+FL    Q   DA  L   F+L+ YFL+++  +   I   + RE+F    L+ 
Sbjct: 181 ERMLALPAFLADRSQACGDAQMLAHGFKLSGYFLDRHVFEPRGIEAPISRESFCTAALKA 240

Query: 240 I 240
           +
Sbjct: 241 M 241


>gi|222148084|ref|YP_002549041.1| DNA repair protein RecO [Agrobacterium vitis S4]
 gi|221735072|gb|ACM36035.1| DNA repair protein RecO [Agrobacterium vitis S4]
          Length = 264

 Score =  223 bits (569), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 110/237 (46%), Positives = 157/237 (66%), Gaps = 5/237 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W D AI+LG R +GE ++I E+MT   GRHLG VR G+S  MQP+LQ GN+V V WR+
Sbjct: 1   MEWTDQAIVLGARRHGETSVIAEMMTLARGRHLGLVRGGRSRTMQPVLQPGNVVEVTWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG+FR E L+     L+SS+  +YG+Q++  L R LPEREP   LY+ +NI L+ 
Sbjct: 61  RLEEHLGDFRVEPLQLRAGHLMSSATAVYGVQALASLLRLLPEREPHGHLYEAMNIILDH 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P+  G++F++ EL +L ++GFGLDLT C  TG  QDL++VSPK+G AV  + GLPYA
Sbjct: 121 LHEPASAGELFIRFELAILNDLGFGLDLTACAATGGRQDLVFVSPKTGRAVSHAAGLPYA 180

Query: 181 EKMLVLPSFLWKE-----EQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENF 232
           +++L LP FL  E     ++  DA +L+ AF+LT YFL ++  +   +     R+ F
Sbjct: 181 DRLLTLPVFLQPEPLVGKDKQADAQALQQAFRLTGYFLQRHVYEPRGLTAGAARDGF 237


>gi|239831498|ref|ZP_04679827.1| DNA repair protein RecO [Ochrobactrum intermedium LMG 3301]
 gi|239823765|gb|EEQ95333.1| DNA repair protein RecO [Ochrobactrum intermedium LMG 3301]
          Length = 245

 Score =  216 bits (551), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 105/237 (44%), Positives = 151/237 (63%), Gaps = 1/237 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D+ IILG R +GE + I+EVMTR++GRH+G VR G+S RMQP+LQ GN V V W +
Sbjct: 3   MEWRDEGIILGTRRHGETSAIVEVMTREHGRHMGMVRGGRSRRMQPLLQPGNHVDVTWWA 62

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL +++G F  E LE   A+L+ + + LYG+Q      R LPER+P   LY+ L + +  
Sbjct: 63  RLDEHMGSFTIEPLEFAAARLIETPVALYGIQLAASHLRLLPERDPHRGLYETLRLIIEH 122

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P   G++ ++ E+M+L+ +GFGLDL +C  TGV +DL++VSPKSG AVCR VG P+A
Sbjct: 123 FDDPLASGELVLRFEVMMLEELGFGLDLKECAATGVKEDLIYVSPKSGRAVCREVGAPWA 182

Query: 181 EKMLVLPSFLWKEE-QTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKL 236
           +K+L+LP F+     +    D +  AF +T YFL ++  +   I     R  FL  L
Sbjct: 183 DKLLLLPGFVNNTAVRAASYDDIDHAFTMTGYFLMRHVWEPRAITPPDARGGFLNAL 239


>gi|153009952|ref|YP_001371167.1| DNA repair protein RecO [Ochrobactrum anthropi ATCC 49188]
 gi|151561840|gb|ABS15338.1| DNA repair protein RecO [Ochrobactrum anthropi ATCC 49188]
          Length = 243

 Score =  216 bits (549), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 104/237 (43%), Positives = 150/237 (63%), Gaps = 1/237 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D+ IILG R +GE + I+EVMTR++GRH+G VR G+S RMQP+LQ GN V V W +
Sbjct: 1   MEWRDEGIILGTRRHGETSAIVEVMTREHGRHMGMVRGGRSRRMQPLLQPGNHVDVTWWA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL +++G F  E LE   A+L+ + + LYG+Q      R LPER+P   LY+ L + +  
Sbjct: 61  RLDEHMGSFTIEPLEFAAARLIETPVALYGIQLAASHLRLLPERDPHRGLYETLRLIIEH 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P   G++ ++ E+M+L+ +GFGLDL KC  TGV +DL++VSPKSG AVCR  G P+A
Sbjct: 121 FDDPLASGELVLRFEVMMLEELGFGLDLKKCAATGVKEDLIYVSPKSGRAVCRDAGAPWA 180

Query: 181 EKMLVLPSFLWKEE-QTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKL 236
           +K+L+LP F+     +    D +  AF +T YFL ++  +   +     R  FL  L
Sbjct: 181 DKLLLLPGFVNNTAVRASSYDDIDHAFTMTGYFLMRHVWEPRAVTPPDARGGFLNAL 237


>gi|13476445|ref|NP_108015.1| DNA repair protein RecO [Mesorhizobium loti MAFF303099]
 gi|20139624|sp|Q985A3|RECO_RHILO RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|14027206|dbj|BAB54160.1| DNA repair protein; RecO [Mesorhizobium loti MAFF303099]
          Length = 253

 Score =  215 bits (548), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 102/237 (43%), Positives = 150/237 (63%), Gaps = 1/237 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D+ IILG R +GE + ILEVMTR +GRHLG VR G+S + QP+LQ GN V + WR+
Sbjct: 1   MEWRDEGIILGTRKHGETSAILEVMTRAHGRHLGLVRGGRSRKQQPVLQPGNRVDLLWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG F+ E +E + A+L+ S++ +YGLQ++    R LPER+    LY+ L++ +  
Sbjct: 61  RLDEHLGTFQAEAIEMNAARLMDSAVAVYGLQTMAAHLRLLPERDAHGGLYEALSVMIVH 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
                  G++  + EL++L  +GFGLDL++C  TG  QDL +VSPKSG AV R  G P+ 
Sbjct: 121 LDDADAAGELVARFELLILDELGFGLDLSQCAATGTRQDLAYVSPKSGRAVSREAGAPWR 180

Query: 181 EKMLVLPSFLWKEEQ-TIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKL 236
           +KML LP+FL +      D  +++ AF+LT +F  ++  +   I     R  FL  L
Sbjct: 181 DKMLALPAFLQRGSGLRADPAAVEDAFRLTGFFFTRHVYEPRAIEQPDARAGFLAAL 237


>gi|90420864|ref|ZP_01228769.1| DNA repair protein recO [Aurantimonas manganoxydans SI85-9A1]
 gi|90334839|gb|EAS48611.1| DNA repair protein recO [Aurantimonas manganoxydans SI85-9A1]
          Length = 243

 Score =  215 bits (548), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 101/236 (42%), Positives = 148/236 (62%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+++AI+LGVR  GE +++ EVMTR  GRHLG VR G+S + QP+LQ GN V V+WR+
Sbjct: 1   MEWREEAIVLGVRRLGETSVVAEVMTRARGRHLGLVRGGRSRKQQPVLQPGNSVAVHWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL +++G F  E LE   A+L+ S + L G+Q +    R L ER+P   LYD L I ++ 
Sbjct: 61  RLDEHMGAFVLEPLELRAARLMESGVGLNGVQLVAAHLRLLAERDPHARLYDGLQIIVDH 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P ++ ++ ++ E+ LL+ +GFGLDL +C  TG   DL +VSP++G AV R  G P+ 
Sbjct: 121 LDRPELVAELMLRFEIALLEELGFGLDLERCAATGQRDDLAYVSPRTGRAVSRDAGAPWH 180

Query: 181 EKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKL 236
           +K+L LP+FL       DA+SL + ++LT YFL ++  +   I     R  FL  L
Sbjct: 181 DKLLTLPAFLADAATASDAESLAAGYRLTGYFLGRHVYEPRGIDVPDARAGFLSAL 236


>gi|260462318|ref|ZP_05810526.1| DNA repair protein RecO [Mesorhizobium opportunistum WSM2075]
 gi|259031812|gb|EEW33080.1| DNA repair protein RecO [Mesorhizobium opportunistum WSM2075]
          Length = 258

 Score =  215 bits (548), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 103/237 (43%), Positives = 151/237 (63%), Gaps = 1/237 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D+ IILG R +GE + ILEVMTR +GRHLG VR G+S + QP+LQ GN V + WR+
Sbjct: 1   MEWRDEGIILGTRKHGETSAILEVMTRTHGRHLGLVRGGRSRKQQPVLQPGNRVDLLWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG F+ E +E + A+L+ S++ +YGLQ++    R LPER+    LY+ L++ +  
Sbjct: 61  RLDEHLGTFQAEPIEMNAARLMDSAIAVYGLQTMAAHLRLLPERDAHGGLYEALSVMIVH 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
                  G++  + EL++L  +GFGLDL++C  TG  QDL +VSPKSG AV R  GLP+ 
Sbjct: 121 LDDADAAGELVARFELLILDELGFGLDLSRCAATGTQQDLAYVSPKSGRAVSREAGLPWR 180

Query: 181 EKMLVLPSFLWKEEQ-TIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKL 236
           +KML LP+FL +      D  +++ AF+LT +F  ++  +   I     R  FL  L
Sbjct: 181 DKMLALPAFLQRGSGLRADPGAVEDAFRLTGFFFTRHVYEPRAIEQPDARLGFLAAL 237


>gi|170748446|ref|YP_001754706.1| DNA repair protein RecO [Methylobacterium radiotolerans JCM 2831]
 gi|170654968|gb|ACB24023.1| DNA repair protein RecO [Methylobacterium radiotolerans JCM 2831]
          Length = 239

 Score =  214 bits (546), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 101/216 (46%), Positives = 137/216 (63%), Gaps = 1/216 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W DDA++LG+R +GE  +ILE MT  +GRHLG V  G+S RMQP+LQAGN VR+ WR+
Sbjct: 1   MQWTDDALVLGLRRHGETGVILEAMTEAHGRHLGLVHGGRSRRMQPVLQAGNRVRLTWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL + LG +  E L+S  ++L+ SSL LYG+  +  L R LPER+P   LY+   I +  
Sbjct: 61  RLDEGLGSYAVEPLDSQVSRLIGSSLALYGMNHMAALLRLLPERDPHPALYEAAGILVEH 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P+V   + V+ EL +L  +GFGLDLT C  TG    L +VSPKSG AV  S G PY 
Sbjct: 121 LDDPAVAPPLMVRFELAILSELGFGLDLTACAATGGNDALAYVSPKSGRAVSASAGEPYR 180

Query: 181 EKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKY 216
           +++L LP+FL     +   D +   F LT YFL+++
Sbjct: 181 DRLLALPTFL-HAGGSPGPDGVAQGFTLTGYFLDRH 215


>gi|328543511|ref|YP_004303620.1| DNA repair protein recO [polymorphum gilvum SL003B-26A1]
 gi|326413255|gb|ADZ70318.1| DNA repair protein recO [Polymorphum gilvum SL003B-26A1]
          Length = 253

 Score =  211 bits (538), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 108/240 (45%), Positives = 145/240 (60%), Gaps = 4/240 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W +D IILG RS+GE  ++LE+MTR+ GRHLG VR G+S R QP+LQ GNLVR  WR+
Sbjct: 1   MEWSEDGIILGTRSHGESGVVLELMTRRRGRHLGLVRGGRSRRQQPVLQPGNLVRATWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           R+A  LG F  E L+     L+ S+L L+ LQ +  L R LPER+    LYD L I L+ 
Sbjct: 61  RIADQLGAFTVEPLQLRAGALMDSALALHALQHLAGLLRLLPERDAHERLYDALTIVLDH 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
                + G + V+ EL LL  +GFGLDLT+C  TG   DL +VSPKSG AV R  G PY 
Sbjct: 121 LGEAMIAGPLIVRFELELLNELGFGLDLTRCAATGQLWDLAYVSPKSGRAVSRDAGAPYR 180

Query: 181 EKMLVLPSFLWKEEQTIDAD----SLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKL 236
           +++L LPSFL + E+   ++     +    +LT +FL ++ L+       L RE  +  L
Sbjct: 181 DQLLPLPSFLVEGERQPGSEITFADISQGLRLTAFFLARHVLEPQGHAPSLSREELVKAL 240


>gi|319784500|ref|YP_004143976.1| DNA repair protein RecO [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
 gi|317170388|gb|ADV13926.1| DNA repair protein RecO [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
          Length = 258

 Score =  207 bits (528), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 104/237 (43%), Positives = 151/237 (63%), Gaps = 1/237 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D+ IILG R +GE + ILEV+TR +GRHLG VR G+S + QP+LQ GN V + WR+
Sbjct: 1   MEWRDEGIILGTRKHGETSAILEVLTRAHGRHLGLVRGGRSRKQQPVLQPGNRVDLLWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG F+ E +E + A+L+ S++ +YGLQ++    R LPER+    LY+ L + +  
Sbjct: 61  RLDEHLGTFQAEAIEMNAARLMDSAVAVYGLQTMAAHLRLLPERDAHEGLYETLAVMIVH 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
                V G++  + EL++L  +GFGLDL++C  TG  QDL +VSPKSG AV R  GLP+ 
Sbjct: 121 LDDADVAGELVARFELLVLDELGFGLDLSQCAATGTRQDLAYVSPKSGRAVSREAGLPWR 180

Query: 181 EKMLVLPSFLWKEEQ-TIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKL 236
           ++ML LP+FL +      DA  +  AF+LT +F N++  +   I     R  FL  L
Sbjct: 181 DRMLALPAFLQRGSGLRADAADVDDAFRLTGFFFNRHVYEPRGIEPPDARTGFLAAL 237


>gi|110633306|ref|YP_673514.1| DNA repair protein RecO [Mesorhizobium sp. BNC1]
 gi|119361464|sp|Q11JS6|RECO_MESSB RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|110284290|gb|ABG62349.1| DNA replication and repair protein RecO [Chelativorans sp. BNC1]
          Length = 248

 Score =  206 bits (525), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 100/238 (42%), Positives = 147/238 (61%), Gaps = 1/238 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W D+ I+LG R +GE ++ILE +T  +GRHLG VR G+S RMQP+LQ GN V + WR+
Sbjct: 1   MEWHDEGIVLGTRRHGESSVILEAITAAHGRHLGLVRGGRSKRMQPVLQPGNRVDLTWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG F+ E LE + A+LL+S++ +YG+Q +    R LPER+P   L++ L +    
Sbjct: 61  RLDEHLGLFQVEPLELNAARLLNSAVAIYGIQLLAAHLRLLPERDPHPGLFEALGVIAAH 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P   G +  + EL +L  +GFGLDL +C VTG  +DL +VSPK+G AV R  G P+A
Sbjct: 121 LDEPETAGVLVARFELAVLDALGFGLDLARCAVTGSREDLAYVSPKTGRAVTREAGAPWA 180

Query: 181 EKMLVLPSFLWKEEQTI-DADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLL 237
           +K+L LP+FL    + + D   L  AF LT +F  ++  +   +     R  FL  ++
Sbjct: 181 DKLLPLPTFLTAGNEALYDRAILSQAFALTGFFFARHVYEPRGLTEPEARAGFLAAVM 238


>gi|114705890|ref|ZP_01438793.1| DNA repair protein RecO [Fulvimarina pelagi HTCC2506]
 gi|114538736|gb|EAU41857.1| DNA repair protein RecO [Fulvimarina pelagi HTCC2506]
          Length = 241

 Score =  204 bits (518), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 93/219 (42%), Positives = 144/219 (65%), Gaps = 5/219 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+++ ++LGVR +GE ++I E+MTR  GRHLG VR G+S  M+P+LQ GN V  +WR+
Sbjct: 1   MEWREEGVVLGVRRHGETSVIAELMTRSRGRHLGLVRGGRSKAMRPVLQPGNSVMAHWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF--- 117
           RL +++G F  E + S    L+ S++ L+G+Q      R L ER+P   LYD L +    
Sbjct: 61  RLDEHMGAFALEPVASRAGGLMESTVGLHGVQLAASHLRLLAERDPHPRLYDGLIVLIEN 120

Query: 118 LNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGL 177
           LN  ++    G++ ++ EL +L+ +GFGLDL +C  +G  +DL++VSPKSG AV R  G 
Sbjct: 121 LNADRL--TAGELMLRFELAVLEELGFGLDLARCAASGTKEDLVYVSPKSGRAVSREPGE 178

Query: 178 PYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKY 216
           PY +K+L LP+FL   ++  D ++L++ F LT YFL+++
Sbjct: 179 PYHDKLLALPAFLTDTDRAADGETLRTGFTLTRYFLSRH 217


>gi|163842935|ref|YP_001627339.1| DNA repair protein RecO [Brucella suis ATCC 23445]
 gi|163673658|gb|ABY37769.1| DNA repair protein RecO [Brucella suis ATCC 23445]
          Length = 247

 Score =  204 bits (518), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 102/236 (43%), Positives = 146/236 (61%), Gaps = 5/236 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D+ +ILG R +GE + I+EVMT  +GRH+G VR G+S RMQP+LQ GN V V+W +
Sbjct: 1   MEWRDEGVILGTRRHGETSAIVEVMTCGHGRHMGMVRGGRSRRMQPLLQPGNHVDVSWWA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL +++G F  E L    A+L+ + + LYG+Q      R LPER+P   LY+ L + +  
Sbjct: 61  RLDEHMGTFTIEPLSFAAARLIETPVALYGIQLAAAHLRLLPERDPHRGLYETLRLIIEH 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P   G++ ++ E+M+L+ +GFGLDL +C  TG   DL++VSPKSG AVCR  G P+A
Sbjct: 121 FDDPLAAGELLLRFEVMMLEELGFGLDLKECAATGRKDDLIYVSPKSGRAVCREAGAPWA 180

Query: 181 EKMLVLPSFLWKEEQTIDA---DSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFL 233
           EK+L LPSF+   +  + A   D L  AF +T YFL ++  +         R  FL
Sbjct: 181 EKLLSLPSFV--NDTALRASCYDDLDRAFTMTGYFLMRHVWEPRAQTPPDSRSGFL 234


>gi|121601946|ref|YP_988791.1| DNA repair protein RecO [Bartonella bacilliformis KC583]
 gi|166221884|sp|A1US38|RECO_BARBK RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|120614123|gb|ABM44724.1| DNA repair protein RecO [Bartonella bacilliformis KC583]
          Length = 245

 Score =  204 bits (518), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 100/217 (46%), Positives = 146/217 (67%), Gaps = 1/217 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W++ AIILG R YGE ++ILEV+TRQ+GR++G V+ G+S RM  +LQ GN V   W +
Sbjct: 1   MKWKEQAIILGARQYGETSVILEVVTRQHGRYMGVVKGGRSRRMAALLQPGNFVEAEWWA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG F+ E L+   ++L+     LYGLQ +   FR LPER+P   LYD+L++F+  
Sbjct: 61  RLDEHLGLFKLEALDLCASRLMFLPEALYGLQLMASHFRLLPERDPHPILYDILHLFMQN 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
                V  ++ V+ E+ LL+ +GFGLDL+ C VTG  + L +VSPKSG AVC  VGLP+ 
Sbjct: 121 FDEQFVNAELLVRFEMRLLEELGFGLDLSHCAVTGRQEKLYYVSPKSGRAVCEEVGLPWK 180

Query: 181 EKMLVLPSFL-WKEEQTIDADSLKSAFQLTDYFLNKY 216
            K+L+LP FL  +  + +D D +++ F LTD+FL ++
Sbjct: 181 NKLLLLPKFLIERTNRPVDFDDIRNGFTLTDFFLTRH 217


>gi|23501551|ref|NP_697678.1| DNA repair protein RecO [Brucella suis 1330]
 gi|62289624|ref|YP_221417.1| DNA repair protein RecO [Brucella abortus bv. 1 str. 9-941]
 gi|82699552|ref|YP_414126.1| DNA repair protein RecO [Brucella melitensis biovar Abortus 2308]
 gi|148559418|ref|YP_001258648.1| DNA repair protein RecO [Brucella ovis ATCC 25840]
 gi|161618634|ref|YP_001592521.1| DNA repair protein RecO [Brucella canis ATCC 23365]
 gi|189023877|ref|YP_001934645.1| DNA repair protein RecO [Brucella abortus S19]
 gi|225852185|ref|YP_002732418.1| DNA repair protein RecO [Brucella melitensis ATCC 23457]
 gi|237815119|ref|ZP_04594117.1| DNA repair protein RecO [Brucella abortus str. 2308 A]
 gi|254688939|ref|ZP_05152193.1| DNA repair protein RecO [Brucella abortus bv. 6 str. 870]
 gi|254693421|ref|ZP_05155249.1| DNA repair protein RecO [Brucella abortus bv. 3 str. Tulya]
 gi|254697074|ref|ZP_05158902.1| DNA repair protein RecO [Brucella abortus bv. 2 str. 86/8/59]
 gi|254701451|ref|ZP_05163279.1| DNA repair protein RecO [Brucella suis bv. 5 str. 513]
 gi|254703997|ref|ZP_05165825.1| DNA repair protein RecO [Brucella suis bv. 3 str. 686]
 gi|254707629|ref|ZP_05169457.1| DNA repair protein RecO [Brucella pinnipedialis M163/99/10]
 gi|254709789|ref|ZP_05171600.1| DNA repair protein RecO [Brucella pinnipedialis B2/94]
 gi|254713791|ref|ZP_05175602.1| DNA repair protein RecO [Brucella ceti M644/93/1]
 gi|254717152|ref|ZP_05178963.1| DNA repair protein RecO [Brucella ceti M13/05/1]
 gi|254729970|ref|ZP_05188548.1| DNA repair protein RecO [Brucella abortus bv. 4 str. 292]
 gi|256031279|ref|ZP_05444893.1| DNA repair protein RecO [Brucella pinnipedialis M292/94/1]
 gi|256060791|ref|ZP_05450953.1| DNA repair protein RecO [Brucella neotomae 5K33]
 gi|256113203|ref|ZP_05454071.1| DNA repair protein RecO [Brucella melitensis bv. 3 str. Ether]
 gi|256257187|ref|ZP_05462723.1| DNA repair protein RecO [Brucella abortus bv. 9 str. C68]
 gi|256264305|ref|ZP_05466837.1| recombination protein O [Brucella melitensis bv. 2 str. 63/9]
 gi|256369101|ref|YP_003106609.1| DNA repair protein RecO [Brucella microti CCM 4915]
 gi|260545621|ref|ZP_05821362.1| recombination protein O [Brucella abortus NCTC 8038]
 gi|260566756|ref|ZP_05837226.1| recombination protein O [Brucella suis bv. 4 str. 40]
 gi|260754426|ref|ZP_05866774.1| DNA repair protein recO [Brucella abortus bv. 6 str. 870]
 gi|260757645|ref|ZP_05869993.1| DNA repair protein recO [Brucella abortus bv. 4 str. 292]
 gi|260761472|ref|ZP_05873815.1| DNA repair protein recO [Brucella abortus bv. 2 str. 86/8/59]
 gi|260883454|ref|ZP_05895068.1| DNA repair protein recO [Brucella abortus bv. 9 str. C68]
 gi|261213672|ref|ZP_05927953.1| DNA repair protein recO [Brucella abortus bv. 3 str. Tulya]
 gi|261218967|ref|ZP_05933248.1| DNA repair protein recO [Brucella ceti M13/05/1]
 gi|261315121|ref|ZP_05954318.1| DNA repair protein recO [Brucella pinnipedialis M163/99/10]
 gi|261317324|ref|ZP_05956521.1| DNA repair protein recO [Brucella pinnipedialis B2/94]
 gi|261321534|ref|ZP_05960731.1| DNA repair protein recO [Brucella ceti M644/93/1]
 gi|261324782|ref|ZP_05963979.1| DNA repair protein recO [Brucella neotomae 5K33]
 gi|261751991|ref|ZP_05995700.1| DNA repair protein recO [Brucella suis bv. 5 str. 513]
 gi|261754650|ref|ZP_05998359.1| DNA repair protein recO [Brucella suis bv. 3 str. 686]
 gi|265988362|ref|ZP_06100919.1| DNA repair protein recO [Brucella pinnipedialis M292/94/1]
 gi|265994611|ref|ZP_06107168.1| DNA repair protein recO [Brucella melitensis bv. 3 str. Ether]
 gi|297248035|ref|ZP_06931753.1| DNA repair protein RecO [Brucella abortus bv. 5 str. B3196]
 gi|38258601|sp|Q8G1P8|RECO_BRUSU RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|75497079|sp|Q57E78|RECO_BRUAB RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|119361447|sp|Q2YMZ9|RECO_BRUA2 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|23347462|gb|AAN29593.1| DNA repair protein RecO, putative [Brucella suis 1330]
 gi|62195756|gb|AAX74056.1| putatiave DNA repair protein RecO [Brucella abortus bv. 1 str.
           9-941]
 gi|82615653|emb|CAJ10640.1| Cytochrome P450:Recombination protein O, RecO [Brucella melitensis
           biovar Abortus 2308]
 gi|148370675|gb|ABQ60654.1| DNA repair protein RecO [Brucella ovis ATCC 25840]
 gi|161335445|gb|ABX61750.1| DNA repair protein RecO [Brucella canis ATCC 23365]
 gi|189019449|gb|ACD72171.1| Recombination protein O, RecO [Brucella abortus S19]
 gi|225640550|gb|ACO00464.1| DNA repair protein RecO [Brucella melitensis ATCC 23457]
 gi|237789956|gb|EEP64166.1| DNA repair protein RecO [Brucella abortus str. 2308 A]
 gi|255999261|gb|ACU47660.1| DNA repair protein RecO [Brucella microti CCM 4915]
 gi|260097028|gb|EEW80903.1| recombination protein O [Brucella abortus NCTC 8038]
 gi|260156274|gb|EEW91354.1| recombination protein O [Brucella suis bv. 4 str. 40]
 gi|260667963|gb|EEX54903.1| DNA repair protein recO [Brucella abortus bv. 4 str. 292]
 gi|260671904|gb|EEX58725.1| DNA repair protein recO [Brucella abortus bv. 2 str. 86/8/59]
 gi|260674534|gb|EEX61355.1| DNA repair protein recO [Brucella abortus bv. 6 str. 870]
 gi|260872982|gb|EEX80051.1| DNA repair protein recO [Brucella abortus bv. 9 str. C68]
 gi|260915279|gb|EEX82140.1| DNA repair protein recO [Brucella abortus bv. 3 str. Tulya]
 gi|260924056|gb|EEX90624.1| DNA repair protein recO [Brucella ceti M13/05/1]
 gi|261294224|gb|EEX97720.1| DNA repair protein recO [Brucella ceti M644/93/1]
 gi|261296547|gb|EEY00044.1| DNA repair protein recO [Brucella pinnipedialis B2/94]
 gi|261300762|gb|EEY04259.1| DNA repair protein recO [Brucella neotomae 5K33]
 gi|261304147|gb|EEY07644.1| DNA repair protein recO [Brucella pinnipedialis M163/99/10]
 gi|261741744|gb|EEY29670.1| DNA repair protein recO [Brucella suis bv. 5 str. 513]
 gi|261744403|gb|EEY32329.1| DNA repair protein recO [Brucella suis bv. 3 str. 686]
 gi|262765724|gb|EEZ11513.1| DNA repair protein recO [Brucella melitensis bv. 3 str. Ether]
 gi|263094578|gb|EEZ18376.1| recombination protein O [Brucella melitensis bv. 2 str. 63/9]
 gi|264660559|gb|EEZ30820.1| DNA repair protein recO [Brucella pinnipedialis M292/94/1]
 gi|297175204|gb|EFH34551.1| DNA repair protein RecO [Brucella abortus bv. 5 str. B3196]
 gi|326408685|gb|ADZ65750.1| Recombination protein O, RecO [Brucella melitensis M28]
 gi|326538410|gb|ADZ86625.1| DNA repair protein RecO [Brucella melitensis M5-90]
          Length = 247

 Score =  203 bits (517), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 99/219 (45%), Positives = 142/219 (64%), Gaps = 5/219 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D+ +ILG R +GE + I+EVMT  +GRH+G VR G+S RMQP+LQ GN V V+W +
Sbjct: 1   MEWRDEGVILGTRRHGETSAIVEVMTCGHGRHMGMVRGGRSRRMQPLLQPGNHVDVSWWA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL +++G F  E L    A+L+ + + LYG+Q      R LPER+P   LY+ L + +  
Sbjct: 61  RLDEHMGTFTIEPLSFAAARLIETPVALYGIQLAAAHLRLLPERDPHRGLYETLRLIIEH 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P   G++ ++ E+M+L+ +GFGLDL +C  TG   DL++VSPKSG AVCR  G P+A
Sbjct: 121 FDDPLAAGELLLRFEVMMLEELGFGLDLKECAATGRKDDLIYVSPKSGRAVCREAGAPWA 180

Query: 181 EKMLVLPSFLWKEEQTIDA---DSLKSAFQLTDYFLNKY 216
           EK+L LPSF+   +  + A   D L  AF +T YFL ++
Sbjct: 181 EKLLSLPSFV--NDTALRASCYDDLDRAFTMTGYFLMRH 217


>gi|294852027|ref|ZP_06792700.1| DNA repair protein RecO [Brucella sp. NVSL 07-0026]
 gi|294820616|gb|EFG37615.1| DNA repair protein RecO [Brucella sp. NVSL 07-0026]
          Length = 247

 Score =  203 bits (517), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 102/236 (43%), Positives = 146/236 (61%), Gaps = 5/236 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D+ +ILG R +GE + I+EVMT  +GRH+G VR G+S RMQP+LQ GN V V+W +
Sbjct: 1   MEWRDEGVILGTRRHGETSAIVEVMTCWHGRHMGMVRGGRSRRMQPLLQPGNHVDVSWWA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL +++G F  E L    A+L+ + + LYG+Q      R LPER+P   LY+ L + +  
Sbjct: 61  RLDEHMGTFTIEPLSFAAARLIETPVALYGIQLAAAHLRLLPERDPHRGLYETLRLIIEH 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P   G++ ++ E+M+L+ +GFGLDL +C  TG   DL++VSPKSG AVCR  G P+A
Sbjct: 121 FDDPLAAGELLLRFEVMMLEELGFGLDLKECAATGRKDDLIYVSPKSGRAVCREAGAPWA 180

Query: 181 EKMLVLPSFLWKEEQTIDA---DSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFL 233
           EK+L LPSF+   +  + A   D L  AF +T YFL ++  +         R  FL
Sbjct: 181 EKLLSLPSFV--NDTALRASCYDDLDRAFTMTGYFLMRHVWEPRAQTPPDSRSGFL 234


>gi|225627162|ref|ZP_03785200.1| DNA repair protein RecO [Brucella ceti str. Cudo]
 gi|256159389|ref|ZP_05457171.1| DNA repair protein RecO [Brucella ceti M490/95/1]
 gi|256254687|ref|ZP_05460223.1| DNA repair protein RecO [Brucella ceti B1/94]
 gi|260168417|ref|ZP_05755228.1| DNA repair protein RecO [Brucella sp. F5/99]
 gi|261221865|ref|ZP_05936146.1| DNA repair protein recO [Brucella ceti B1/94]
 gi|261757878|ref|ZP_06001587.1| recombination protein O [Brucella sp. F5/99]
 gi|265997829|ref|ZP_06110386.1| DNA repair protein recO [Brucella ceti M490/95/1]
 gi|225617997|gb|EEH15041.1| DNA repair protein RecO [Brucella ceti str. Cudo]
 gi|260920449|gb|EEX87102.1| DNA repair protein recO [Brucella ceti B1/94]
 gi|261737862|gb|EEY25858.1| recombination protein O [Brucella sp. F5/99]
 gi|262552297|gb|EEZ08287.1| DNA repair protein recO [Brucella ceti M490/95/1]
          Length = 247

 Score =  202 bits (515), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 99/219 (45%), Positives = 142/219 (64%), Gaps = 5/219 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D+ +ILG R +GE + I+EVMT  +GRH+G VR G+S RMQP+LQ GN V V+W +
Sbjct: 1   MEWRDEGVILGRRRHGETSAIVEVMTCGHGRHMGMVRGGRSRRMQPLLQPGNHVDVSWWA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL +++G F  E L    A+L+ + + LYG+Q      R LPER+P   LY+ L + +  
Sbjct: 61  RLDEHMGTFTIEPLSFAAARLIETPVALYGIQLAAAHLRLLPERDPHRGLYETLRLIIEH 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P   G++ ++ E+M+L+ +GFGLDL +C  TG   DL++VSPKSG AVCR  G P+A
Sbjct: 121 FDDPLAAGELLLRFEVMMLEELGFGLDLKECAATGRKDDLIYVSPKSGRAVCREAGAPWA 180

Query: 181 EKMLVLPSFLWKEEQTIDA---DSLKSAFQLTDYFLNKY 216
           EK+L LPSF+   +  + A   D L  AF +T YFL ++
Sbjct: 181 EKLLSLPSFV--NDTALRASCYDDLDRAFTMTGYFLMRH 217


>gi|254718804|ref|ZP_05180615.1| DNA repair protein RecO [Brucella sp. 83/13]
 gi|265983786|ref|ZP_06096521.1| DNA repair protein recO [Brucella sp. 83/13]
 gi|264662378|gb|EEZ32639.1| DNA repair protein recO [Brucella sp. 83/13]
          Length = 247

 Score =  202 bits (514), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 101/236 (42%), Positives = 146/236 (61%), Gaps = 5/236 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D+ +ILG R +GE + I+EVMT  +GRH+G VR G+S RMQP+LQ GN V V+W +
Sbjct: 1   MEWRDEGVILGTRRHGETSAIVEVMTCGHGRHMGMVRGGRSRRMQPLLQPGNHVDVSWWA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL +++G F  E L    A+L+ + + LYG+Q      R LPER+P   LY+ L + +  
Sbjct: 61  RLDEHMGTFTIEPLGFAAARLIETPVALYGIQLAAAHLRLLPERDPHRGLYETLRLIIEH 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P   G++ ++ E+M+L+ +GFGLDL +C  TG   DL++VSPKSG AVCR  G P+A
Sbjct: 121 FDDPLAAGELLLRFEVMMLEELGFGLDLKECAATGRKDDLIYVSPKSGRAVCREAGAPWA 180

Query: 181 EKMLVLPSFLWKEEQTIDA---DSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFL 233
           +K+L LPSF+   +  + A   D L  AF +T YFL ++  +         R  FL
Sbjct: 181 DKLLALPSFV--NDTALRASCYDDLDRAFTMTGYFLMRHVWEPRAQTPPDSRSGFL 234


>gi|115525024|ref|YP_781935.1| DNA repair protein RecO [Rhodopseudomonas palustris BisA53]
 gi|122295836|sp|Q07M79|RECO_RHOP5 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|115518971|gb|ABJ06955.1| DNA repair protein RecO [Rhodopseudomonas palustris BisA53]
          Length = 258

 Score =  202 bits (513), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 99/235 (42%), Positives = 141/235 (60%), Gaps = 2/235 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W DD I+LGVR +GE + I+E++TR +GRHLG VR G   +++P+LQ GN V   WR+
Sbjct: 1   MEWTDDGIVLGVRRHGESSAIVELLTRAHGRHLGLVRGGAGSKLRPVLQPGNSVHAGWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG +  E +    A LL+     YG+  +  L R LPER+P  E+Y+ +   L  
Sbjct: 61  RLDEHLGYYALEGMRLRAATLLAVPHAAYGITHLAALARLLPERDPHPEMYETVERILED 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
               ++ G   V+ EL +L  +GFGLDL+ C  TGVT DL++VSPKSGGAV R+ G P+ 
Sbjct: 121 FDDATMAGAHLVRFELAMLGELGFGLDLSACAATGVTSDLIYVSPKSGGAVSRTAGEPWR 180

Query: 181 EKMLVLPSFLWKEEQTID--ADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFL 233
           +K+L LP FL ++E      AD L+  F LT  FL +  L+         R+ F+
Sbjct: 181 DKLLRLPPFLREDEDAAGCTADDLRDGFALTGRFLLRNVLEPRGQGHSDARDGFI 235


>gi|254469353|ref|ZP_05082758.1| DNA repair protein RecO [Pseudovibrio sp. JE062]
 gi|211961188|gb|EEA96383.1| DNA repair protein RecO [Pseudovibrio sp. JE062]
          Length = 253

 Score =  202 bits (513), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 102/242 (42%), Positives = 146/242 (60%), Gaps = 6/242 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M WQ + I++G R  GE NI+LEV+T   GR LG VR G+S R QP LQ GN + + WR+
Sbjct: 1   MQWQAEGIVIGTRKQGENNILLEVLTPDRGRCLGLVRGGRSRRQQPALQLGNHLNLTWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG F  E L+   A L+ ++  ++GLQS+    R LPER+P   L+  L++ L+ 
Sbjct: 61  RLDEHLGFFTVEPLQLRAAHLMQTARAIHGLQSLCAQIRLLPERDPHPNLFHALDVILDH 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
            + P +   + ++ EL LL  +GFGLDLT+C  TG T +L+WVSPKSG AVC++ G PYA
Sbjct: 121 LEDPQIGAALVLRFELELLNELGFGLDLTECAATGATDELIWVSPKSGRAVCKTAGQPYA 180

Query: 181 EKMLVLPSFLWKEEQ------TIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLG 234
            K+L LP FL   +        I    +++ F LT YFL KY  +   I     R++++ 
Sbjct: 181 SKLLTLPEFLKAPQARLSQNIQISKGDMEAGFSLTGYFLFKYIYEPRSIPWPPARDSYVT 240

Query: 235 KL 236
            L
Sbjct: 241 AL 242


>gi|17987568|ref|NP_540202.1| DNA repair protein RecO [Brucella melitensis bv. 1 str. 16M]
 gi|256044360|ref|ZP_05447264.1| DNA repair protein RecO [Brucella melitensis bv. 1 str. Rev.1]
 gi|260563712|ref|ZP_05834198.1| DNA repair protein recO [Brucella melitensis bv. 1 str. 16M]
 gi|265990775|ref|ZP_06103332.1| DNA repair protein recO [Brucella melitensis bv. 1 str. Rev.1]
 gi|20139477|sp|Q8YG76|RECO_BRUME RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|17983272|gb|AAL52466.1| DNA repair protein reco [Brucella melitensis bv. 1 str. 16M]
 gi|260153728|gb|EEW88820.1| DNA repair protein recO [Brucella melitensis bv. 1 str. 16M]
 gi|263001559|gb|EEZ14134.1| DNA repair protein recO [Brucella melitensis bv. 1 str. Rev.1]
          Length = 247

 Score =  202 bits (513), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 101/236 (42%), Positives = 145/236 (61%), Gaps = 5/236 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D+ +ILG R +GE + I+EVMT  +GRH+G VR G+S RMQP+LQ GN V V+W +
Sbjct: 1   MEWRDEGVILGTRRHGETSAIVEVMTCGHGRHMGMVRGGRSRRMQPLLQPGNHVDVSWWA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL +++G F  E L    A+L+ + + LYG+Q      R LPER+P   LY+ L + +  
Sbjct: 61  RLDEHMGTFTIEPLSFAAARLIETPVALYGIQLAAAHLRLLPERDPHRGLYETLRLIIEH 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P   G++ ++ E+M+L+ +GFGLDL +C  TG   DL++VSP SG AVCR  G P+A
Sbjct: 121 FDDPLAAGELLLRFEVMMLEELGFGLDLKECAATGRKDDLIYVSPTSGRAVCREAGAPWA 180

Query: 181 EKMLVLPSFLWKEEQTIDA---DSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFL 233
           EK+L LPSF+   +  + A   D L  AF +T YFL ++  +         R  FL
Sbjct: 181 EKLLSLPSFV--NDTALRASCYDDLDRAFTMTGYFLMRHVWEPRAQTPPDSRSGFL 234


>gi|163867994|ref|YP_001609198.1| DNA repair protein RecO [Bartonella tribocorum CIP 105476]
 gi|189039650|sp|A9IRN6|RECO_BART1 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|161017645|emb|CAK01203.1| DNA repair protein RecO [Bartonella tribocorum CIP 105476]
          Length = 248

 Score =  200 bits (509), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 101/234 (43%), Positives = 146/234 (62%), Gaps = 1/234 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W++ A+ILGVR YGE ++ILE++TR+ GR++G V+ G+S RM  +LQ GN V   W +
Sbjct: 1   MKWKEQAVILGVRQYGETSVILEIITRERGRYMGVVKGGRSRRMAALLQPGNFVEAEWSA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG FR E L+ H A+L+     LY LQ I    R LPER+P   LYD+L++F+  
Sbjct: 61  RLEEHLGLFRLEALDFHAARLICLPEALYALQLIAFHLRLLPERDPHPVLYDILHLFMQN 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P V  ++ V+ E+ LL+ +GFGLDL+ C  TG  Q L +VSPKSG AVC   G P+ 
Sbjct: 121 FDEPFVNAELLVRFEMRLLEELGFGLDLSCCAATGRKQKLYYVSPKSGRAVCEEAGEPWK 180

Query: 181 EKMLVLPSFL-WKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFL 233
           +K+L+LP FL  +  +  D   + + F LT +FL +Y  +   I    +R N +
Sbjct: 181 KKLLILPQFLVQRATRPADFRDIINGFNLTSFFLMRYVWEPRDIKQPSVRTNLI 234


>gi|304392068|ref|ZP_07374010.1| DNA repair protein RecO [Ahrensia sp. R2A130]
 gi|303296297|gb|EFL90655.1| DNA repair protein RecO [Ahrensia sp. R2A130]
          Length = 241

 Score =  200 bits (508), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 94/219 (42%), Positives = 138/219 (63%), Gaps = 4/219 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W D AI+LGVR +GE +++ E+MTRQ GRHLG V  G+S  M+PILQ GN V   WR+
Sbjct: 1   MEWTDQAIVLGVRKHGETSVVAELMTRQRGRHLGLVHGGRSRTMRPILQPGNRVTATWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG+FR E      A+L+ +   +Y LQ++    R L ER+   +LYD L++ L+ 
Sbjct: 61  RLDEHLGQFRIEADNLRAARLMETDYAIYALQTLASHLRLLAERDAHPQLYDTLDLVLDA 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P+  G++ ++ EL LL  +GFGLDL  C  TG   +L+ VSP++G AV  +   PY 
Sbjct: 121 LDNPAAAGELVIRFELALLDELGFGLDLNACAATGARANLVSVSPRTGRAVSGAAAAPYG 180

Query: 181 EKMLVLPSFL--WKEEQTIDAD--SLKSAFQLTDYFLNK 215
           +++L LPSFL   + ++T  AD  +L   F LT +FL++
Sbjct: 181 DRLLALPSFLTTAQADRTSGADEETLAQGFALTGHFLHR 219


>gi|306842071|ref|ZP_07474743.1| DNA repair protein RecO [Brucella sp. BO2]
 gi|306287821|gb|EFM59244.1| DNA repair protein RecO [Brucella sp. BO2]
          Length = 247

 Score =  199 bits (507), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 100/236 (42%), Positives = 145/236 (61%), Gaps = 5/236 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D+ +ILG R +GE + I+EVMT  +GRH+G VR G+S RMQP+LQ GN V V+W +
Sbjct: 1   MEWRDEGVILGTRRHGETSAIVEVMTCGHGRHMGMVRGGRSRRMQPLLQPGNHVDVSWWA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL +++G F  E L    A+L+ + + LYG+Q      R LPER+P   LY+ L + +  
Sbjct: 61  RLDEHMGTFTIEPLGFAAARLIETPVALYGIQLAAAHLRLLPERDPHRGLYETLRLIIEH 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P   G++ ++ E+M+L+ +GFGLDL +C  TG    L++VSPKSG AVCR  G P+A
Sbjct: 121 FDDPLAAGELLLRFEVMMLEELGFGLDLKECAATGRKDGLIYVSPKSGRAVCREAGAPWA 180

Query: 181 EKMLVLPSFLWKEEQTIDA---DSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFL 233
           +K+L LPSF+   +  + A   D L  AF +T YFL ++  +         R  FL
Sbjct: 181 DKLLALPSFV--NDTALRASCYDDLDRAFTMTGYFLMRHVWEPRAQTPPDSRSGFL 234


>gi|218529181|ref|YP_002419997.1| DNA repair protein RecO [Methylobacterium chloromethanicum CM4]
 gi|254764643|sp|B7KPI6|RECO_METC4 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|218521484|gb|ACK82069.1| DNA repair protein RecO [Methylobacterium chloromethanicum CM4]
          Length = 246

 Score =  199 bits (505), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 94/222 (42%), Positives = 135/222 (60%), Gaps = 6/222 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W DD +++G+R +GE  ++LE+MT ++GRHLG V  G+S RMQP+LQ GN +R  WR+
Sbjct: 1   MQWIDDGLVIGLRKHGETGVVLELMTPEHGRHLGLVHGGRSRRMQPMLQPGNTLRATWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL   LG +  E L  + ++L+ S L LYG+  +  L R LPER+P   LY+   I +  
Sbjct: 61  RLDGALGAYAVEPLTLNASRLMDSGLALYGVAHLSALLRLLPERDPHPALYEAAQILIAH 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P +   + V+ EL LL  +GFGLDL+ C  TG    L++VSPKSG AV  S G P+ 
Sbjct: 121 LDDPEIAPALMVRFELALLAGLGFGLDLSHCAATGANDALVYVSPKSGRAVSASAGEPFR 180

Query: 181 EKMLVLPSFLWKEEQ------TIDADSLKSAFQLTDYFLNKY 216
           +++L LP FL   +Q      T D   ++  F LT YFL+++
Sbjct: 181 DRLLPLPPFLRDRDQPGSGWRTPDTQDVREGFTLTGYFLDQH 222


>gi|163850484|ref|YP_001638527.1| DNA repair protein RecO [Methylobacterium extorquens PA1]
 gi|240137548|ref|YP_002962019.1| DNA repair protein RecO [Methylobacterium extorquens AM1]
 gi|238687373|sp|A9W1K0|RECO_METEP RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|163662089|gb|ABY29456.1| DNA repair protein RecO [Methylobacterium extorquens PA1]
 gi|240007516|gb|ACS38742.1| DNA repair protein RecO [Methylobacterium extorquens AM1]
          Length = 246

 Score =  199 bits (505), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 94/222 (42%), Positives = 135/222 (60%), Gaps = 6/222 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W DD +++G+R +GE  ++LE+MT ++GRHLG V  G+S RMQP+LQ GN +R  WR+
Sbjct: 1   MQWIDDGLVIGLRKHGETGVVLELMTPEHGRHLGLVHGGRSRRMQPMLQPGNTLRATWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL   LG +  E L  + ++L+ S L LYG+  +  L R LPER+P   LY+   I +  
Sbjct: 61  RLDGALGAYAVEPLTLNASRLMDSGLALYGVAHLSALLRLLPERDPHPALYEAAQILIAH 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P +   + V+ EL LL  +GFGLDL+ C  TG    L++VSPKSG AV  S G P+ 
Sbjct: 121 LDDPEIAPALMVRFELALLAGLGFGLDLSHCAATGANDALVYVSPKSGRAVSASAGEPFR 180

Query: 181 EKMLVLPSFLWKEEQ------TIDADSLKSAFQLTDYFLNKY 216
           +++L LP FL   +Q      T D   ++  F LT YFL+++
Sbjct: 181 DRLLPLPPFLRDRDQPGSGWRTPDTHDVREGFTLTGYFLDQH 222


>gi|254560020|ref|YP_003067115.1| DNA repair protein RecO [Methylobacterium extorquens DM4]
 gi|254267298|emb|CAX23130.1| DNA repair protein RecO [Methylobacterium extorquens DM4]
          Length = 246

 Score =  199 bits (505), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 94/222 (42%), Positives = 135/222 (60%), Gaps = 6/222 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W DD +++G+R +GE  ++LE+MT ++GRHLG V  G+S RMQP+LQ GN +R  WR+
Sbjct: 1   MQWIDDGLVIGLRKHGETGVVLELMTPEHGRHLGLVHGGRSRRMQPMLQPGNTLRATWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL   LG +  E L  + ++L+ S L LYG+  +  L R LPER+P   LY+   I +  
Sbjct: 61  RLDGALGAYAVEPLTLNASRLMDSGLALYGVAHLSALLRLLPERDPHPALYEAAQILIAH 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P +   + V+ EL LL  +GFGLDL+ C  TG    L++VSPKSG AV  S G P+ 
Sbjct: 121 LDDPEIAPALMVRFELALLAGLGFGLDLSHCAATGANDALVYVSPKSGRAVSASAGEPFR 180

Query: 181 EKMLVLPSFLWKEEQ------TIDADSLKSAFQLTDYFLNKY 216
           +++L LP FL   +Q      T D   ++  F LT YFL+++
Sbjct: 181 DRLLPLPPFLRDRDQSGSGWRTPDTHDVREGFTLTGYFLDQH 222


>gi|49475306|ref|YP_033347.1| DNA repair protein RecO [Bartonella henselae str. Houston-1]
 gi|61215010|sp|Q6G457|RECO_BARHE RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|49238112|emb|CAF27319.1| DNA repair protein reco [Bartonella henselae str. Houston-1]
          Length = 256

 Score =  198 bits (503), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 99/217 (45%), Positives = 141/217 (64%), Gaps = 1/217 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W++ AIILG R YGE ++ILEVMTRQ+GR++G V+ G+S RM  +LQ GN V   W +
Sbjct: 1   MKWKEQAIILGTRQYGETSVILEVMTRQHGRYMGVVKGGRSRRMAVLLQPGNFVEAEWWA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG FR E L+ H A+L+     LY LQ IV     LPER+P   LYD+L++F+  
Sbjct: 61  RLDEHLGLFRLEALDLHAARLILFPEALYALQLIVFHLHLLPERDPHPILYDILHLFMQS 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P +  ++ V+ E+  L+ +GFGLDL++C  TG  + L +VSPKSG AVC   G P+ 
Sbjct: 121 FDEPFINAELLVRFEMRFLEELGFGLDLSRCAATGRLEKLCYVSPKSGRAVCEEAGHPWR 180

Query: 181 EKMLVLPSFLWKEE-QTIDADSLKSAFQLTDYFLNKY 216
           EK+L LP FL +   + +D   +K+ F LT +FL ++
Sbjct: 181 EKLLNLPQFLVQRTVRPVDFSDIKNGFILTGFFLMRH 217


>gi|188580258|ref|YP_001923703.1| DNA repair protein RecO [Methylobacterium populi BJ001]
 gi|238692877|sp|B1ZA19|RECO_METPB RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|179343756|gb|ACB79168.1| DNA repair protein RecO [Methylobacterium populi BJ001]
          Length = 246

 Score =  197 bits (502), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 93/222 (41%), Positives = 136/222 (61%), Gaps = 6/222 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W D+ +++G+R +GE  ++LE+MT ++GRHLG V  G+S RMQP+LQ GN +R  WR+
Sbjct: 1   MQWIDEGLVIGLRKHGETGVVLELMTLEHGRHLGLVHGGRSRRMQPMLQPGNTLRATWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL   LG +  E L  + ++L+ S L LYG+  +  L R LPER+P   LY+   + +  
Sbjct: 61  RLDGALGSYAVEPLTLNASRLMDSGLALYGIGHLSTLLRLLPERDPHPALYEAAQVLIAH 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P +   + V+ EL LL  +GFGLDL+ C  TG    L++VSPKSG AV  S G P+ 
Sbjct: 121 LDEPEIAPALMVRFELALLAGLGFGLDLSHCAATGANDALVYVSPKSGRAVSASAGEPFR 180

Query: 181 EKMLVLPSFLWKEEQ------TIDADSLKSAFQLTDYFLNKY 216
           +++L LP FL   +Q      T DA  ++  F LT YFL+++
Sbjct: 181 DRLLALPPFLRDRDQPGSGWRTPDAHDVREGFTLTGYFLDQH 222


>gi|240850199|ref|YP_002971592.1| DNA repair protein RecO [Bartonella grahamii as4aup]
 gi|240267322|gb|ACS50910.1| DNA repair protein RecO [Bartonella grahamii as4aup]
          Length = 248

 Score =  197 bits (500), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 100/234 (42%), Positives = 147/234 (62%), Gaps = 1/234 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W++ A+ILG R YGE ++ILEVMTR++GR++G V+ G+S RM  +LQ GN V   W +
Sbjct: 1   MKWKEQAVILGTRQYGETSVILEVMTREHGRYMGVVKGGRSRRMAALLQPGNFVEAEWWA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG FR E L+ H A+L+     LY LQ I    R LPER+P   LYD+L++F+  
Sbjct: 61  RLEEHLGLFRLEALDLHAARLICLPEALYALQLIAFHLRLLPERDPHPVLYDILHLFMQN 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P V  ++ V+ E+ LL+ +GFGLDL+ C  TG  + L +VSPKSG AVC   G P+ 
Sbjct: 121 FDEPFVNAELLVRFEMRLLEELGFGLDLSCCAATGRQERLHYVSPKSGRAVCEEAGEPWK 180

Query: 181 EKMLVLPSFL-WKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFL 233
           +K+L+LP FL  +  +  D+  + + F LT +FL ++  +   I    +R N +
Sbjct: 181 KKLLILPQFLVQRTTRPTDSSDIINGFILTGFFLMRHVWEPRDIKQPSVRMNLI 234


>gi|49474068|ref|YP_032110.1| DNA repair protein RecO [Bartonella quintana str. Toulouse]
 gi|61215004|sp|Q6G080|RECO_BARQU RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|49239572|emb|CAF25929.1| DNA repair protein recO [Bartonella quintana str. Toulouse]
          Length = 243

 Score =  196 bits (498), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 101/234 (43%), Positives = 146/234 (62%), Gaps = 1/234 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W++ A+ILG R YGE +IILEVMTRQ+GR++G V+ G S RM  +LQ GN V   W +
Sbjct: 1   MKWKEQAVILGTRQYGETSIILEVMTRQHGRYMGIVKGGHSRRMAGLLQPGNFVEAEWWA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG FR E L+ + A+L+     LY LQ IV   R LPER+P   LYD+L++F+  
Sbjct: 61  RLDEHLGLFRLEALDLYAARLILLPEALYALQLIVFHLRLLPERDPYPSLYDILHLFMQN 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
                V  ++ V+ E+ LL+ +GFGLDL++C  TG  + L +VSPKSG AVC   G P+ 
Sbjct: 121 FDESFVNAELLVRFEMRLLEELGFGLDLSRCAATGRQERLFYVSPKSGRAVCEEAGRPWK 180

Query: 181 EKMLVLPSFLWKEE-QTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFL 233
           EK+L LP FL +   + ++   + + F LT +FL ++  +   I    +R N +
Sbjct: 181 EKLLTLPQFLVRRAIRPVNFSDIINGFILTGFFLMRHVWEPRGIKQPSVRVNLI 234


>gi|86749733|ref|YP_486229.1| DNA repair protein RecO [Rhodopseudomonas palustris HaA2]
 gi|119361478|sp|Q2IWU2|RECO_RHOP2 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|86572761|gb|ABD07318.1| DNA replication and repair protein RecO [Rhodopseudomonas palustris
           HaA2]
          Length = 249

 Score =  194 bits (494), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 96/222 (43%), Positives = 136/222 (61%), Gaps = 3/222 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W D+ IILGVR +GE   I+E++TR +GRHLG VR G S R++P+LQ GN V   WR+
Sbjct: 1   MEWSDEGIILGVRRHGEAGAIVELLTRGHGRHLGLVRGGASSRLRPLLQPGNSVLAVWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG ++ E      A +L+SS  +YG+  +  L R LPER+P  ++Y+ML   L+ 
Sbjct: 61  RLDEHLGYYQLEGTRMRAATMLASSHAVYGITHLASLARLLPERDPHEDIYEMLERTLDD 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
                      ++ EL +L  +GFGLDL+ C  TG T DL++VSPKSGGAV R+ G P+ 
Sbjct: 121 FDDVGDAATHLIRFELAMLAELGFGLDLSACAATGATTDLIYVSPKSGGAVSRTAGEPWR 180

Query: 181 EKMLVLPSFLWKEEQTIDA---DSLKSAFQLTDYFLNKYALQ 219
           EK+L LP FL ++    +      L+  F LT  FL +  L+
Sbjct: 181 EKLLRLPDFLREDNDGRNGWSDQDLRDGFDLTGRFLLRNVLE 222


>gi|319408285|emb|CBI81938.1| DNA repair protein RecO [Bartonella schoenbuchensis R1]
          Length = 248

 Score =  193 bits (491), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 99/235 (42%), Positives = 149/235 (63%), Gaps = 1/235 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W++ AIILG R +GE ++ILE+MTRQ+GR++G V+ G+S  M  +LQ GN V   W +
Sbjct: 1   MRWKEQAIILGTRQHGETSVILEIMTRQHGRYMGMVKGGRSRSMAALLQPGNFVEAEWWA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG F+ E L+ H ++L+     LY LQ +    R LPER+P   LYDML+IF+  
Sbjct: 61  RLDEHLGLFKLEALDLHASRLMLIPEALYTLQLMASHLRLLPERDPHPILYDMLHIFMQN 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
                VI ++ ++ E+ LLK +GFGLDL+ CVVTG  ++L +VSPKSG AV    G  + 
Sbjct: 121 FDEWFVIAELLIRFEMRLLKELGFGLDLSCCVVTGCRENLHYVSPKSGRAVSEEAGYLWR 180

Query: 181 EKMLVLPSFL-WKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLG 234
           +K+L LP FL  +  + ID + +++ F LT++FL ++  +   I    +R N + 
Sbjct: 181 DKLLPLPQFLIQRASRPIDFNDMRNGFALTNFFLTRHVWEPRRIQQPSVRVNLIN 235


>gi|148256029|ref|YP_001240614.1| DNA repair protein RecO [Bradyrhizobium sp. BTAi1]
 gi|166221886|sp|A5EKL4|RECO_BRASB RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|146408202|gb|ABQ36708.1| DNA replication and repair protein RecO [Bradyrhizobium sp. BTAi1]
          Length = 248

 Score =  192 bits (487), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 101/236 (42%), Positives = 140/236 (59%), Gaps = 4/236 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W DD I+LG+R +GE + +LE++TR++GRHLG VR     RM+P+LQ GN VR  WR+
Sbjct: 1   MEWTDDGIVLGLRRHGESSAVLELLTREHGRHLGLVRGASGARMRPMLQPGNTVRAVWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG +  + L    A+L+S +   YG+  +  L R LPER+P  E+Y  L   L+ 
Sbjct: 61  RLDEHLGMYAIDGLTLRAAELMSVAHGAYGVTHLAALARLLPERDPHQEMYLRLEHALDD 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
                      V+ EL +L  +GFGLDL  C  TG T DL++VSPKSGGAV RS G P+A
Sbjct: 121 FAEAGGAAVHIVRFELAILAELGFGLDLESCAATGETTDLVYVSPKSGGAVSRSAGAPWA 180

Query: 181 EKMLVLPSFLWKEEQT---IDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFL 233
           +++L LP FL + E      D D L   F+LT  FL ++ L+         RE F+
Sbjct: 181 DRLLPLPPFLRESEDDHGFSDQD-LLDGFRLTGLFLLRHVLEPRGQGHSDAREGFI 235


>gi|39935766|ref|NP_948042.1| DNA repair protein RecO [Rhodopseudomonas palustris CGA009]
 gi|61215044|sp|Q6N6B8|RECO_RHOPA RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|39649619|emb|CAE28141.1| putative DNA repair protein RecO [Rhodopseudomonas palustris
           CGA009]
          Length = 250

 Score =  191 bits (484), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 97/223 (43%), Positives = 136/223 (60%), Gaps = 4/223 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W D+ IILGVR +GE   I+E++TR +GRHLG VR G S RM+P+LQ GN V  +WR+
Sbjct: 1   MEWSDEGIILGVRRHGESAAIVELLTRGHGRHLGMVRGGASARMRPLLQPGNSVLASWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG ++ E  +   A LL SS  +YG+  +  L R LPER+P  E+Y  L + L+ 
Sbjct: 61  RLDEHLGYYQLEATKMRAATLLGSSHAVYGVTHLASLARLLPERDPHEEIYQRLVLTLDD 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
                V     ++ EL +L  +GFGLDL+ C  TG T +L++VSPKSG AV RS G P+ 
Sbjct: 121 FDDFGVAAAHLIRFELAILAELGFGLDLSACAATGSTTELIYVSPKSGSAVSRSAGEPWR 180

Query: 181 EKMLVLPSFLWKEEQTI----DADSLKSAFQLTDYFLNKYALQ 219
           +++L LP+FL  +E           L   F+LT  FL +  L+
Sbjct: 181 DRLLRLPAFLRDDEAESGHGWSGQDLFDGFELTGRFLLRNVLE 223


>gi|192291353|ref|YP_001991958.1| DNA repair protein RecO [Rhodopseudomonas palustris TIE-1]
 gi|238692599|sp|B3QJH7|RECO_RHOPT RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|192285102|gb|ACF01483.1| DNA repair protein RecO [Rhodopseudomonas palustris TIE-1]
          Length = 250

 Score =  190 bits (483), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 97/223 (43%), Positives = 136/223 (60%), Gaps = 4/223 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W D+ IILGVR +GE   I+E++TR +GRHLG VR G S RM+P+LQ GN V  +WR+
Sbjct: 1   MEWSDEGIILGVRRHGESAAIVELLTRGHGRHLGMVRGGASARMRPLLQPGNSVLASWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG ++ E  +   A LL SS  +YG+  +  L R LPER+P  E+Y  L + L+ 
Sbjct: 61  RLDEHLGYYQLEATKMRAATLLGSSHAVYGVTHLASLARLLPERDPHEEIYQRLVLTLDD 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
                V     ++ EL +L  +GFGLDL+ C  TG T +L++VSPKSG AV RS G P+ 
Sbjct: 121 FDDFGVAAAHLIRFELAILAELGFGLDLSACAATGSTTELIYVSPKSGSAVSRSAGEPWR 180

Query: 181 EKMLVLPSFLWKEEQTI----DADSLKSAFQLTDYFLNKYALQ 219
           +++L LP+FL  +E           L   F+LT  FL +  L+
Sbjct: 181 DRLLRLPAFLRDDEAESGNGWSGQDLFDGFELTGRFLLRNVLE 223


>gi|85716281|ref|ZP_01047255.1| DNA repair protein RecO [Nitrobacter sp. Nb-311A]
 gi|85696953|gb|EAQ34837.1| DNA repair protein RecO [Nitrobacter sp. Nb-311A]
          Length = 260

 Score =  190 bits (483), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 96/222 (43%), Positives = 132/222 (59%), Gaps = 3/222 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W DD I+LGVR +GE + I+E++TR +GRHLG VR G   RM+P+LQ GN V   WR+
Sbjct: 1   MEWIDDGIVLGVRRHGESSAIVELLTRDHGRHLGLVRGGAGSRMRPLLQPGNSVNALWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG +  E      A LL+SS   YG+  +  L R LPER+P   ++ ML   L+ 
Sbjct: 61  RLDEHLGAYALEGTRMRAASLLASSHATYGVTHLAALARLLPERDPHEGIFTMLERTLDD 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
                      ++ EL +L  +GFGLDL+ C  TGVT DL++VSPKSGGAV R  G P+ 
Sbjct: 121 FDHAGGAAIHLIRFELAMLSELGFGLDLSACAATGVTGDLIYVSPKSGGAVSRQAGEPWR 180

Query: 181 EKMLVLPSFL---WKEEQTIDADSLKSAFQLTDYFLNKYALQ 219
           +++L LP FL     E+       L   F+LT  FL ++ L+
Sbjct: 181 DRLLPLPPFLRASHDEQNGCSEQDLLDGFELTGRFLLRHVLE 222


>gi|162139842|ref|YP_318527.2| DNA repair protein RecO [Nitrobacter winogradskyi Nb-255]
 gi|119361470|sp|Q3SRB6|RECO_NITWN RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
          Length = 262

 Score =  190 bits (482), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 96/228 (42%), Positives = 133/228 (58%), Gaps = 15/228 (6%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W DD I+LGVR +GE + I+E++TR +GRHLG VR G   RM+P+LQ GN V   WR+
Sbjct: 1   MEWTDDGIVLGVRRHGESSAIVELLTRTHGRHLGLVRGGAGSRMRPLLQPGNSVSALWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG +  E      A LL+SS   YG+  +  L R LPER+P   ++ ML   L+ 
Sbjct: 61  RLDEHLGTYALEGTRMRAASLLASSHATYGVTHLAALARLLPERDPHEVIFAMLERTLDD 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
                      ++ EL +L  +GFGLDL+ C  TG T DL++VSPKSGGAV R  G P+ 
Sbjct: 121 FDRAGGAAIHLIRFELAMLSELGFGLDLSACAATGATGDLIYVSPKSGGAVSRQAGEPWR 180

Query: 181 EKMLVLPSFL---------WKEEQTIDADSLKSAFQLTDYFLNKYALQ 219
           +++L LP FL         W E+  +D       F+LT  FL ++ L+
Sbjct: 181 DRLLPLPPFLRVTHDEQDGWSEQDLLD------GFELTGRFLLRHVLE 222


>gi|91977125|ref|YP_569784.1| DNA repair protein RecO [Rhodopseudomonas palustris BisB5]
 gi|119361480|sp|Q136V6|RECO_RHOPS RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|91683581|gb|ABE39883.1| DNA replication and repair protein RecO [Rhodopseudomonas palustris
           BisB5]
          Length = 249

 Score =  189 bits (481), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 94/222 (42%), Positives = 135/222 (60%), Gaps = 3/222 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W D+ IILGVR +GE   I+E++TR +GRHLG VR G S RM+P+LQ GN V   WR+
Sbjct: 1   MEWSDEGIILGVRRHGEAGAIVELLTRSHGRHLGLVRGGASSRMRPLLQPGNSVLAVWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG ++ E      A +L+SS  +YG+  +  L R LPER+P  ++Y+ML   L+ 
Sbjct: 61  RLDEHLGYYQLEGTRMRAATMLASSHAVYGVTHLASLARLLPERDPHEDIYEMLERTLDD 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
                      ++ EL +L  +GFGLDL+ C  TG T +L++VSPKSG AV R+ G P+ 
Sbjct: 121 FDDVGDAATHLIRFELAMLAELGFGLDLSACAATGATVELIYVSPKSGSAVSRAAGEPWR 180

Query: 181 EKMLVLPSFLWKEEQTIDA---DSLKSAFQLTDYFLNKYALQ 219
           +K+L LP+FL  +    +      L+  F LT  FL +  L+
Sbjct: 181 DKLLRLPAFLRDDNDGRNGWSDQDLRDGFDLTGRFLLRNVLE 222


>gi|74420976|gb|ABA05175.1| DNA replication and repair protein RecO [Nitrobacter winogradskyi
           Nb-255]
          Length = 278

 Score =  189 bits (480), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 96/228 (42%), Positives = 133/228 (58%), Gaps = 15/228 (6%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W DD I+LGVR +GE + I+E++TR +GRHLG VR G   RM+P+LQ GN V   WR+
Sbjct: 17  MEWTDDGIVLGVRRHGESSAIVELLTRTHGRHLGLVRGGAGSRMRPLLQPGNSVSALWRA 76

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG +  E      A LL+SS   YG+  +  L R LPER+P   ++ ML   L+ 
Sbjct: 77  RLDEHLGTYALEGTRMRAASLLASSHATYGVTHLAALARLLPERDPHEVIFAMLERTLDD 136

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
                      ++ EL +L  +GFGLDL+ C  TG T DL++VSPKSGGAV R  G P+ 
Sbjct: 137 FDRAGGAAIHLIRFELAMLSELGFGLDLSACAATGATGDLIYVSPKSGGAVSRQAGEPWR 196

Query: 181 EKMLVLPSFL---------WKEEQTIDADSLKSAFQLTDYFLNKYALQ 219
           +++L LP FL         W E+  +D       F+LT  FL ++ L+
Sbjct: 197 DRLLPLPPFLRVTHDEQDGWSEQDLLD------GFELTGRFLLRHVLE 238


>gi|307946583|ref|ZP_07661918.1| DNA repair protein RecO [Roseibium sp. TrichSKD4]
 gi|307770247|gb|EFO29473.1| DNA repair protein RecO [Roseibium sp. TrichSKD4]
          Length = 256

 Score =  189 bits (480), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 98/237 (41%), Positives = 139/237 (58%), Gaps = 4/237 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W    I+LG R +GE ++ILEVMT  YGRHLG VR G+S   QP +Q GN ++V WR+
Sbjct: 1   MEWTATGIVLGSRKHGENDVILEVMTETYGRHLGLVRGGRSRTRQPQIQPGNELQVTWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL + LG +  E L    A+L++S L L+G+Q +  L R LPER+P   LY  L + L+ 
Sbjct: 61  RLPEQLGTYSIEPLRLRAAELMASPLGLHGVQHLGALLRMLPERDPHAALYRALTLVLDQ 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
            +   +   + ++ EL LL  +GFGLDL+ C  TG  +DL +VSPKSG AV R  G PY 
Sbjct: 121 LQDGDIGPPLLIRFELELLNELGFGLDLSCCAATGSQEDLAYVSPKSGRAVSRDAGQPYH 180

Query: 181 EKMLVLPSFLWKEEQTIDAD----SLKSAFQLTDYFLNKYALQHNIIHCHLLRENFL 233
           +K+L LP FL   ++   ++     L + F+LT +FL ++           LR+  L
Sbjct: 181 DKLLPLPDFLIDGQRQPGSELLFKDLSNGFKLTRFFLARHEKWQTDPAIESLRQQLL 237


>gi|92117771|ref|YP_577500.1| DNA repair protein RecO [Nitrobacter hamburgensis X14]
 gi|119361468|sp|Q1QL57|RECO_NITHX RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|91800665|gb|ABE63040.1| DNA replication and repair protein RecO [Nitrobacter hamburgensis
           X14]
          Length = 253

 Score =  189 bits (480), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 96/222 (43%), Positives = 136/222 (61%), Gaps = 3/222 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W DD I+LGVR +GE + I+E++TR +GRHLG VR G   RM+P+LQ GN V   WR+
Sbjct: 1   MEWTDDGIVLGVRRHGESSAIVELLTRGHGRHLGLVRGGAGSRMRPLLQPGNSVSALWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG +  E      A LL +S   YG+  +  L R LPER+P   +++ L   L+ 
Sbjct: 61  RLDEHLGAYALEGTRMRAANLLGASHATYGVTHLASLARLLPERDPHDGIFERLERTLDD 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
                      ++ EL +L  +GFGLDL+ CV TG T +L++VSPKSGGAV R  G P+ 
Sbjct: 121 FDTAGEAAIHLIRFELAMLTELGFGLDLSTCVATGTTTELIYVSPKSGGAVSRQAGEPWR 180

Query: 181 EKMLVLPSFLWK--EEQTIDAD-SLKSAFQLTDYFLNKYALQ 219
           +++L LP FL +  EEQ+  +D  L   F+LT  FL ++ L+
Sbjct: 181 DRLLRLPPFLREADEEQSGWSDQDLLDGFELTGRFLLRHVLE 222


>gi|146341374|ref|YP_001206422.1| DNA repair protein RecO [Bradyrhizobium sp. ORS278]
 gi|166221887|sp|A4YWC5|RECO_BRASO RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|146194180|emb|CAL78201.1| putative DNA repair protein RecO (Recombination protein O)
           [Bradyrhizobium sp. ORS278]
          Length = 248

 Score =  188 bits (478), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 97/235 (41%), Positives = 140/235 (59%), Gaps = 2/235 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W DD I+LG+R +GE + ++E++TR++GRHLG VR     RM+P+LQ GN VR  WR+
Sbjct: 1   MEWTDDGIVLGLRRHGESSAVVELLTREHGRHLGLVRGAAGKRMRPVLQPGNTVRAIWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG +  + L    A+L+S+S   YG+  +  L R LPER+P  ++Y  L   L+ 
Sbjct: 61  RLDEHLGMYAVDGLTLRAAELMSASHGAYGVTHLASLARLLPERDPHEDMYFRLEHALDD 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
                      V+ EL +L  +GFGLDL  C  TG T DL++VSPKSGGAV R+ G P+A
Sbjct: 121 FADAGAAAAHIVRFELAILTELGFGLDLESCAATGETSDLIYVSPKSGGAVSRTAGAPWA 180

Query: 181 EKMLVLPSFLWK--EEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFL 233
           +++L LP FL +  E+       L   F+LT  FL ++ L+         RE F+
Sbjct: 181 DRLLPLPPFLRESDEDHGWSDQDLLDGFRLTGLFLLRHVLEPRGQGHSDAREGFI 235


>gi|298291623|ref|YP_003693562.1| DNA repair protein RecO [Starkeya novella DSM 506]
 gi|296928134|gb|ADH88943.1| DNA repair protein RecO [Starkeya novella DSM 506]
          Length = 243

 Score =  188 bits (477), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 94/220 (42%), Positives = 128/220 (58%), Gaps = 1/220 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W D+ IILG+R +GE N I+E+MT  +GRHLG VR G S R    LQ GN V+  WR+
Sbjct: 1   MEWSDEGIILGLRRHGEGNAIVELMTAAHGRHLGLVRGGGSRRQAAALQPGNGVQATWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG F  EV      +L+ ++   + L  I  L R LPER+P  EL+D+L   +  
Sbjct: 61  RLDEHLGTFALEVTTPRAGRLMGAAHSAFALSHIGSLIRMLPERDPHPELHDVLTAMVEH 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P + G +  + ELM+L  +GFGLDL  C  TG   DLL+VSPKSG AV R  G P+ 
Sbjct: 121 LDEPRLTGMMMARFELMMLSELGFGLDLESCAATGGRNDLLYVSPKSGRAVSRDAGEPWR 180

Query: 181 EKMLVLPSFLWKE-EQTIDADSLKSAFQLTDYFLNKYALQ 219
            ++L LP FL  E  +      + +AF LT +FL +   +
Sbjct: 181 AQLLNLPYFLIGEVAEPPSPGDVDAAFDLTGHFLARRVFE 220


>gi|209884979|ref|YP_002288836.1| DNA repair protein RecO [Oligotropha carboxidovorans OM5]
 gi|229470366|sp|B6JGG5|RECO_OLICO RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|209873175|gb|ACI92971.1| DNA repair protein RecO [Oligotropha carboxidovorans OM5]
          Length = 249

 Score =  188 bits (477), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 96/222 (43%), Positives = 132/222 (59%), Gaps = 3/222 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W DD IILG R +GE N I+E++TR +GRHLG VR G   RM+P+LQ GN V   WR+
Sbjct: 1   MEWTDDGIILGTRRHGEANAIVELLTRSHGRHLGLVRGGAGTRMRPLLQPGNSVGAVWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG +  E      A +LS S   YG+  +  L R LPER P   +Y+     L  
Sbjct: 61  RLDEHLGYYALEGTRLRAATMLSYSHAAYGITHLAALARLLPERAPHDGIYEQFEAILED 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P +     V+ E+ +L+ +GFGLDL+ C  TG   DL++VSPKSG AV RS G P+ 
Sbjct: 121 FDDPVIAATHVVRFEMAMLEELGFGLDLSCCAATGTHTDLIYVSPKSGCAVSRSAGEPWR 180

Query: 181 EKMLVLPSFL--WKEEQTIDADS-LKSAFQLTDYFLNKYALQ 219
           E++L LP+FL    EE + D ++ +   F+LT  FL +  L+
Sbjct: 181 ERLLPLPAFLRAGNEESSPDGEADIMEGFRLTGMFLLRNVLE 222


>gi|6655025|gb|AAF22872.1| recO-like protein [Bradyrhizobium japonicum]
          Length = 250

 Score =  187 bits (475), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 94/221 (42%), Positives = 134/221 (60%), Gaps = 2/221 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W D+ I+LGVR +GE + I+E++TR +GRHLG VR G   RM+P+LQ GN V   WR+
Sbjct: 1   MEWTDEGIVLGVRRHGESSAIVELLTRAHGRHLGLVRGGAGSRMRPLLQPGNSVTAVWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG +  E L+   A LL+SS  +YG+  +  + R LPER+P  E++ +L   L+ 
Sbjct: 61  RLDEHLGTYAVEGLKLRAATLLASSHGVYGVTHLASIARLLPERDPHEEIFGLLEHSLDD 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
                      +  EL +L  +GFGL L  C VTG T DL++VSPKSGGAV R  G P+ 
Sbjct: 121 FDDIGSAAVHVIHFELAMLAELGFGLALDNCAVTGETTDLIYVSPKSGGAVSRGAGEPWR 180

Query: 181 EKMLVLPSFLWKEEQTID--ADSLKSAFQLTDYFLNKYALQ 219
           +++L LP FL   E   +     L+  F+LT  FL ++ L+
Sbjct: 181 DRLLRLPPFLRHGETATELTDQDLQDGFRLTGLFLLRHVLE 221


>gi|27380169|ref|NP_771698.1| DNA repair protein RecO [Bradyrhizobium japonicum USDA 110]
 gi|30179751|sp|Q9RH67|RECO_BRAJA RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|27353323|dbj|BAC50323.1| recO-like protein [Bradyrhizobium japonicum USDA 110]
          Length = 250

 Score =  187 bits (475), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 94/221 (42%), Positives = 134/221 (60%), Gaps = 2/221 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W D+ I+LGVR +GE + I+E++TR +GRHLG VR G   RM+P+LQ GN V   WR+
Sbjct: 1   MEWTDEGIVLGVRRHGESSAIVELLTRAHGRHLGLVRGGAGSRMRPLLQPGNSVSAVWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG +  E L+   A LL+SS  +YG+  +  + R LPER+P  E++ +L   L+ 
Sbjct: 61  RLDEHLGTYAVEGLKLRAATLLASSHGVYGVTHLASIARLLPERDPHEEIFGLLEHSLDD 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
                      +  EL +L  +GFGL L  C VTG T DL++VSPKSGGAV R  G P+ 
Sbjct: 121 FDDIGSAAVHVIHFELAMLAELGFGLALDNCAVTGETTDLIYVSPKSGGAVSRGAGEPWR 180

Query: 181 EKMLVLPSFLWKEEQTID--ADSLKSAFQLTDYFLNKYALQ 219
           +++L LP FL   E   +     L+  F+LT  FL ++ L+
Sbjct: 181 DRLLRLPPFLRHGETATELTDQDLQDGFRLTGLFLLRHVLE 221


>gi|316934141|ref|YP_004109123.1| DNA repair protein RecO [Rhodopseudomonas palustris DX-1]
 gi|315601855|gb|ADU44390.1| DNA repair protein RecO [Rhodopseudomonas palustris DX-1]
          Length = 250

 Score =  186 bits (473), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 94/223 (42%), Positives = 135/223 (60%), Gaps = 4/223 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W D+ IILGVR +GE   I+E++TR +GRHLG VR   S RM+P+LQ GN V  +WR+
Sbjct: 1   MDWSDEGIILGVRRHGEAGAIVELLTRSHGRHLGMVRGAASARMRPLLQPGNSVLASWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG ++ E  +   A LL+SS  +YG+  +  L R LPER+P  E+Y  L + L+ 
Sbjct: 61  RLDEHLGYYQLEATKMRAATLLASSHAVYGVTHLASLARLLPERDPHEEIYHRLILTLDD 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
                +     ++ EL +L  +GFGLDL+ C  TG T +L++VSPKSG AV R  G P+ 
Sbjct: 121 FDDLGIAAAHLIRFELAILAELGFGLDLSACAATGATTELIYVSPKSGSAVSRIAGEPWR 180

Query: 181 EKMLVLPSFLWKEEQTIDA----DSLKSAFQLTDYFLNKYALQ 219
           +++L LP FL  +E   ++      L   F LT  FL +  L+
Sbjct: 181 DRLLRLPPFLRDDEAASESGWSGQDLFDGFALTGRFLLRNVLE 223


>gi|118587959|ref|ZP_01545369.1| DNA repair protein RecO [Stappia aggregata IAM 12614]
 gi|118439581|gb|EAV46212.1| DNA repair protein RecO [Stappia aggregata IAM 12614]
          Length = 251

 Score =  186 bits (471), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 88/226 (38%), Positives = 133/226 (58%), Gaps = 4/226 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W    ++L  R +GE ++ILE MT  +GRHLG VR G+S R +P+LQ GN + + W++
Sbjct: 1   MEWSGRGVVLTTRKHGENDVILEAMTLDHGRHLGLVRGGRSRRHRPVLQPGNELTLTWKA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL+ +LG+F  E        L++SSL L  LQ +  L R LPER     L++ L + L+ 
Sbjct: 61  RLSDHLGQFHIEPETLRAGDLMTSSLGLAALQHLAFLLRLLPERHTYPRLFNALTVVLDH 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
            +       + ++ EL +L+++G GLDL+ C  TG  +DL +VSPKS  AVCR  GLPY 
Sbjct: 121 LEASDAAAALLIRFELEVLRDLGIGLDLSSCAATGSNEDLAYVSPKSARAVCREAGLPYH 180

Query: 181 EKMLVLPSFLWKEEQTIDAD----SLKSAFQLTDYFLNKYALQHNI 222
           +++L LP FL   ++   ++     +   F LT +FLN+Y  +H  
Sbjct: 181 DRLLPLPGFLLDGQRQAGSELTWADVTQGFDLTSFFLNRYLQEHGT 226


>gi|323137541|ref|ZP_08072618.1| DNA repair protein RecO [Methylocystis sp. ATCC 49242]
 gi|322397167|gb|EFX99691.1| DNA repair protein RecO [Methylocystis sp. ATCC 49242]
          Length = 241

 Score =  185 bits (470), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 93/215 (43%), Positives = 132/215 (61%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D+ +++G R +GE ++ILE+MTRQ+GRHLG VR G+S  M+P+LQ GNLV  +WR+
Sbjct: 1   MEWRDEGLVIGARKHGETSVILELMTRQHGRHLGVVRGGRSQAMRPVLQPGNLVVASWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL  +LG F  E L S  A+ L     L+G+ ++    R LPER+P  EL++M +     
Sbjct: 61  RLEVHLGAFAIEPLASRAARYLDRGAALHGVAALAAWLRLLPERDPYEELFEMADAIACR 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
                    +  + EL LL  +GFGLDL  C +TG   DL +VSPKSG AV R  G P+ 
Sbjct: 121 LDAADFAAPLMARFELALLGALGFGLDLGACALTGARDDLAYVSPKSGRAVSREAGAPWR 180

Query: 181 EKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNK 215
           E++L  P+FL +       D + +AF+LT YFL +
Sbjct: 181 ERLLPYPAFLREASDVAAVDDVAAAFRLTGYFLTR 215


>gi|319405460|emb|CBI79079.1| DNA repair protein RecO [Bartonella sp. AR 15-3]
          Length = 248

 Score =  185 bits (470), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 106/230 (46%), Positives = 147/230 (63%), Gaps = 1/230 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W++ AIILG R +GE ++ILE+MTRQ+GR++G V+ G+S RM P+LQ GN V   W +
Sbjct: 1   MKWKEPAIILGTRQHGETSVILEIMTRQHGRYMGIVKGGRSRRMAPLLQPGNFVEAEWWA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG FR E L+SH ++L+     LY LQ +    R LPER+P   LYDML  F+  
Sbjct: 61  RLDEHLGLFRLEALDSHASRLIVLPEALYSLQLMASHLRLLPERDPHPVLYDMLYFFMQN 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P +  ++ V+ EL+LL+ +GFGLDL+ C VTG  + L +VSPKSG AVC  +G P+ 
Sbjct: 121 FDDPFINAELLVRFELLLLEELGFGLDLSCCAVTGRQEKLCYVSPKSGRAVCEEIGRPWK 180

Query: 181 EKMLVLPSFL-WKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLR 229
           +K+L+LP FL  K    ID D +     LTD+FL +Y  +   I    LR
Sbjct: 181 DKLLLLPQFLVQKTACPIDFDDINKGLTLTDFFLTRYVWEARGIKQPSLR 230


>gi|90424142|ref|YP_532512.1| DNA repair protein RecO [Rhodopseudomonas palustris BisB18]
 gi|119361479|sp|Q214J3|RECO_RHOPB RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|90106156|gb|ABD88193.1| DNA repair protein RecO [Rhodopseudomonas palustris BisB18]
          Length = 254

 Score =  185 bits (469), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 97/242 (40%), Positives = 140/242 (57%), Gaps = 3/242 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W D+ I+LGVR +GE + I+E++TR +GRHLG VR G   +++P+LQ GN V   WR+
Sbjct: 1   MEWTDEGIVLGVRRHGESSAIVELLTRGHGRHLGLVRGGAGSKLRPLLQPGNSVSAVWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG +  E      A LL+SS  +YG+  +  L R LPER+P  E+Y+ L   L+ 
Sbjct: 61  RLDEHLGYYVLEGTRMRAAMLLASSHAVYGVTHLASLARLLPERDPQPEIYERLERTLDD 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
                      ++ EL +L  +GFGLDL  C  TGVT DL++VSPKSGGAV R+ G P+ 
Sbjct: 121 FDDVGEAAVHVIRFELTMLAELGFGLDLANCAATGVTSDLIYVSPKSGGAVSRAAGEPWR 180

Query: 181 EKMLVLPSFLWK---EEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLL 237
           +K+L LP FL +   +        L+  F LT  FL +  L+         R+ F+  ++
Sbjct: 181 DKLLRLPPFLREGSAQRNDWSDQDLQDGFLLTGRFLLRNVLEPRGQGHSDARDGFINAVV 240

Query: 238 EL 239
            L
Sbjct: 241 RL 242


>gi|218670194|ref|ZP_03519865.1| DNA repair protein RecO [Rhizobium etli GR56]
          Length = 190

 Score =  184 bits (468), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 85/167 (50%), Positives = 117/167 (70%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M WQD AIILGV+ +GE ++I EVMTR  GRHLG VR+G+S  MQP+LQ GN V V WR+
Sbjct: 1   MQWQDHAIILGVKRHGETSVIAEVMTRDRGRHLGLVRSGRSRAMQPVLQPGNAVEVIWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LGEFR E +    A+L+ ++  +YG+Q++  L R LPER+P   L+D L + L+ 
Sbjct: 61  RLDEHLGEFRVEPVTLRAARLMETATAVYGVQAMGALLRLLPERDPHPHLFDALEVILDH 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKS 167
              P+  G++FV+ EL +L ++GFGLDL +C  TG   DL +VSPKS
Sbjct: 121 LHNPADAGELFVRFELAVLNDLGFGLDLAECAATGDRSDLAYVSPKS 167


>gi|299135099|ref|ZP_07028290.1| DNA repair protein RecO [Afipia sp. 1NLS2]
 gi|298590076|gb|EFI50280.1| DNA repair protein RecO [Afipia sp. 1NLS2]
          Length = 249

 Score =  182 bits (463), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 93/239 (38%), Positives = 136/239 (56%), Gaps = 3/239 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W D+ IILG R +GE + I+E++TR +GRHLG VR G   RM+P+LQ GN V   WR+
Sbjct: 1   MEWTDEGIILGTRRHGESSAIVELLTRSHGRHLGLVRGGAGTRMRPLLQPGNSVSAVWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG +  E  +   A +L+     YG+  +  L R LPER P   +Y++L   L+ 
Sbjct: 61  RLDEHLGYYAIEGTQLRAATMLACPHAAYGITHLAALARLLPERAPHDGIYELLEAILDD 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P V     V+ E+ +L  +GFGLDL+ C  TG   DL++VSPKSG AV R+ G P+ 
Sbjct: 121 FDEPVVAATHVVRFEMAMLDELGFGLDLSSCAATGAQADLIYVSPKSGCAVSRAAGEPWR 180

Query: 181 EKMLVLPSFLWKEEQTIDADS---LKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKL 236
           E++L LP FL    +   A++   +   F+LT  FL +  L+         R+ F+  +
Sbjct: 181 ERLLPLPPFLRAGHEDSGAETERDMMEGFRLTGLFLLRNVLEPRGQGHSDARDGFIAAV 239


>gi|158423630|ref|YP_001524922.1| recombination protein O [Azorhizobium caulinodans ORS 571]
 gi|158330519|dbj|BAF88004.1| recombination protein O [Azorhizobium caulinodans ORS 571]
          Length = 245

 Score =  182 bits (463), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 92/236 (38%), Positives = 133/236 (56%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W D  I+LGVR +GE + I+++MTR+ GRH G VR G S R+  +LQ GN +   WR+
Sbjct: 1   MEWTDAGIVLGVRRHGETSAIVDLMTRERGRHAGLVRGGGSRRLAALLQPGNTLHATWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL   LG    E L      ++ S+   +G+  +V L R LPER+P   L+  L+  L+ 
Sbjct: 61  RLEGQLGLMTVEPLTLRSDAIMRSAHGSFGVTHLVGLMRLLPERDPHPGLFASLDAILDA 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P+  G++  + E+ LL  +GFGLDLT C  TG   DL +VSP+SG AV RS G PYA
Sbjct: 121 FDEPAHAGELLARFEMALLVELGFGLDLTTCAATGGNNDLAYVSPRSGRAVSRSAGEPYA 180

Query: 181 EKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKL 236
           +K+  LP+FL           ++ A ++T +FL+   L+   +     R +FL  L
Sbjct: 181 DKLFGLPTFLIGGIVPPSLPDMEEALRMTGFFLSTRVLEPRGLALGEARASFLAAL 236


>gi|144899859|emb|CAM76723.1| DNA repair protein RecO [Magnetospirillum gryphiswaldense MSR-1]
          Length = 250

 Score =  181 bits (459), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 94/224 (41%), Positives = 128/224 (57%), Gaps = 3/224 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W DD I+L VR  GE  I+  + TR +GRH G V  G     +  LQ GNLV+ +WR+
Sbjct: 1   MDWTDDGIVLAVRRLGEAGIVASLFTRSHGRHPGMVPGGAGRANRAALQPGNLVQASWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFR-FLPEREPCLELYDMLNIFLN 119
           RL + LG +R E+ E+H AK L  +  L  L S   L    LPER+P   L+D L+  L 
Sbjct: 61  RLPEQLGTYRLELAEAHSAKALDDAGCLAALTSACALCEALLPERQPHAPLFDALSALLV 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
               PS    ++V  EL LL+ +G+GLDL+ C  TG T DL++VSPKS  AV    G P+
Sbjct: 121 SLTAPSWP-SVYVHWELALLRGLGYGLDLSACAATGATTDLIYVSPKSARAVSAQAGQPH 179

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNII 223
           A K+L LP+FL  + +  DA  + +   LT YF+ ++ LQ   I
Sbjct: 180 AHKLLPLPAFLLGKSEG-DATDIAAGLTLTGYFIERHLLQQRHI 222


>gi|296444472|ref|ZP_06886437.1| DNA repair protein RecO [Methylosinus trichosporium OB3b]
 gi|296258119|gb|EFH05181.1| DNA repair protein RecO [Methylosinus trichosporium OB3b]
          Length = 240

 Score =  181 bits (459), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 91/235 (38%), Positives = 139/235 (59%), Gaps = 1/235 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D+ +++GVR +GE  +ILE+MTR +GRH+G VR G    ++ +LQ GN V V WR+
Sbjct: 1   MEWRDEGLVIGVRRHGESAVILELMTRAHGRHMGLVRGGSGRALRSVLQVGNSVEVLWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG F  E L S  A+L+  +  L+G+  +  L R LPER+   EL++M  +  + 
Sbjct: 61  RLEEHLGAFAVEPLRSRAARLIDRAFALHGVAHLAALLRLLPERDAQRELFEMAELIADR 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
                +   +  + EL LL+ +GFGLD+ +C +TG TQDL +VSPK+G AV R  G P+ 
Sbjct: 121 LDSLDLAPALMARFELALLQALGFGLDVERCALTGATQDLAFVSPKTGRAVTRDAGAPWR 180

Query: 181 EKMLVLPSFLWK-EEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLG 234
           +++L  P FL        DA  L +AF+LT +FL +       +     R  ++G
Sbjct: 181 DRLLPFPPFLQDCARAPADASELAAAFRLTGHFLARDVFTPRGLEAPQARALYVG 235


>gi|254502661|ref|ZP_05114812.1| DNA repair protein RecO [Labrenzia alexandrii DFL-11]
 gi|222438732|gb|EEE45411.1| DNA repair protein RecO [Labrenzia alexandrii DFL-11]
          Length = 244

 Score =  180 bits (456), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 89/220 (40%), Positives = 130/220 (59%), Gaps = 4/220 (1%)

Query: 8   IILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQNLG 67
           ++L  R +GE ++ILEVMT   GRHLG VR G+S R +P LQ GN + + W++RL+ +LG
Sbjct: 1   MVLTTRKHGENDVILEVMTADSGRHLGLVRGGRSKRHRPALQPGNELSLTWKARLSDHLG 60

Query: 68  EFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPSVI 127
           +F+ E   +  A L++S + L  +Q +  L R LPER P   +Y  LN+ L+        
Sbjct: 61  QFQIEPHTARAADLMNSGIGLAAVQHLAALVRLLPERHPYPRIYGALNVVLDHLDASDAA 120

Query: 128 GKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKMLVLP 187
             + ++ EL LL+ +G GLDLT C  TG T DL +VSP+S  AV R  G PY +K+L LP
Sbjct: 121 AALMIRFELELLQELGAGLDLTSCAATGTTDDLAYVSPRSARAVSREAGRPYHDKLLPLP 180

Query: 188 SFLWKEEQTIDAD----SLKSAFQLTDYFLNKYALQHNII 223
           SFL   ++    +     +   FQLT +FL++   + NI 
Sbjct: 181 SFLLDGQRQAGTELTWQDVTQGFQLTGFFLDRQLGERNIT 220


>gi|217979938|ref|YP_002364085.1| DNA repair protein RecO [Methylocella silvestris BL2]
 gi|254764645|sp|B8EMP4|RECO_METSB RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|217505314|gb|ACK52723.1| DNA repair protein RecO [Methylocella silvestris BL2]
          Length = 247

 Score =  179 bits (455), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 90/218 (41%), Positives = 133/218 (61%), Gaps = 5/218 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D+ +I+GVR YGE ++ILE MTR +GRHLG VR G+S RM+ +LQ GN   + WR+
Sbjct: 1   MEWRDEGLIIGVRQYGEASVILEAMTRGHGRHLGLVRGGRSQRMRAVLQPGNSAELVWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL + LG +  E  +   A L++S+  L+ +  I  L R + ER+P  +LY+   + +  
Sbjct: 61  RLDEQLGTWAIEPTQLRAATLMASAEALHAVGLICALLRLIAERDPHPDLYET-AVLIAG 119

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
           H     +  + V++E+ +L+  GFGLDL++C  TG  +DL +VSPKSG AV  + G PY 
Sbjct: 120 HIGDERLAPLLVRLEIEILRETGFGLDLSRCAATGAREDLAYVSPKSGRAVSLAAGAPYR 179

Query: 181 EKMLVLPSFLWKEE---QTIDADSLKSAFQLTDYFLNK 215
           E++L LP FL  E    +    D L   F LT +FL +
Sbjct: 180 ERLLPLPPFLRDEAPGGEPTPQDVL-DGFGLTGFFLKR 216


>gi|220923264|ref|YP_002498566.1| DNA repair protein RecO [Methylobacterium nodulans ORS 2060]
 gi|254764644|sp|B8IL75|RECO_METNO RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|219947871|gb|ACL58263.1| DNA repair protein RecO [Methylobacterium nodulans ORS 2060]
          Length = 246

 Score =  179 bits (454), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 97/238 (40%), Positives = 137/238 (57%), Gaps = 5/238 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W D+ ++LG R +GE +++LE+MT  +GRHLG V  G+S RMQP+LQ GN VR  WR+
Sbjct: 1   MQWSDEGLVLGARRHGETSVVLELMTAGHGRHLGLVHGGRSRRMQPVLQPGNRVRAVWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL + LG F  E +ES   +L+ S L LYGL     L R LPER+P   LY    + +  
Sbjct: 61  RLDEGLGHFAVEPIESAAGRLMGSRLALYGLAHAAALLRLLPERDPHPSLYAAAQVLVAH 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P++   + V+ EL +L ++GFGLDL+ C  TG    L +VSPKSG AV  + G P+ 
Sbjct: 121 LTDPAIAPALMVRFELAVLADLGFGLDLSACAATGSNAYLAYVSPKSGRAVSAAAGEPWR 180

Query: 181 EKMLVLPSFLWKEE-----QTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFL 233
           +++L LP FL   E      T     ++  F LT YFL+++      +     RE F+
Sbjct: 181 DRLLALPDFLVAREAGGTGATPTPRDVRQGFTLTGYFLDQHVWHPRGVAPPEARELFV 238


>gi|23014388|ref|ZP_00054207.1| COG1381: Recombinational DNA repair protein (RecF pathway)
           [Magnetospirillum magnetotacticum MS-1]
          Length = 309

 Score =  177 bits (450), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 96/240 (40%), Positives = 130/240 (54%), Gaps = 9/240 (3%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W DD I+L VR +GE   +  ++TR +GRH G V  GQ    +PILQ GNLVR  W  
Sbjct: 74  MEWDDDGIVLAVRRHGETGAVASLLTRSHGRHAGLVHGGQGRTNRPILQPGNLVRAKWTG 133

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFR-FLPEREP---CLELYDMLNI 116
           RL + LG F+ E+L ++ A  L  +  L  L S   L    L ER+P   C      L  
Sbjct: 134 RLPEQLGNFKLEMLHAYGAAFLDDAARLSALGSACALVETALAERQPHPACHAALVALLH 193

Query: 117 FLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVG 176
            L     PS    I+V  EL LL+++GFGLDL+ C  TG T DL WVSPK+G AV R+ G
Sbjct: 194 ALEAESWPS----IYVHFELALLRDLGFGLDLSACAATGQTDDLAWVSPKTGRAVSRAAG 249

Query: 177 LPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKL 236
            PY +K+  LP+FL  E    DA +++   ++T +FL ++ L          R   +G+L
Sbjct: 250 EPYRDKLFKLPAFL-VEGGEGDAAAIREGLEMTGFFLQRHVLDSRHAVLPAARGRMIGRL 308


>gi|170742438|ref|YP_001771093.1| DNA repair protein RecO [Methylobacterium sp. 4-46]
 gi|168196712|gb|ACA18659.1| DNA repair protein RecO [Methylobacterium sp. 4-46]
          Length = 267

 Score =  177 bits (449), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 97/238 (40%), Positives = 135/238 (56%), Gaps = 5/238 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W D+ ++LG R  GE  ++LE+MT  +GRHLG V  G+S RMQP+LQ GN VR  WR+
Sbjct: 22  MQWSDEGLVLGARRLGETGVVLELMTAAHGRHLGLVHGGRSRRMQPVLQPGNRVRAVWRA 81

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL   LG F  E L+S   +L+ S L LYGL     L R LPER+P   LY+   + ++ 
Sbjct: 82  RLDDGLGSFAVEPLDSAAGRLIGSRLALYGLAHAAALLRLLPERDPHPGLYEAARVLIDH 141

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
               ++   + V+ EL +L  +GFGLDL+ C  TG    L +VSPKSG AV  + G P+ 
Sbjct: 142 LADAAIAPPLMVRFELAVLAELGFGLDLSACAATGSNAYLAYVSPKSGRAVSAAAGEPWR 201

Query: 181 EKMLVLPSFLWKEE-----QTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFL 233
           +++L LP FL   E      T  A  ++  F LT YFL+++      +     RE F+
Sbjct: 202 DRLLALPDFLVAREAGGTGATPTARDVRQGFTLTGYFLDQHVWAPRGLAPPEARERFV 259


>gi|319407033|emb|CBI80670.1| DNA repair protein RecO [Bartonella sp. 1-1C]
          Length = 248

 Score =  177 bits (449), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 102/230 (44%), Positives = 146/230 (63%), Gaps = 1/230 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W++ AIILG R +GE ++ILE+MTRQ+GR++G V+ G+S RM P+LQ GN V   W +
Sbjct: 1   MKWKEQAIILGTRQHGETSVILEIMTRQHGRYMGIVKGGRSRRMAPLLQPGNFVEAEWWA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG FR E L+ H ++L+     LY LQ +    R LPER+P   LYDML  F+  
Sbjct: 61  RLDEHLGLFRLEALDLHASRLIVLPEALYSLQLMAFYLRLLPERDPHPVLYDMLYFFMQN 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
            + P +  ++ V+ EL+LL+ +GFGLDL+ C VTG  + L +VSPKSG AVC  +G P+ 
Sbjct: 121 FEDPFINAELLVRFELLLLEELGFGLDLSCCAVTGRQEKLYYVSPKSGRAVCEEIGRPWK 180

Query: 181 EKMLVLPSFL-WKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLR 229
           +K+L+LP FL  K    +D + +     LT++FL +Y      I    LR
Sbjct: 181 DKLLLLPKFLVQKNVYPVDFNDISKGLILTNFFLTRYVWDARGIKQSSLR 230


>gi|319404020|emb|CBI77608.1| DNA repair protein RecO [Bartonella rochalimae ATCC BAA-1498]
          Length = 248

 Score =  176 bits (446), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 99/220 (45%), Positives = 143/220 (65%), Gaps = 1/220 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W++ AIILG R +GE ++ILE+MTRQ+GR++G V+ G+S RM P+LQ GN V   W +
Sbjct: 1   MKWKEQAIILGTRQHGETSVILEIMTRQHGRYMGIVKGGRSRRMAPLLQPGNFVEAEWWA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG FR E L  H ++L+     LY LQ +    R LPER+P   LYDML  F+  
Sbjct: 61  RLDEHLGLFRLEALNLHASRLIVLPEALYSLQLMAFYLRLLPERDPHPVLYDMLYFFMQN 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
            + P +  ++ V+ EL+LL+ +GFGLDL+ C VTG  + L +VSPKSG AVC  +G P+ 
Sbjct: 121 FEDPFINAELLVRFELLLLEELGFGLDLSCCAVTGRQEKLYYVSPKSGRAVCEEIGRPWK 180

Query: 181 EKMLVLPSFL-WKEEQTIDADSLKSAFQLTDYFLNKYALQ 219
           +K+L+LP FL  K    +D + +     LT++FL +Y  +
Sbjct: 181 DKLLLLPQFLVQKSVYPVDFNDISKGLILTNFFLTRYVWE 220


>gi|182679932|ref|YP_001834078.1| DNA repair protein RecO [Beijerinckia indica subsp. indica ATCC
           9039]
 gi|238691211|sp|B2IBG3|RECO_BEII9 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|182635815|gb|ACB96589.1| DNA repair protein RecO [Beijerinckia indica subsp. indica ATCC
           9039]
          Length = 250

 Score =  176 bits (445), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 89/217 (41%), Positives = 123/217 (56%), Gaps = 2/217 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W D+ +I+G+R YGE   ILEV T  +GRH G VR G   R++ +LQ GN     WR+
Sbjct: 1   MEWHDEGLIIGLRRYGETGAILEVFTPAHGRHFGLVRGGFGRRLRALLQPGNQADFTWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL Q LG    E  +    +L +S L L G+  I  L R LPER+P  ELY ++ + L  
Sbjct: 61  RLDQQLGLLAVEPTKLMTTRLFASGLALQGMNLIAALLRLLPERDPHPELYAVVRVLLEH 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P+V   +  + EL +L   GFGLDL+ C  TG TQ+L++VSPKSG AV    G PY 
Sbjct: 121 LDEPAVAPILLARFELAMLTETGFGLDLSACAATGATQELIYVSPKSGRAVSARAGAPYH 180

Query: 181 EKMLVLPSFLWKEE--QTIDADSLKSAFQLTDYFLNK 215
           +K+L LP F       +    + +++ F LT +FL +
Sbjct: 181 DKLLGLPPFFLDGSLLKNPTLEEVEAGFALTGHFLMR 217


>gi|154247809|ref|YP_001418767.1| DNA repair protein RecO [Xanthobacter autotrophicus Py2]
 gi|238686793|sp|A7IM67|RECO_XANP2 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|154161894|gb|ABS69110.1| DNA repair protein RecO [Xanthobacter autotrophicus Py2]
          Length = 242

 Score =  175 bits (443), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 88/233 (37%), Positives = 128/233 (54%), Gaps = 1/233 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W D+ I+LGVR +GE N I+E++TR  GRHLG VR G S R  P+LQ GN V   WR+
Sbjct: 1   MEWTDEGIVLGVRRHGEGNAIVELLTRLRGRHLGMVRGGASRRQAPLLQPGNTVSATWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL +++G +  E        L+ +    +G   +  +   LPER+P   L+  +   L+ 
Sbjct: 61  RLDEHMGNYALEPAVVRTEVLMRAPHAAFGFTHMAQILHLLPERDPHEGLFLTVGAILDA 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
            +     G++  + EL LL  +GFGL+L  C  TG  +DL++VSPKSG AVC   G PYA
Sbjct: 121 FENRESAGRLLARFELALLAELGFGLELETCAATGRREDLVYVSPKSGRAVCGEAGAPYA 180

Query: 181 EKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFL 233
           +++  LP FL  +     A  ++ A +LT YFL    L+   +     R  F+
Sbjct: 181 DRLFALPRFL-VDGTAPPAGDVEDALRLTGYFLLTRVLEPRGLGLSDARAAFI 232


>gi|319898694|ref|YP_004158787.1| DNA repair protein RecO [Bartonella clarridgeiae 73]
 gi|319402658|emb|CBI76204.1| DNA repair protein RecO [Bartonella clarridgeiae 73]
          Length = 231

 Score =  171 bits (434), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 99/222 (44%), Positives = 140/222 (63%), Gaps = 1/222 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W++ AIILG R +GE ++ILE+MTRQ GR++G V+ G+S RM  +LQ GN V   W +
Sbjct: 1   MKWKEQAIILGTRQHGETSVILEIMTRQRGRYMGIVKGGRSRRMAFLLQPGNFVEAEWWA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG FR E L+ H ++L+     LY  Q +    R LPER+P   LYDML  F+  
Sbjct: 61  RLDEHLGLFRLEALDLHASRLIVLPEALYSFQLMASHLRLLPERDPHPVLYDMLYFFMQN 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P +  ++ V+ EL+LL+ +GFGLDL+ C VTG  + L +VSPKSG AVC  VG P+ 
Sbjct: 121 FDDPFINAELLVRFELLLLEELGFGLDLSCCAVTGRQEKLCYVSPKSGRAVCEEVGRPWK 180

Query: 181 EKMLVLPSFLWKEE-QTIDADSLKSAFQLTDYFLNKYALQHN 221
           +K+L LP FL ++    +D + +K    LTD+F N   L+  
Sbjct: 181 DKLLFLPQFLARKTICPVDFNDIKKGLILTDFFFNTLCLERE 222


>gi|218660067|ref|ZP_03515997.1| DNA repair protein RecO [Rhizobium etli IE4771]
          Length = 174

 Score =  170 bits (430), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 77/156 (49%), Positives = 110/156 (70%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M WQD AIILGV+ +GE ++I+EVMTR  GRHLG VR+G+S  MQP+LQ GN V V WR+
Sbjct: 19  MQWQDHAIILGVKRHGETSVIVEVMTRDRGRHLGLVRSGRSRAMQPVLQPGNAVEVIWRA 78

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LGEFR E +    A+++ ++  +YG+Q++  L R LPER+P   L+D L + L+ 
Sbjct: 79  RLDEHLGEFRVEPVTLRAARMMETATAVYGVQAMGALLRLLPERDPHPHLFDALEVILDH 138

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGV 156
              P+  G++FV+ EL +L ++GFGLDL +C  TG 
Sbjct: 139 LHNPADAGELFVRFELAVLNDLGFGLDLAECAATGA 174


>gi|114770109|ref|ZP_01447647.1| DNA repair protein RecO [alpha proteobacterium HTCC2255]
 gi|114548946|gb|EAU51829.1| DNA repair protein RecO [alpha proteobacterium HTCC2255]
          Length = 243

 Score =  169 bits (427), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 86/217 (39%), Positives = 131/217 (60%), Gaps = 2/217 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W  + +I+ VR YGE ++I++ +T ++GRHLG VR G S +M   +Q G+ V++ WR+
Sbjct: 1   MEWTSEGVIVSVRKYGENSVIIDTLTPKHGRHLGVVRGGASRKMAATIQPGSQVKLEWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLN 119
           RL ++LG FR E LES  + +    L L  L SI  +  F  PER P  ELY+     ++
Sbjct: 61  RLEEHLGNFRVEQLESR-SDMFDDRLRLAALSSICSIVTFSFPERMPVAELYNSTLNLMD 119

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                     ++   EL +L+ +GFGLDLT C VT VTQDL++VSPKSG AV R     +
Sbjct: 120 TLNTGGDWKPLYALWELQVLEEMGFGLDLTSCAVTNVTQDLIYVSPKSGRAVSRKAAGEW 179

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKY 216
            E++L LPSFL  + +T + + + ++ + T +FL+ +
Sbjct: 180 KERLLPLPSFLRNKFETANHEDILNSLKTTGHFLSSW 216


>gi|254512349|ref|ZP_05124416.1| DNA repair protein RecO [Rhodobacteraceae bacterium KLH11]
 gi|221536060|gb|EEE39048.1| DNA repair protein RecO [Rhodobacteraceae bacterium KLH11]
          Length = 241

 Score =  166 bits (420), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 91/217 (41%), Positives = 125/217 (57%), Gaps = 2/217 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D  I+L  R +GE   I+EV T  +GRH G VR G S ++ PILQ G  + V WR+
Sbjct: 1   MDWRDHGILLTARRHGETAAIIEVFTEGHGRHAGVVRGGTSRKIAPILQPGAQLDVLWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLN 119
           RL +++G F+ E L S  A   S  L L GL ++V L  F LPEREP   +Y      ++
Sbjct: 61  RLEEHIGTFQVEPLRSRAAAAFSGRLALAGLNAVVALLSFCLPEREPHPAIYKQTEQLMD 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                 V    +++ EL LL+ +GFGLDL+ C VTGVT  L++VSPK+G AV R+    +
Sbjct: 121 LLGQDEVWPLAYLRWELALLEELGFGLDLSACAVTGVTDGLVYVSPKTGRAVSRAGAGEW 180

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKY 216
           A+K+L LP  L  E    DA  +  A + T YFL  +
Sbjct: 181 ADKLLPLPPCLRGEGAAPDA-GIAEALRTTGYFLENH 216


>gi|254485777|ref|ZP_05098982.1| DNA repair protein RecO [Roseobacter sp. GAI101]
 gi|214042646|gb|EEB83284.1| DNA repair protein RecO [Roseobacter sp. GAI101]
          Length = 241

 Score =  164 bits (415), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 91/217 (41%), Positives = 122/217 (56%), Gaps = 2/217 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D  I+L  R +GE + I+EV T   GRH G VR G S ++ PILQ G  + V WR+
Sbjct: 1   MEWRDQGILLSARRHGETSAIIEVFTPTQGRHAGIVRGGTSRKIAPILQPGAQLDVAWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLN 119
           RL  ++G F  E + S     +S  L L GL ++  L  F LPEREP   LY      L+
Sbjct: 61  RLEGHIGAFTVEPVRSRAVSAMSDRLSLAGLNTVTALLSFCLPEREPHPPLYHRTQALLD 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                 +    ++Q EL LL+ +G+GLDLT C VTG T  L++VSPKSG AV R     +
Sbjct: 121 LLDQGDLWPLAYLQWELSLLEEMGYGLDLTACAVTGATDALVFVSPKSGRAVTREGAGEW 180

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKY 216
           A+KML LP  L  E +  D D +   F+ T YFL ++
Sbjct: 181 ADKMLPLPPVLLGEGEARD-DEILQGFKTTGYFLEQH 216


>gi|114570118|ref|YP_756798.1| DNA repair protein RecO [Maricaulis maris MCS10]
 gi|114340580|gb|ABI65860.1| DNA repair protein RecO [Maricaulis maris MCS10]
          Length = 234

 Score =  162 bits (411), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 83/211 (39%), Positives = 123/211 (58%), Gaps = 2/211 (0%)

Query: 9   ILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQNLGE 68
           +L VR +GE + I+EV+T + GRH G VR  +S  M+PILQ GN + VNWR+RL+++LG 
Sbjct: 1   MLAVRPHGETSAIVEVLTAEQGRHAGLVRGARSRSMRPILQPGNQITVNWRARLSEHLGM 60

Query: 69  FRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLNCHKIPSVI 127
           F+ E  +     ++     L GL S   +    LPERE    ++    + L     P + 
Sbjct: 61  FQIEADDLTAGMVMEDRTALAGLNSACAIAVMGLPEREAHPRVHQGFQLLLGAFDNPDIW 120

Query: 128 GKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKMLVLP 187
             ++V+ E  LL ++G+GLD++ C VTGVT+DL  +SP++G AVCR    PYA K+L LP
Sbjct: 121 PALYVRWEAGLLSDLGYGLDMSACAVTGVTEDLTHISPRTGRAVCREEAAPYAPKLLELP 180

Query: 188 SFLWKEEQTIDADSLKSAFQLTDYFLNKYAL 218
            F+    + I+A  +     LT YFL +  L
Sbjct: 181 PFMAGSGK-IEAGDIARGLALTGYFLERRVL 210


>gi|83858198|ref|ZP_00951720.1| DNA repair protein RecO [Oceanicaulis alexandrii HTCC2633]
 gi|83853021|gb|EAP90873.1| DNA repair protein RecO [Oceanicaulis alexandrii HTCC2633]
          Length = 242

 Score =  162 bits (410), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 82/219 (37%), Positives = 124/219 (56%), Gaps = 2/219 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W     I+ VR +GE + ++EV+T ++GRH G VR G+S  M+PILQ GN +R  WR+
Sbjct: 1   MEWTASGRIVAVRPHGETSAVIEVLTAEHGRHAGLVRGGRSKAMRPILQPGNRIRAVWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLN 119
           RL  +LG F  E  +     L+   L L GL +   +    LPERE    + D   + ++
Sbjct: 61  RLESHLGGFAVEAEDLSAGVLMEDPLALSGLNAACAMASICLPEREEHPAVADAFEVLIS 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
             + P +   ++V+ E  LL ++G+GLDL +C  TGV   L++VSPKSG AV    G PY
Sbjct: 121 ALEDPDLWPALYVRWEAGLLADLGYGLDLRRCAATGVETGLVYVSPKSGRAVSAEAGEPY 180

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYAL 218
            ++ML LP F+    Q  + D + +  +LT +F+ +  L
Sbjct: 181 RDRMLALPGFMKGGGQVSEGD-VGAGLKLTAHFIERRVL 218


>gi|56698028|ref|YP_168399.1| DNA repair protein RecO [Ruegeria pomeroyi DSS-3]
 gi|61214680|sp|Q5LNK7|RECO_SILPO RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|56679765|gb|AAV96431.1| DNA repair protein RecO, putative [Ruegeria pomeroyi DSS-3]
          Length = 241

 Score =  162 bits (409), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 94/241 (39%), Positives = 135/241 (56%), Gaps = 5/241 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D  I+L VR +GE + I++  T  +GRH G VR G S R+ PILQ G  + ++WR+
Sbjct: 1   MDWRDQGILLAVRRHGETSAIIDTFTASHGRHAGVVRGGTSRRIAPILQPGAQLDLSWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLN 119
           RL  +LG F  E L S  A  +S  L L GL ++V L  F LPERE    LY      L+
Sbjct: 61  RLEDHLGSFTVEPLRSRAAAAMSGRLALAGLNAVVSLLSFCLPEREAHPRLYKQSEQLLD 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                 +    +++ EL LL  +GFGLDL+ C VTG + DL++VSP+SG AV       +
Sbjct: 121 LLGQDEIWPLAYLRWELALLDTLGFGLDLSSCAVTGNSDDLVYVSPRSGRAVSAGAAGEW 180

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLEL 239
           AE++L LP  L  E    D + +  A + T +FL ++ +   + H  L +    G+LL+L
Sbjct: 181 AERLLPLPPCLRGEGPAPDPE-IAQALRTTGHFL-EHRVAPALGHAPLPQAR--GRLLDL 236

Query: 240 I 240
           I
Sbjct: 237 I 237


>gi|254461391|ref|ZP_05074807.1| DNA repair protein RecO [Rhodobacterales bacterium HTCC2083]
 gi|206677980|gb|EDZ42467.1| DNA repair protein RecO [Rhodobacteraceae bacterium HTCC2083]
          Length = 244

 Score =  160 bits (404), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 85/216 (39%), Positives = 124/216 (57%), Gaps = 2/216 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D  I+L VR +GE N I++V T ++GRH G VR G S ++ PILQ G  + V+WR+
Sbjct: 1   MEWRDQGILLSVRRHGETNAIIDVFTIEHGRHAGIVRGGTSRKIAPILQPGAQLDVSWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLN 119
           RL  +LG +  E L S  A  L   L L GL ++  L  F LPERE    LY      L+
Sbjct: 61  RLEDHLGTYTVEPLRSRAAAALGDRLSLAGLNAVTALLAFALPEREANTRLYKQSEQLLD 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                 V    +++ E+ LL+  G GLDL+ C VTG  ++L+++SP++G AV   V  P+
Sbjct: 121 LLGQHEVWPLAYLRFEMALLEACGMGLDLSACAVTGTNENLIYISPRTGRAVSEQVAGPW 180

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNK 215
             K+L LP  L  +    DA+ ++ A + T YFL++
Sbjct: 181 VNKLLPLPPILIGQGMGSDAE-IEQALRTTGYFLSQ 215


>gi|260432760|ref|ZP_05786731.1| DNA repair protein RecO [Silicibacter lacuscaerulensis ITI-1157]
 gi|260416588|gb|EEX09847.1| DNA repair protein RecO [Silicibacter lacuscaerulensis ITI-1157]
          Length = 241

 Score =  159 bits (403), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 86/214 (40%), Positives = 122/214 (57%), Gaps = 2/214 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D  I+L  R +GE   I+EV T  +GRH G VR G S ++ PILQ G  + V WR+
Sbjct: 1   MDWRDHGILLTARRHGETAAIIEVFTETHGRHAGVVRGGASRKIAPILQPGAQLDVLWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFR-FLPEREPCLELYDMLNIFLN 119
           RL +++G F+ E L S  A   S  L L GL ++V L   FLPEREP   +Y      ++
Sbjct: 61  RLQEHIGTFQVEPLRSRAAAAFSGRLALSGLNAVVALLSFFLPEREPHPGIYRQTEQLMD 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                 +    +++ EL LL+ +GFGLDLT+C VTG T+ L +VSPK+G AV       +
Sbjct: 121 LLGQDEIWPLAYLRWELALLEELGFGLDLTRCAVTGTTEGLAYVSPKTGRAVSAEGAGDW 180

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFL 213
           A+++L LP  L  +    D D + +  + T YFL
Sbjct: 181 ADRLLPLPPVLRGQGGAPD-DEIAAGLRTTGYFL 213


>gi|300023747|ref|YP_003756358.1| DNA repair protein RecO [Hyphomicrobium denitrificans ATCC 51888]
 gi|299525568|gb|ADJ24037.1| DNA repair protein RecO [Hyphomicrobium denitrificans ATCC 51888]
          Length = 239

 Score =  159 bits (403), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 87/219 (39%), Positives = 128/219 (58%), Gaps = 1/219 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W D+AI+L V+ +GE   ++E+ TR +GRHLG V  G+S R++PILQ GN V   W++
Sbjct: 1   MQWTDEAIVLSVKPHGETAAVIELWTRTHGRHLGLVHGGRSRRLRPILQPGNHVDATWKA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL+  LG    E+  +  A+ L  +  L  L ++  L   LPER+P   LY++    L  
Sbjct: 61  RLSDQLGHVTIEMRRAFAAETLDDAAALAALSTLTTLTHLLPERDPHPNLYEITLFVLGF 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
               +V   + V+ EL LL+ +GFGLDL++C  TG    L++VSP++G AV  S G PY 
Sbjct: 121 LNDATVWPALLVRWELALLEELGFGLDLSQCAATGSNDQLIYVSPRTGRAVSASAGEPYR 180

Query: 181 EKMLVLPSFLWKEEQT-IDADSLKSAFQLTDYFLNKYAL 218
           +K+L LP+FL K     +  D ++  F LT +FL    L
Sbjct: 181 DKLLPLPAFLTKHRSGHVTEDDIRLGFALTGHFLETRVL 219


>gi|302383088|ref|YP_003818911.1| DNA repair protein RecO [Brevundimonas subvibrioides ATCC 15264]
 gi|302193716|gb|ADL01288.1| DNA repair protein RecO [Brevundimonas subvibrioides ATCC 15264]
          Length = 243

 Score =  159 bits (402), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 77/217 (35%), Positives = 123/217 (56%), Gaps = 1/217 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M + ++A +L  R++G+  ++++++T  +GRH  +V  G S RM+P LQAG  V  ++R+
Sbjct: 1   MEFHEEAFVLSARAHGDTGVVVDLLTETHGRHAAYVAGGASRRMKPFLQAGARVIADYRA 60

Query: 61  RLAQNLGEFRFE-VLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLN 119
           R + +LG  R E V E   A             +       LPEREP    +      ++
Sbjct: 61  RTSDHLGSARLEPVGEGPSALFDDGLALAGLSAAAAVAQGALPEREPHPGAFLAFEALMS 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
             +IP+V   IFV+ E  LL+++GFGLDL++C VTG   DL+WVSP++G +V  S G PY
Sbjct: 121 AFQIPAVWPAIFVRFEAGLLEDLGFGLDLSRCAVTGTMDDLVWVSPRTGRSVSASAGAPY 180

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKY 216
           A+K+L LP F+   +  +    +K    LT +FL ++
Sbjct: 181 ADKLLKLPPFMLGAQAGLRDGDVKDGLDLTGHFLEQF 217


>gi|254466686|ref|ZP_05080097.1| DNA repair protein RecO [Rhodobacterales bacterium Y4I]
 gi|206687594|gb|EDZ48076.1| DNA repair protein RecO [Rhodobacterales bacterium Y4I]
          Length = 241

 Score =  159 bits (401), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 86/217 (39%), Positives = 123/217 (56%), Gaps = 2/217 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D  I+L VR +GE + I++V T  +GRH G VR G   RM PILQ G  + V WR+
Sbjct: 1   MEWRDHGILLSVRRHGESSAIIDVFTEGHGRHAGVVRGGAGRRMAPILQPGAQLDVTWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLN 119
           RL  +LG +  E L S  A  LS  L L GL ++  L  F LPEREP  +LY      L+
Sbjct: 61  RLEDHLGSYHAEPLRSRAAAALSGRLALAGLNTVTALLSFCLPEREPHPDLYTRSEQLLD 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                 +    +++ EL LL+ +GFGLDL+ C VTG    L ++SPK+G AV R     +
Sbjct: 121 LLGNEDLWPLAYLRWELALLEEMGFGLDLSACAVTGSRFGLAYISPKTGRAVSREGAGDW 180

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKY 216
           A+++L LP  +  +    DA+ ++ A + T +FL  +
Sbjct: 181 ADRLLPLPPVMLGQGSAADAEIVQ-ALRATGFFLEAH 216


>gi|209964784|ref|YP_002297699.1| DNA repair protein RecO, putative [Rhodospirillum centenum SW]
 gi|238058647|sp|B6IMY9|RECO_RHOCS RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|209958250|gb|ACI98886.1| DNA repair protein RecO, putative [Rhodospirillum centenum SW]
          Length = 250

 Score =  157 bits (397), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 89/234 (38%), Positives = 126/234 (53%), Gaps = 7/234 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W DDAI+L  R +GE   +  ++TR +GRH G V  GQS RM+P+L+ GN V   W +
Sbjct: 1   MEWTDDAIVLSARPHGETAALAVLLTRGHGRHAGLVHGGQSGRMRPVLEPGNRVAARWAA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLF-RFLPEREPCLELYDMLNIFLN 119
           RL + LG    E+  +  A LL   L L  L S   L    LPEREP   L+D      +
Sbjct: 61  RLVEQLGTLALELERATAAGLLEDPLRLAALSSACALVDAALPEREPHPALFDATLALFD 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQD--LLWVSPKSGGAVCRSVGL 177
             +   V  +I+V+ E+ LL+  GFGLD   C  TG+T +  L +VSP++G AV  S G 
Sbjct: 121 ALQT-EVWAEIYVRWEIGLLEEAGFGLDFGSCAATGITDNDQLAYVSPRTGRAVSLSAGE 179

Query: 178 PYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNK--YALQHNIIHCHLLR 229
           PY +++L LP FL        A+ +     LT +FL++  +AL+H  +     R
Sbjct: 180 PYRDRLLALPPFLVGRSAG-GAEEVVQGLALTGHFLDRHLFALRHAEVPAARTR 232


>gi|154253316|ref|YP_001414140.1| DNA repair protein RecO [Parvibaculum lavamentivorans DS-1]
 gi|154157266|gb|ABS64483.1| DNA repair protein RecO [Parvibaculum lavamentivorans DS-1]
          Length = 234

 Score =  157 bits (397), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 82/209 (39%), Positives = 121/209 (57%), Gaps = 1/209 (0%)

Query: 9   ILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQNLGE 68
           +L  R++GE   ILE+ TR+ GRHLG V  G   RM+ +LQ GN +  +WR RL+++LG 
Sbjct: 1   MLSARAHGETGAILELFTREQGRHLGLVHGGAGRRMRSVLQPGNKLAAHWRGRLSEHLGT 60

Query: 69  FRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPSVIG 128
           ++ E+++     L+   L L GL +   +   LPERE    LYD   + L+  +   V  
Sbjct: 61  YQVELVKPLAGLLMDDPLALLGLSAASAICSILPEREAHPALYDGYEVLLDTMRDEDVWP 120

Query: 129 KIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKMLVLPS 188
            +FV+ EL LL+ +GFGLDLT+C  TG   DL +VSP+SG AV R  G  Y E++  LP 
Sbjct: 121 AVFVRWELGLLQELGFGLDLTQCAATGSRDDLAYVSPRSGSAVSRGAGEIYKERLFRLPG 180

Query: 189 FL-WKEEQTIDADSLKSAFQLTDYFLNKY 216
           FL   +    +A  +    +LT +FL ++
Sbjct: 181 FLVGSQAGAAEAADVAEGLRLTGHFLERH 209


>gi|312115948|ref|YP_004013544.1| DNA repair protein RecO [Rhodomicrobium vannielii ATCC 17100]
 gi|311221077|gb|ADP72445.1| DNA repair protein RecO [Rhodomicrobium vannielii ATCC 17100]
          Length = 241

 Score =  153 bits (387), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 77/187 (41%), Positives = 107/187 (57%), Gaps = 1/187 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W DD I L  R +GE ++I ++ TR  GR  G V+ G+S R++P+LQ GN + V WR+
Sbjct: 1   MRWADDGIFLAGRPHGETSVIADIFTRANGRAKGLVKGGRSRRLRPLLQTGNTLGVEWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL   LG +  E+  +  A  L     L G+ ++  L + L ER+P   LYD     L  
Sbjct: 61  RLDDQLGVYTVELARATAANALDDPSALAGMTALAALLQVLAERDPHPALYDAAQDCL-A 119

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
           H   +     F++ EL  L  +GFGL+L  C  TG   DL++VSPKSG AVCR  G PYA
Sbjct: 120 HASDASFPAAFIRFELRFLNELGFGLNLATCAATGRADDLIYVSPKSGQAVCREAGEPYA 179

Query: 181 EKMLVLP 187
           +++L LP
Sbjct: 180 DRLLPLP 186


>gi|83941547|ref|ZP_00954009.1| DNA repair protein RecO, putative [Sulfitobacter sp. EE-36]
 gi|83847367|gb|EAP85242.1| DNA repair protein RecO, putative [Sulfitobacter sp. EE-36]
          Length = 245

 Score =  153 bits (386), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 86/217 (39%), Positives = 120/217 (55%), Gaps = 2/217 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D  I+L  R +GE + I+EV T + GRH G VR G S ++ PILQ G  + + WR+
Sbjct: 1   MEWRDQGILLSARRHGETSAIIEVFTPERGRHAGIVRGGTSRKIAPILQPGAQLDIAWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLN 119
           RL  ++G F  E + S  A  +   L L GL ++  L  F LPERE    LY      L+
Sbjct: 61  RLEDHIGAFTVEPVRSRAALAMHDRLSLAGLNAVTGLLAFALPEREAHAPLYRRTEALLD 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                 +    ++Q E+ LL  +G+GLDL+ C VTG T  L++VSPK+G AV R     +
Sbjct: 121 LLGQGDLWPLAYLQWEISLLDELGYGLDLSACAVTGRTSGLVFVSPKTGRAVTREGAGEW 180

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKY 216
            +KML L   L  E    DAD +  AF+ T YFL ++
Sbjct: 181 VDKMLPLSPVLRGEGDASDAD-IALAFKTTGYFLERH 216


>gi|163793044|ref|ZP_02187020.1| GTP-binding protein Era [alpha proteobacterium BAL199]
 gi|159181690|gb|EDP66202.1| GTP-binding protein Era [alpha proteobacterium BAL199]
          Length = 253

 Score =  152 bits (385), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 78/218 (35%), Positives = 122/218 (55%), Gaps = 5/218 (2%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRL 62
           W D+ I+L  +++GE + I+ ++TR +GRH G VR   S R + + Q GN V   WR+RL
Sbjct: 4   WTDEGIVLAAKAHGEGSAIVVLLTRDHGRHAGLVRGAFSGRARGVYQPGNRVTAEWRARL 63

Query: 63  AQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLNCH 121
           A +LG +  E+   H A +L   L L GL +   +    LPEREP  +++D L   L+  
Sbjct: 64  ADHLGNYTCELGHGHAAAVLDDPLKLAGLSAACAIAEASLPEREPHPQVHDGLVALLDAM 123

Query: 122 KIPSVIG---KIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
             P +      ++V+ E+ +L ++G+GLDL  C  TG   DL +VSP++G AV  + G P
Sbjct: 124 AEPELGDAWIAVYVRWEIGVLADLGYGLDLESCAATGANDDLAYVSPRTGRAVSLAAGEP 183

Query: 179 YAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKY 216
           Y +++L LP FL       D D L     L+ +F+ ++
Sbjct: 184 YRDRLLSLPRFLIGRGGG-DQDDLFRGLALSGFFMERH 220


>gi|83855024|ref|ZP_00948554.1| DNA repair protein RecO [Sulfitobacter sp. NAS-14.1]
 gi|83842867|gb|EAP82034.1| DNA repair protein RecO [Sulfitobacter sp. NAS-14.1]
          Length = 245

 Score =  152 bits (384), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 86/217 (39%), Positives = 120/217 (55%), Gaps = 2/217 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D  I+L  R +GE + I+EV T + GRH G VR G S ++ PILQ G  + + WR+
Sbjct: 1   MEWRDQGILLSARRHGETSAIIEVFTPERGRHAGIVRGGTSRKIAPILQPGAQLDIAWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLN 119
           RL  ++G F  E + S  A  +   L L GL ++  L  F LPERE    LY      L+
Sbjct: 61  RLEDHIGAFTVEPVRSRAALAMHDRLSLAGLNAVTGLLAFALPEREAHPPLYRRTEALLD 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                 +    ++Q E+ LL  +G+GLDL+ C VTG T  L++VSPK+G AV R     +
Sbjct: 121 LLGQGDLWPLAYLQWEISLLDELGYGLDLSACAVTGRTSGLVFVSPKTGRAVTREGAGEW 180

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKY 216
            +KML L   L  E    DAD +  AF+ T YFL ++
Sbjct: 181 VDKMLPLSPVLRGEGDASDAD-IALAFKTTGYFLERH 216


>gi|254420124|ref|ZP_05033848.1| DNA repair protein RecO [Brevundimonas sp. BAL3]
 gi|196186301|gb|EDX81277.1| DNA repair protein RecO [Brevundimonas sp. BAL3]
          Length = 243

 Score =  151 bits (382), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 75/217 (34%), Positives = 121/217 (55%), Gaps = 1/217 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M + ++A +L  R++G+   +++++T  +GR   +V  G S +M+P LQAG  V  ++R+
Sbjct: 1   MDFHEEAFVLSARAHGDTGAVVDLLTESHGRRAAYVAGGASRKMRPFLQAGARVVADYRA 60

Query: 61  RLAQNLGEFRFE-VLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLN 119
           R + +LG  R E V E   A    +        +       LPEREP   ++      + 
Sbjct: 61  RTSDHLGGARLEPVGEGPSALFDDALALTGLAAAAGVAQGALPEREPHPGVFLAFEALMA 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
              +P V   IFV+ E  LL+++GFGLDL+KC  TG   DL++VSP++G AV R  G PY
Sbjct: 121 AFALPDVWPAIFVRFEAGLLEDLGFGLDLSKCAATGTADDLIYVSPRTGRAVSREAGAPY 180

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKY 216
           A+KML LP F+   +  +    +++ F LT +FL ++
Sbjct: 181 ADKMLSLPPFMLGAQAGLVEGDVRAGFDLTGHFLEQF 217


>gi|315499944|ref|YP_004088747.1| DNA repair protein reco [Asticcacaulis excentricus CB 48]
 gi|315417956|gb|ADU14596.1| DNA repair protein RecO [Asticcacaulis excentricus CB 48]
          Length = 239

 Score =  150 bits (380), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 76/217 (35%), Positives = 118/217 (54%), Gaps = 1/217 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M ++DDA +L  R +GE   ++  +T ++G     V  G S R++P LQ  + VR+++R+
Sbjct: 1   MTFEDDAFVLSARPHGETGAVVHFLTLEHGHIAAHVPGGASRRLKPYLQPASRVRLSYRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFR-FLPEREPCLELYDMLNIFLN 119
           R A  LG    E      A++    + L G+Q    + R  LPERE     +      +N
Sbjct: 61  RTADQLGSATLEPEGDATAEIFDDPMALIGVQCACVMTRAVLPEREAYPGAFYAFETLIN 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
              +P V   ++V+ E+ LL+ +GFGLDL+ C V+G   DL +VSP+S  AV R  G PY
Sbjct: 121 AFGLPGVWPYVYVRFEMGLLEAVGFGLDLSACAVSGSRDDLAYVSPRSARAVSRREGEPY 180

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKY 216
            +K+L LP FL   +  + AD L+    LT +FL ++
Sbjct: 181 KDKLLPLPGFLLSSQGGVQADDLRRGLDLTGFFLERH 217


>gi|163740179|ref|ZP_02147573.1| DNA repair protein RecO [Phaeobacter gallaeciensis 2.10]
 gi|161386037|gb|EDQ10412.1| DNA repair protein RecO [Phaeobacter gallaeciensis 2.10]
          Length = 241

 Score =  150 bits (379), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 81/216 (37%), Positives = 123/216 (56%), Gaps = 2/216 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D+ I+L +R +GE   I++  T ++GRH G VR G   RM P+LQ G  + + WR+
Sbjct: 1   MEWRDEGILLTMRRHGESAAIVDAFTAEHGRHAGIVRGGAGRRMAPVLQPGAQLDLTWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLN 119
           RL  +LG ++ E++ S  A  +SS L L GL ++  L  F LPERE   ELY      L+
Sbjct: 61  RLEDHLGSYQAELIRSRAATAMSSRLALAGLNAVTALLAFCLPEREAHPELYLRSTQILD 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                 +    +++ E+ LL+ +GFGL+  +C VTG   DL++VSPKSG AV R     +
Sbjct: 121 LLGRDDIWPLAYLRWEVALLEEMGFGLEFEQCAVTGSRLDLIYVSPKSGRAVSRRGAGEW 180

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNK 215
           A++ML LP  L       +++ + +A   T +FL  
Sbjct: 181 ADRMLPLPPVLMGRGGAENSE-IVTALSTTGFFLQN 215


>gi|163738241|ref|ZP_02145657.1| DNA repair protein RecO [Phaeobacter gallaeciensis BS107]
 gi|161388857|gb|EDQ13210.1| DNA repair protein RecO [Phaeobacter gallaeciensis BS107]
          Length = 241

 Score =  150 bits (379), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 81/216 (37%), Positives = 123/216 (56%), Gaps = 2/216 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D+ I+L +R +GE   I++  T ++GRH G VR G   RM P+LQ G  + + WR+
Sbjct: 1   MEWRDEGILLTMRRHGESAAIVDAFTAEHGRHAGIVRGGAGRRMAPVLQPGAQLDLTWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLN 119
           RL  +LG ++ E++ S  A  +SS L L GL ++  L  F LPERE   ELY      L+
Sbjct: 61  RLEDHLGSYQAELIRSRAATAMSSRLALAGLNAVTALLAFCLPEREAHPELYLRSTQILD 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                 +    +++ E+ LL+ +GFGL+  +C VTG   DL++VSPKSG AV R     +
Sbjct: 121 LLGRDDIWPLAYLRWEVALLEEMGFGLEFEQCAVTGSRLDLIYVSPKSGRAVSRRGAGEW 180

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNK 215
           A++ML LP  L       +++ + +A   T +FL  
Sbjct: 181 ADRMLPLPPVLMGRGGAENSE-IVTALSTTGFFLQN 215


>gi|255263314|ref|ZP_05342656.1| DNA repair protein RecO [Thalassiobium sp. R2A62]
 gi|255105649|gb|EET48323.1| DNA repair protein RecO [Thalassiobium sp. R2A62]
          Length = 242

 Score =  150 bits (379), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 81/215 (37%), Positives = 120/215 (55%), Gaps = 2/215 (0%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRL 62
           W+D+  +L VR +GE   I+E+ T ++GRH G VR G S ++ PILQ G  + V W++RL
Sbjct: 4   WRDEGALLSVRRHGESAAIVEIFTAEHGRHAGIVRGGTSRKIAPILQPGAQLDVVWKARL 63

Query: 63  AQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLNCH 121
            ++LG F  E + S  A ++S  L L GL ++  L  F +PERE    LY    + ++  
Sbjct: 64  EEHLGSFSVEPVRSRAAAVMSDRLALAGLNAVCALLAFAMPEREAHPSLYRQSTVLMDLL 123

Query: 122 KIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAE 181
                    +++ EL LL+ +GFGLDL  C VTG  + L +VSPKSG AV       +A+
Sbjct: 124 GNTDAWPLAYLRWELALLEELGFGLDLGSCAVTGSVEGLCYVSPKSGRAVSAEGAGEWAD 183

Query: 182 KMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKY 216
           ++L LP  L       DA+ L+   + T YFL  +
Sbjct: 184 RLLPLPDVLLGVGSAPDAEILQ-GLETTGYFLEHW 217


>gi|163744852|ref|ZP_02152212.1| DNA repair protein RecO [Oceanibulbus indolifex HEL-45]
 gi|161381670|gb|EDQ06079.1| DNA repair protein RecO [Oceanibulbus indolifex HEL-45]
          Length = 240

 Score =  150 bits (379), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 84/217 (38%), Positives = 120/217 (55%), Gaps = 3/217 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D  I+L  R +GE + I+EV T + GRH G VR G S ++ P LQ G  + + WR+
Sbjct: 1   MEWRDQGILLSARRHGETSAIIEVFTPEQGRHAGIVRGGTSRKIAPSLQPGAQLDLAWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLN 119
           RL  ++G F  E L S  A  +   L L GL ++  L  F LPEREP   LY      L+
Sbjct: 61  RLEDHIGAFTVEPLRSRAAVAMQDRLALAGLNAVTALLSFCLPEREPHPALYRRTETLLD 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                 V    +++ EL LL+ +G+ LDL  C VTGV++DL++VSPKSG AV       +
Sbjct: 121 MLGQGDVWPLAYLKWELRLLEEMGYALDLESCAVTGVSEDLIYVSPKSGRAVSAKGAGEW 180

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKY 216
           AE++L LP+ L +     DA+ +      T +FL  +
Sbjct: 181 AERLLPLPAVL-RGGAGSDAE-IAQGLVTTGHFLTAH 215


>gi|89070889|ref|ZP_01158124.1| DNA repair protein RecO, putative [Oceanicola granulosus HTCC2516]
 gi|89043528|gb|EAR49739.1| DNA repair protein RecO, putative [Oceanicola granulosus HTCC2516]
          Length = 239

 Score =  150 bits (379), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 83/217 (38%), Positives = 119/217 (54%), Gaps = 2/217 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D  ++L  R +GE  +I EV T   GRH G VR G+S ++ P+LQ G  V V W +
Sbjct: 1   MQWRDGGVLLARRGHGESGVIAEVFTETRGRHAGLVRGGRSKQLAPVLQPGEQVEVTWTA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLN 119
           RL ++LG +R E L S  A +++  L L GL +I  L  F LPEREP   LY      L+
Sbjct: 61  RLEEHLGAYRVEPLRSRAALVMNDRLALAGLNAICGLLAFALPEREPHPALYARSVTLLD 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                      ++  EL LL+ +GFGLDL+ C VTG    L +VSP++G AV  +    +
Sbjct: 121 LLGRTDAWPLAYLHWELALLEELGFGLDLSSCAVTGAEDGLAFVSPRTGRAVSAAGAGEW 180

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKY 216
           A ++L LP  L  +    DA+ L+   + T +FL  +
Sbjct: 181 AGRLLPLPPALRGQGPGPDAEILEG-LRTTGHFLATW 216


>gi|149913474|ref|ZP_01902007.1| DNA repair protein RecO [Roseobacter sp. AzwK-3b]
 gi|149812594|gb|EDM72423.1| DNA repair protein RecO [Roseobacter sp. AzwK-3b]
          Length = 244

 Score =  149 bits (376), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 81/218 (37%), Positives = 122/218 (55%), Gaps = 3/218 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D  I+L  R++GE ++I+EV T ++GRH G VR G S ++ P+LQ G  + + WR+
Sbjct: 1   MEWRDQGILLSTRTHGETSVIIEVFTPEHGRHAGVVRGGTSRKLAPVLQPGAQLDLRWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLN 119
           RL  ++G F  E + S  A  +   L L GL ++  L  F LP+RE    LY      L+
Sbjct: 61  RLEDHIGTFTVEPVRSRAAASMGDRLSLAGLNAVTALLLFCLPDREAHRRLYRRTEALLD 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGV-TQDLLWVSPKSGGAVCRSVGLP 178
                 V    ++  E+ LL  +GFGLDL+ C V G    DL +VSP+SG AV R+    
Sbjct: 121 LLGQGDVWPLAYLNWEMALLDEMGFGLDLSGCAVMGPQANDLSYVSPRSGRAVSRAGAGE 180

Query: 179 YAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKY 216
           +A+++L LP+ L       DA+ +   FQ+T +FL  +
Sbjct: 181 WADRLLPLPACLLGAGPAPDAE-VAEGFQVTGHFLQNH 217


>gi|221641177|ref|YP_002527439.1| DNA repair protein RecO [Rhodobacter sphaeroides KD131]
 gi|332560104|ref|ZP_08414426.1| DNA repair protein RecO [Rhodobacter sphaeroides WS8N]
 gi|254764657|sp|B9KSB0|RECO_RHOSK RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|221161958|gb|ACM02938.1| DNA repair protein recO [Rhodobacter sphaeroides KD131]
 gi|332277816|gb|EGJ23131.1| DNA repair protein RecO [Rhodobacter sphaeroides WS8N]
          Length = 239

 Score =  149 bits (375), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 82/216 (37%), Positives = 122/216 (56%), Gaps = 4/216 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D+  +L VR +GE + I+EV T  +GRH G VR G S ++ PILQ G  + + W++
Sbjct: 2   MEWRDEGALLSVRRHGESSAIIEVFTAAHGRHAGVVRGGASRKIAPILQPGAQLDLTWKA 61

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLN 119
           RL +++G F  E L S  A LL   L L GL +I  +    LPEREP   L+      L+
Sbjct: 62  RLDEHMGAFTVEPLRSRTA-LLGDRLGLAGLNAICAMLHVTLPEREPHSTLWQESMALLD 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
               P      +++ E+ LL+  GFGLDLT+C VTG  +DL +VSPK+G AV R     +
Sbjct: 121 ALDRPGWP-PAYLRWEMRLLEETGFGLDLTRCAVTGSREDLAFVSPKTGRAVSRGAAGGW 179

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNK 215
           A+++  LP  L   +    A+ ++    +T +FL +
Sbjct: 180 ADRLFPLPLALLG-QGPASAEEVRQGLAITGHFLGR 214


>gi|126461085|ref|YP_001042199.1| DNA repair protein RecO [Rhodobacter sphaeroides ATCC 17029]
 gi|166221908|sp|A3PGG1|RECO_RHOS1 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|126102749|gb|ABN75427.1| DNA repair protein RecO [Rhodobacter sphaeroides ATCC 17029]
          Length = 239

 Score =  149 bits (375), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 82/216 (37%), Positives = 122/216 (56%), Gaps = 4/216 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D+  +L VR +GE + I+EV T  +GRH G VR G S ++ PILQ G  + + W++
Sbjct: 2   MEWRDEGALLSVRRHGESSAIIEVFTAAHGRHAGVVRGGASRKIAPILQPGAQLDLTWKA 61

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLN 119
           RL +++G F  E L S  A LL   L L GL +I  +    LPEREP   L+      L+
Sbjct: 62  RLDEHMGAFTVEPLRSRTA-LLGDRLGLAGLNAICAMLHVTLPEREPHSTLWQESMALLD 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
               P      +++ E+ LL+  GFGLDLT+C VTG  +DL +VSPK+G AV R     +
Sbjct: 121 ALDRPGWP-PAYLRWEMRLLEETGFGLDLTRCAVTGSREDLAFVSPKTGRAVSRGAAGGW 179

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNK 215
           A+++  LP  L   +    A+ ++    +T +FL +
Sbjct: 180 ADRLFPLPLALLG-QGPASAEEVRQGLAITGHFLGR 214


>gi|254476248|ref|ZP_05089634.1| DNA repair protein RecO [Ruegeria sp. R11]
 gi|214030491|gb|EEB71326.1| DNA repair protein RecO [Ruegeria sp. R11]
          Length = 241

 Score =  148 bits (374), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 78/215 (36%), Positives = 125/215 (58%), Gaps = 2/215 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D  I+L +R +GE + I+++ T ++GRH G +R G S +M PILQ G  + + WR+
Sbjct: 1   MEWRDQGILLRMRRHGEGSAIVDMFTAEHGRHAGVIRGGASRKMAPILQPGAQLDLLWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLN 119
           RL  +LG ++ E++ S     LS  L L GL ++  L  F LP+REP  +LY      L+
Sbjct: 61  RLEDHLGSYQAELMRSRAGAALSGRLALAGLNAVTGLLAFCLPDREPHPDLYLRSERLLD 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                 +    ++Q E+ LL+ +GFGLDL+ C V+G   +L+++SPKSG AV R+    +
Sbjct: 121 LLGQDEIWPLAYLQWEMALLEELGFGLDLSCCAVSGALDELIYISPKSGRAVSRASAGEW 180

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLN 214
           A ++L LP+ +  E +    + L+     T +FL 
Sbjct: 181 AHRLLPLPAVMRGEGEAGTGEILQ-GLSTTGFFLE 214


>gi|149200802|ref|ZP_01877777.1| DNA repair protein RecO [Roseovarius sp. TM1035]
 gi|149145135|gb|EDM33161.1| DNA repair protein RecO [Roseovarius sp. TM1035]
          Length = 244

 Score =  148 bits (373), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 84/218 (38%), Positives = 124/218 (56%), Gaps = 4/218 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D  I+L  R +GE ++I+EV T + GRH G VR G S +M P+LQ G  + + WR+
Sbjct: 1   MDWRDQGILLNSRRHGESSVIIEVFTPERGRHAGVVRGGASRKMAPVLQPGAQLDLEWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLN 119
           RL  ++G FR E L+S  A  +   + L GL ++  L  F LPERE   ELY    I L+
Sbjct: 61  RLEDHIGTFRVEPLKSR-AWTMGDRMALAGLNAVCALLLFVLPEREAHAELYRKTLILLD 119

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTG-VTQDLLWVSPKSGGAVCRSVGLP 178
               P +    ++  E+ LL+ +GFGLDL +C V G    DL ++SPK+G AV R+    
Sbjct: 120 ILDQPEIWTLAYLNWEMALLEEMGFGLDLRRCAVLGEKANDLSYISPKTGRAVSRAGAGE 179

Query: 179 YAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKY 216
           +A+++L LP  L       D + L+  F++T  FL  +
Sbjct: 180 WADRLLPLPPCLMGHGPAPDGEILQG-FEVTGQFLRNH 216


>gi|197105330|ref|YP_002130707.1| recombinational DNA repair protein (RecF pathway) [Phenylobacterium
           zucineum HLK1]
 gi|254764651|sp|B4RCU1|RECO_PHEZH RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|196478750|gb|ACG78278.1| recombinational DNA repair protein (RecF pathway) [Phenylobacterium
           zucineum HLK1]
          Length = 243

 Score =  148 bits (373), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 76/217 (35%), Positives = 114/217 (52%), Gaps = 1/217 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M ++DDA +L  R++GE   I+E++T  +GR+   V  G S +++P LQ G  V   +R+
Sbjct: 1   MEFEDDAFVLAARAHGETGAIVELLTSAHGRYAAHVAGGASRKVRPFLQPGARVIARYRA 60

Query: 61  RLAQNLGEFRFE-VLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLN 119
           R++  LG    E V E   A             +       LPEREP    +        
Sbjct: 61  RVSDQLGSAAIEPVGEGPAALFDDPLALSGLSAAAAVAAGALPEREPHPGAFLAFEALTG 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
               P V   +FV+ E  LL+++GFGLDL+KC  TG+T DL+WVSP++G AV R  G PY
Sbjct: 121 ALTHPDVWPAVFVRFEAGLLQDLGFGLDLSKCAATGITDDLVWVSPRTGRAVSRQAGEPY 180

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKY 216
            +++L LP FL   +  + A  + +   LT +FL  +
Sbjct: 181 KDRLLALPPFLLSAQGGLRAGDVAAGLALTGHFLEAF 217


>gi|119370511|sp|Q3J5V8|RECO_RHOS4 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
          Length = 238

 Score =  147 bits (372), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 81/216 (37%), Positives = 122/216 (56%), Gaps = 4/216 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D+  +L VR +GE + I+EV T  +GRH G VR G S ++ PILQ G  + + W++
Sbjct: 1   MEWRDEGALLSVRRHGESSAIIEVFTAAHGRHAGVVRGGASRKIAPILQPGAQLDLTWKA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLN 119
           RL +++G F  E L S  A LL   L L GL +I  +    LPEREP   L+    + L+
Sbjct: 61  RLDEHMGAFTVEPLRSRTA-LLGDRLGLAGLNAICAMLHVTLPEREPHSTLWQESMVLLD 119

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
               P      +++ E+ LL+  GFGLDLT+C VTG  +DL +VSPK+G AV       +
Sbjct: 120 ALDRPGWP-PAYLRWEMRLLEETGFGLDLTRCAVTGSREDLAFVSPKTGRAVSSGAAGGW 178

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNK 215
           A+++  LP  L   +    A+ ++    +T +FL +
Sbjct: 179 ADRLFPLPLALLG-QGPASAEEVRQGLAITGHFLGR 213


>gi|77462223|ref|YP_351727.1| DNA repair protein RecO [Rhodobacter sphaeroides 2.4.1]
 gi|77386641|gb|ABA77826.1| putative RecO protein [Rhodobacter sphaeroides 2.4.1]
          Length = 239

 Score =  147 bits (371), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 81/216 (37%), Positives = 122/216 (56%), Gaps = 4/216 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D+  +L VR +GE + I+EV T  +GRH G VR G S ++ PILQ G  + + W++
Sbjct: 2   MEWRDEGALLSVRRHGESSAIIEVFTAAHGRHAGVVRGGASRKIAPILQPGAQLDLTWKA 61

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLN 119
           RL +++G F  E L S  A LL   L L GL +I  +    LPEREP   L+    + L+
Sbjct: 62  RLDEHMGAFTVEPLRSRTA-LLGDRLGLAGLNAICAMLHVTLPEREPHSTLWQESMVLLD 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
               P      +++ E+ LL+  GFGLDLT+C VTG  +DL +VSPK+G AV       +
Sbjct: 121 ALDRPGWP-PAYLRWEMRLLEETGFGLDLTRCAVTGSREDLAFVSPKTGRAVSSGAAGGW 179

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNK 215
           A+++  LP  L   +    A+ ++    +T +FL +
Sbjct: 180 ADRLFPLPLALLG-QGPASAEEVRQGLAITGHFLGR 214


>gi|99082396|ref|YP_614550.1| DNA repair protein RecO [Ruegeria sp. TM1040]
 gi|119361485|sp|Q1GDH8|RECO_SILST RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|99038676|gb|ABF65288.1| DNA repair protein RecO [Ruegeria sp. TM1040]
          Length = 241

 Score =  147 bits (371), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 82/216 (37%), Positives = 122/216 (56%), Gaps = 2/216 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D  I+L VR +GE + ++EV T  +G H G VR G S +M P LQ G  + + W +
Sbjct: 1   MDWRDQGILLTVRRHGESSALIEVFTEDHGLHAGLVRGGASRKMAPHLQPGAQLDLTWSA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLN 119
           RL  +LG ++ E L S     LS  L L GL ++  L  F LP+R P   LY   +  L+
Sbjct: 61  RLEDHLGTYKAEPLRSRAGMALSGRLALAGLNAVCALLAFALPDRAPYPALYHRSSALLD 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                 +    +++ EL LL+++G+GLDL+ C  TGVTQDL +VSPK+G AV  +    +
Sbjct: 121 LLDSEDLWPLAYLRWELSLLEDLGYGLDLSACAATGVTQDLRYVSPKTGRAVSGAAAGEW 180

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNK 215
           A+++L LP  +  E    D + L +A + T +FL  
Sbjct: 181 ADRLLPLPPVMRGEGAAEDIEIL-TALRTTGFFLES 215


>gi|259418038|ref|ZP_05741957.1| DNA repair protein RecO [Silicibacter sp. TrichCH4B]
 gi|259346944|gb|EEW58758.1| DNA repair protein RecO [Silicibacter sp. TrichCH4B]
          Length = 241

 Score =  146 bits (369), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 82/216 (37%), Positives = 124/216 (57%), Gaps = 2/216 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D  I+L VR +GE + ++EV T+ +GRH G VR G S +M P LQ G  + + W +
Sbjct: 1   MDWRDQGILLTVRRHGESSALIEVFTQAHGRHAGLVRGGASRKMAPHLQPGAQLDLTWSA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLN 119
           RL  +LG ++ E L S  A  LS  L L GL ++  L  F LP+RE   ELY      L+
Sbjct: 61  RLEDHLGTYKAEPLRSRAASALSGRLALSGLNAVCALLAFALPDREAYSELYHRSEALLD 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                 +    +++ EL LL+++G+GLDL+ C VTG T+ L++VSPK+G AV  +    +
Sbjct: 121 LLDNEDLWPLGYLRWELSLLEDLGYGLDLSCCAVTGATEGLMYVSPKTGRAVSEAGAGEW 180

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNK 215
           A+++L LP  +  E    D + L +A + T +F   
Sbjct: 181 ADRLLPLPPVMRGEGDGEDIEIL-TALRTTGFFFES 215


>gi|126739720|ref|ZP_01755412.1| DNA repair protein RecO [Roseobacter sp. SK209-2-6]
 gi|126719366|gb|EBA16076.1| DNA repair protein RecO [Roseobacter sp. SK209-2-6]
          Length = 251

 Score =  145 bits (367), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 78/213 (36%), Positives = 121/213 (56%), Gaps = 2/213 (0%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRL 62
           W+D  I+L  R +GE + I++V T ++GRH G VR G S R+ PILQ G  + + WR+RL
Sbjct: 13  WRDHGILLSARRHGESSAIIDVFTEEHGRHAGVVRGGASRRLAPILQPGAQLDLLWRARL 72

Query: 63  AQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLNCH 121
            ++LG ++ E L S     +S  L L GL ++  L  F LPEREP   LY      L+  
Sbjct: 73  EEHLGSYQAEPLRSRAVAAMSGRLALSGLNAVTALLGFCLPEREPHPALYASSERLLDLL 132

Query: 122 KIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAE 181
           +   +    +++ E+ LL+ +GFGLDL  C V+G  ++L +VSP++G AV R    P+  
Sbjct: 133 EQEELWPLAYLRWEMELLEEMGFGLDLLACAVSGRNEELAYVSPRTGRAVSRQEAGPWVA 192

Query: 182 KMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLN 214
           ++L LP  +  + +  D + +    + T YFL 
Sbjct: 193 RLLPLPPVMLGKGEAPDHE-IAEGLKTTGYFLE 224


>gi|254293710|ref|YP_003059733.1| DNA repair protein RecO [Hirschia baltica ATCC 49814]
 gi|254042241|gb|ACT59036.1| DNA repair protein RecO [Hirschia baltica ATCC 49814]
          Length = 290

 Score =  145 bits (366), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 77/215 (35%), Positives = 118/215 (54%), Gaps = 2/215 (0%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRL 62
           W D AI LG R++GE ++IL+V T   GR  G V  G S + +P+++AGN + V W+++ 
Sbjct: 4   WSDTAISLGARTFGETDVILDVFTPSRGRTRGLVYGGISQKKRPMIEAGNTIDVQWKAKT 63

Query: 63  AQNLGEFRF-EVLESHCAKLLSSSLFLYGLQSIVPLFR-FLPEREPCLELYDMLNIFLNC 120
             +LG F   + +    A+ +   L L GL ++  + R  LPE E    LY+     L+ 
Sbjct: 64  ESSLGHFSVADAINQRAARCMIDPLALAGLSAVTSILRDGLPEGEAKDGLYEATETLLDV 123

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P +   IF++ EL  L+ +G+GL+L  CV++G    L  VSPKSG AV  S    Y 
Sbjct: 124 MGEPDIWPAIFIKWELGFLQQMGYGLNLETCVISGANDGLTHVSPKSGCAVRGSEAEEYI 183

Query: 181 EKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNK 215
           +K+L LP+FL   +       + + F+LT YFL +
Sbjct: 184 DKLLSLPAFLTDAKAPPSPYDIGAGFKLTGYFLTR 218


>gi|85705116|ref|ZP_01036216.1| DNA repair protein RecO [Roseovarius sp. 217]
 gi|85670438|gb|EAQ25299.1| DNA repair protein RecO [Roseovarius sp. 217]
          Length = 244

 Score =  145 bits (366), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 89/239 (37%), Positives = 130/239 (54%), Gaps = 5/239 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D  I+L  R +GE  +I+EV T + GRH G VR G S +M PILQ G  + + WR+
Sbjct: 1   MDWRDQGILLSSRRHGESAVIIEVFTPERGRHAGVVRGGASRKMAPILQPGAQLDLEWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLN 119
           RL  ++G FR E + S  A +L + L L GL ++  L  F LPERE    LY+     L+
Sbjct: 61  RLEDHIGTFRVEPVRSR-AGVLGNPLTLAGLNAVCALLLFALPEREAHGALYERTETLLD 119

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTG-VTQDLLWVSPKSGGAVCRSVGLP 178
                 V    ++  EL LL+++GFGLDL+ C V G    DL ++SP++G AV R+    
Sbjct: 120 LLAESEVWPLAYLHWELALLEDLGFGLDLSTCAVMGEKANDLSYISPRTGRAVSRAGAGE 179

Query: 179 YAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKY-ALQHNIIHCHLLRENFLGKL 236
           + +K+L LP  L       DA+ L+    +T +FL  + A Q         RE F+ ++
Sbjct: 180 WVDKLLPLPPCLMGHGPAPDAEILQ-GLTVTGHFLRTHLAPQMRNKPLPEARERFVARM 237


>gi|126733738|ref|ZP_01749485.1| DNA repair protein RecO [Roseobacter sp. CCS2]
 gi|126716604|gb|EBA13468.1| DNA repair protein RecO [Roseobacter sp. CCS2]
          Length = 244

 Score =  145 bits (365), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 79/213 (37%), Positives = 116/213 (54%), Gaps = 2/213 (0%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRL 62
           W+ +A +L  R +GE  +I+EV +  +GRH G VR G S ++ P+LQ G  + V W++RL
Sbjct: 4   WRSEAALLSSRPFGENGVIIEVFSALHGRHAGVVRGGASRKLAPVLQPGAQLSVAWKARL 63

Query: 63  AQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLNCH 121
             +LG F  E + S  A  +   L L GL ++  L    LPERE    LY+     L+  
Sbjct: 64  ESHLGSFAVEPIRSRAAAAMGDRLALAGLNAVCSLLAMVLPEREAHEPLYERTIALLDLL 123

Query: 122 KIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAE 181
               V    +++ E  LL+ +GF +DL+ C V GV +DL++VSPKSG AV R     +A+
Sbjct: 124 GQQDVWPLAYLRWEQALLEEMGFAMDLSACAVRGVNEDLIYVSPKSGRAVSREAAGEWAD 183

Query: 182 KMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLN 214
           +ML LP  L  +    +A   K A   T YF+ 
Sbjct: 184 RMLPLPEVLTGKGDASNAQIAK-ALGTTGYFIE 215


>gi|163733859|ref|ZP_02141301.1| DNA repair protein RecO [Roseobacter litoralis Och 149]
 gi|161392970|gb|EDQ17297.1| DNA repair protein RecO [Roseobacter litoralis Och 149]
          Length = 241

 Score =  143 bits (361), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 81/217 (37%), Positives = 119/217 (54%), Gaps = 2/217 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+++ I+L  R +GE   I+EV T  +GRH G VR G S ++ PILQ G  + + WR+
Sbjct: 1   MEWREEGILLSTRRHGESAAIIEVFTPSHGRHAGVVRGGTSRKIAPILQPGAQLDLTWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLN 119
           RL  ++G F  E + S  A  +   L L GL ++  L  F LPERE    LY      L+
Sbjct: 61  RLEDHIGSFHVEPVRSRAAAAMGDRLALAGLNAVTALLGFCLPEREAHRALYLETERLLD 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
             +   +    +++ E+ LL  +G+ L+L +C VTG   DL++VSPKSG AV       +
Sbjct: 121 LLEEGELWPLAYLRWEVQLLHEMGYALELDQCAVTGQRDDLIYVSPKSGRAVSAQGAGDW 180

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKY 216
           AE++L LP  L       DA+ +  AF  T YFL ++
Sbjct: 181 AERLLPLPPILRGVGGGPDAE-IAQAFVTTGYFLTEH 216


>gi|84684348|ref|ZP_01012249.1| DNA repair protein RecO [Maritimibacter alkaliphilus HTCC2654]
 gi|84667327|gb|EAQ13796.1| DNA repair protein RecO [Rhodobacterales bacterium HTCC2654]
          Length = 246

 Score =  143 bits (360), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 88/230 (38%), Positives = 127/230 (55%), Gaps = 15/230 (6%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D   +L VR +GE ++I+EV T ++GRH G VR G S ++ PILQ G+ + + WR+
Sbjct: 4   MEWRDQGTLLSVRKHGETSVIIEVFTAEHGRHAGVVRGGVSRKIAPILQPGSQLDLVWRA 63

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYD----MLN 115
           RL +++G F  E ++S  A ++     L GL +I  L  F LPERE    LY     ML+
Sbjct: 64  RLEEHIGAFTVEPVKSRAAAIMGDRNALAGLNAITALLSFALPEREAHPRLYTRSIAMLD 123

Query: 116 IFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSV 175
           +       P  +G  ++Q EL LL+ +G+GLDLT C VTG  +DL +VSPKSG AV    
Sbjct: 124 LLAETPAWP--VG--YLQWELALLEELGYGLDLTACAVTGGAEDLAYVSPKSGRAVSAEG 179

Query: 176 GLPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHC 225
              + +++L LP  L     T D   +    + T YFL      H + H 
Sbjct: 180 AGEWVDRLLPLPEEL-LGVVTQDLAGIPDGLRTTGYFLT-----HGLAHA 223


>gi|68171672|ref|ZP_00545033.1| recO-related protein [Ehrlichia chaffeensis str. Sapulpa]
 gi|88658325|ref|YP_507349.1| DNA repair protein RecO [Ehrlichia chaffeensis str. Arkansas]
 gi|123493398|sp|Q2GGT4|RECO_EHRCR RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|67998907|gb|EAM85598.1| recO-related protein [Ehrlichia chaffeensis str. Sapulpa]
 gi|88599782|gb|ABD45251.1| putative DNA repair protein RecO [Ehrlichia chaffeensis str.
           Arkansas]
          Length = 244

 Score =  142 bits (359), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 80/226 (35%), Positives = 131/226 (57%), Gaps = 12/226 (5%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQ--SHRMQPILQAGNLVRVNW 58
           M WQD  I++ +R YG+  II+ + T+++G   G  +  +  +HR    LQ G+ V V W
Sbjct: 1   MRWQDQGIVIAIRKYGDDQIIISIFTQKHGLKKGLAKYSKKATHR----LQIGDYVNVTW 56

Query: 59  RSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQ-SIVPLFRFLPEREPCLELYDMLNIF 117
            SRL  NLG F++E+++S     +  +L    +  S V L + LPE E    +Y+ L+IF
Sbjct: 57  SSRLISNLGCFKYELIKSTLYHYIQDNLKTMCIAFSTVILDQVLPENEENYIIYNCLDIF 116

Query: 118 LNCHKIPSVIGKI-FVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVG 176
           +N  +   +  KI ++++EL LL  +GFGLDL++C V    ++L ++SPK+G AV ++VG
Sbjct: 117 INSIQFQDINWKIKYLRLELTLLSELGFGLDLSRCAVNNTNENLTFISPKTGKAVSKTVG 176

Query: 177 LPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLT----DYFLNKYAL 218
           LPY++ +L LP  L+      +    K+ F+L+     YF  K+ L
Sbjct: 177 LPYSKSLLPLPQLLYDVYNNYEYKYSKTDFKLSLNVLGYFFKKHFL 222


>gi|84515166|ref|ZP_01002529.1| DNA repair protein RecO [Loktanella vestfoldensis SKA53]
 gi|84511325|gb|EAQ07779.1| DNA repair protein RecO [Loktanella vestfoldensis SKA53]
          Length = 243

 Score =  142 bits (358), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 80/214 (37%), Positives = 118/214 (55%), Gaps = 2/214 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           + W+DDA IL +R +GE + I+EV +  +GRH G VR G S ++ P++Q G  V V W +
Sbjct: 2   ISWRDDAAILAMRPFGESSAIIEVFSANHGRHAGVVRGGASRKIAPLIQPGAQVNVAWAA 61

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVP-LFRFLPEREPCLELYDMLNIFLN 119
           RL  +LG F  E + S  A  ++  L L GL ++   L   LPERE    LY      L+
Sbjct: 62  RLDDHLGSFTVEPVRSRNAAAMADRLSLAGLNAVCALLLMVLPERESHPLLYQRSIALLD 121

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                +V    +++ E  LL+ +GFGLDL+ C  +GV +DL +VSPKSG AV R     +
Sbjct: 122 LLDQRAVWPLAYLRWEQALLEEMGFGLDLSACAASGVNEDLAFVSPKSGRAVSRDAAGVW 181

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFL 213
           A+++L LP  L  +      +  K A   T +F+
Sbjct: 182 ADRLLPLPPVLAGKGDASGVEIAK-ALGTTGFFI 214


>gi|304321235|ref|YP_003854878.1| DNA repair protein RecO [Parvularcula bermudensis HTCC2503]
 gi|303300137|gb|ADM09736.1| DNA repair protein RecO [Parvularcula bermudensis HTCC2503]
          Length = 243

 Score =  142 bits (358), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 80/218 (36%), Positives = 116/218 (53%), Gaps = 6/218 (2%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRL 62
           W D   ++     GE ++++ + TR  G   G V  GQ  R  P+LQ GNLV  +W SR 
Sbjct: 4   WTDRGFVIKTIPRGENHLVVTLFTRCRGAVTGLVHGGQGTRKAPLLQRGNLVSADWSSRQ 63

Query: 63  AQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLF-RFLPEREPCLELYDMLNIFLNCH 121
           A   G +R E+ E+  A+ L S L L  LQS+  L    LPE      L+D   +F +  
Sbjct: 64  ADGYGTYRLELAEAIAARALDSRLSLLALQSVTDLLCEILPEGVAYEGLFDATEVFFSAL 123

Query: 122 KIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVT----QDLLWVSPKSGGAVCRSVGL 177
              +++  + V+ EL LL  +G+GL L +C  TG T     DL++VSPKSGGAV    G 
Sbjct: 124 GEKAIMATLLVKWELGLLAALGYGLSLERCAATGRTLEDGADLVFVSPKSGGAVTAEAGA 183

Query: 178 PYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNK 215
           PYA+++L LP FL    +    D + +  +LT  FL++
Sbjct: 184 PYADRLLPLPPFLIDRGEPTWPD-IAAGLRLTGTFLDE 220


>gi|114799258|ref|YP_759606.1| DNA repair protein RecO [Hyphomonas neptunium ATCC 15444]
 gi|122942647|sp|Q0C3T7|RECO_HYPNA RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|114739432|gb|ABI77557.1| DNA repair protein RecO [Hyphomonas neptunium ATCC 15444]
          Length = 243

 Score =  141 bits (355), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 81/218 (37%), Positives = 118/218 (54%), Gaps = 7/218 (3%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W DD I+LG R +GE  +IL+V+TR+ GR  G V  G S R +   +AGN + ++W  
Sbjct: 1   MNWSDDGIVLGGRRFGEGGLILDVLTREKGRRSGLVYGGASRRKRAQFEAGNTIALSWTG 60

Query: 61  RLAQNLGEFRFEVLESH---CAKLLSSSLFLYGLQSIVPLFRF-LPEREPC-LELYDMLN 115
           RL   LG  RF+V E+     ++LL     L  L +I  L R  L E +     LY+   
Sbjct: 61  RLDDQLG--RFDVAEARKDRASRLLDDPAALAALSAITSLLRGGLNEGDAAGSSLYEATT 118

Query: 116 IFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSV 175
           + L+    P+V   ++V+ EL LL  +GFGLDL +C V+G    L  VSP++G AV  S 
Sbjct: 119 LLLDQLTEPNVWPALYVRWELGLLSALGFGLDLDECAVSGANDGLTHVSPRTGRAVRGSE 178

Query: 176 GLPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFL 213
             PY +++  LPSFL      +    + +  +LT YF+
Sbjct: 179 AEPYVDRLFALPSFLIDPRADVLPGDIAAGLRLTGYFI 216


>gi|126728495|ref|ZP_01744311.1| DNA repair protein RecO [Sagittula stellata E-37]
 gi|126711460|gb|EBA10510.1| DNA repair protein RecO [Sagittula stellata E-37]
          Length = 241

 Score =  141 bits (355), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 82/215 (38%), Positives = 118/215 (54%), Gaps = 2/215 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D  I+L  R +GE ++IL+V T + GRH G +R G S +M P LQ G  + ++WR+
Sbjct: 1   MEWRDTGILLATRRHGETSLILDVFTPERGRHSGVLRGGTSRKMAPHLQPGAQLDLSWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLN 119
           RL  ++G F  E   S  A+ L   L L GL ++V L RF LPER P  +LY      L+
Sbjct: 61  RLEDHMGAFTVEPQRSRAAQALGDRLALAGLNAVVALLRFCLPERVPHPDLYTFSEQLLD 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
               P +    +++ E+ LL+ +GF LDL+ C VTG T+ L++VSPKSG AV       +
Sbjct: 121 LLDQPDLWPLAYLRWEMALLEEMGFALDLSCCAVTGRTEGLVYVSPKSGRAVTAEGAGNW 180

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLN 214
              +L LP  +       D   + +A   T YFL 
Sbjct: 181 VHHLLPLPEVMLG-RGAADNPEVATALGTTGYFLE 214


>gi|110678689|ref|YP_681696.1| DNA repair protein RecO [Roseobacter denitrificans OCh 114]
 gi|119361483|sp|Q16AI3|RECO_ROSDO RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|109454805|gb|ABG31010.1| DNA repair protein RecO [Roseobacter denitrificans OCh 114]
          Length = 241

 Score =  141 bits (355), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 80/217 (36%), Positives = 117/217 (53%), Gaps = 2/217 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+++ I+L  R +GE   I+EV T  +GRH G VR G S ++ PILQ G  + + WR+
Sbjct: 1   MEWREEGILLSTRRHGESAAIIEVFTPSHGRHAGVVRGGTSRKIAPILQPGAQLDLTWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLN 119
           RL  ++G F  E + S  A  +   L L GL ++  L  F LPERE    LY      L+
Sbjct: 61  RLEDHIGSFLVEPVRSRAAAAMGDRLALAGLNAVTALLGFCLPEREAHRPLYVETERLLD 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                 +    +++ E+ LL ++G+ L L  C VTG   DL++VSPKSG AV       +
Sbjct: 121 LLGEGEIWPLAYLRWEVQLLHDMGYALALEACAVTGQRDDLIYVSPKSGRAVSAKGAGDW 180

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKY 216
           A+++L LP  L       DA+ +  AF  T YFL ++
Sbjct: 181 ADRLLPLPPILRGIGGGPDAE-IAQAFITTGYFLTEH 216


>gi|288958668|ref|YP_003449009.1| DNA repair protein RecO [Azospirillum sp. B510]
 gi|288910976|dbj|BAI72465.1| DNA repair protein RecO [Azospirillum sp. B510]
          Length = 240

 Score =  140 bits (354), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 82/234 (35%), Positives = 120/234 (51%), Gaps = 4/234 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W D  I+L  R  GE + +  ++TR +GRH G V  G+S R +  L+ G LV   WR 
Sbjct: 1   MDWSDQGIVLSARPQGEGSAVATLLTRGHGRHAGMVMGGRSARQRGTLEPGTLVHARWRG 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFR-FLPEREPCLELYDMLNIFLN 119
           RL ++LG F  E +  + A     +  L  L S   L    LPERE    L+D L +   
Sbjct: 61  RLPEHLGHFTLEPVRGYAAGFFDDAQALAALTSACALVEAALPEREAHPALFDGLLVLFG 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
               P+   + +V+ E+ LL  +GFGLDL +C V+G    L +VSP++G AV  SVG PY
Sbjct: 121 LLDSPA-WAETYVRWEVGLLAELGFGLDLDRCAVSGANDYLAYVSPRTGRAVTASVGEPY 179

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHC-HLLRENF 232
            +++L LP FL          ++    +LT +FL ++ L   +      LRE +
Sbjct: 180 RDRLLPLPDFL-AGRGGGGPAAVADGLRLTAHFLERHLLNGPLPPARERLRERY 232


>gi|294084098|ref|YP_003550856.1| DNA repair protein RecO [Candidatus Puniceispirillum marinum
           IMCC1322]
 gi|292663671|gb|ADE38772.1| DNA repair protein RecO [Candidatus Puniceispirillum marinum
           IMCC1322]
          Length = 250

 Score =  140 bits (352), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 84/219 (38%), Positives = 119/219 (54%), Gaps = 10/219 (4%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRL 62
           W  DA+I+  + +GE + ++ V+T + GRH G VR G S +M+ ILQ GN VRV+WR+RL
Sbjct: 4   WVADAVIISAKPHGEGSAVVIVLTAENGRHAGLVRGGSSSKMRGILQPGNRVRVSWRARL 63

Query: 63  AQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFR-FLPEREPCLELYDMLNIFLN-- 119
              LG+ + E++ +  A +L  +L L G+ S   L    LPERE    LYD  N   +  
Sbjct: 64  IDQLGQMQIELINAIPALMLDDALRLAGIASACALLDGTLPEREAQHALYDGTNALFDLM 123

Query: 120 CHKIPS---VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVG 176
           C   P    + G  +++ EL LL   G+ LDLT+C  +G  + L +VSPKSG A+     
Sbjct: 124 CLDDPDHRWIEG--YIRWELGLLNAAGYQLDLTRCAASGAREKLAYVSPKSGCAIALDQA 181

Query: 177 LPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNK 215
             Y ++ML LP FL        A    S   LT +FL K
Sbjct: 182 GEYVQRMLTLPVFLGGITNV--ASDHVSGLNLTGHFLEK 218


>gi|254450984|ref|ZP_05064421.1| DNA repair protein RecO [Octadecabacter antarcticus 238]
 gi|198265390|gb|EDY89660.1| DNA repair protein RecO [Octadecabacter antarcticus 238]
          Length = 242

 Score =  140 bits (352), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 76/215 (35%), Positives = 119/215 (55%), Gaps = 2/215 (0%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRL 62
           W+D+  ++ VR +GE + I+EV T   G   G VR G S ++ P LQ G  + V W++RL
Sbjct: 4   WRDEGALIRVRKHGESSAIIEVFTPSRGLTAGIVRGGTSRKIAPTLQPGAQLDVTWKARL 63

Query: 63  AQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLNCH 121
             +LG F  E + S  A+++   L L GL ++  L  F LP+RE   +LY      L+  
Sbjct: 64  EDHLGSFTVEPIRSRTAQVMQDRLALAGLNAVTGLLSFLLPDREAHAQLYARTIQLLDLL 123

Query: 122 KIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAE 181
               V    ++Q E+ LL  +GFG+DL+ C V+G+  DL +VSP++G AV R     +A+
Sbjct: 124 GQNDVWPLAYLQWEIALLDEMGFGMDLSACAVSGLNDDLFYVSPRTGRAVSRLAAGEWAD 183

Query: 182 KMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKY 216
           ++L LP  L  +    D + +  A + T +FLN +
Sbjct: 184 RLLPLPHVLLGKGDA-DLNEIVLALRTTGHFLNNH 217


>gi|84500557|ref|ZP_00998806.1| DNA repair protein RecO [Oceanicola batsensis HTCC2597]
 gi|84391510|gb|EAQ03842.1| DNA repair protein RecO [Oceanicola batsensis HTCC2597]
          Length = 241

 Score =  139 bits (351), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 79/217 (36%), Positives = 126/217 (58%), Gaps = 2/217 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D  I+L VR +GE   I +V T   GRH G VR   S ++ P+LQ G  + ++W++
Sbjct: 1   MEWRDQGILLAVRRHGESAAIADVFTPGRGRHAGVVRGATSRKLAPVLQPGAQLDISWKA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLN 119
           RL ++LG F  E + S  A++L   L L GL ++  L  F LPERE    LY      L+
Sbjct: 61  RLEEHLGHFTVEPVRSRAAQILGDRLALAGLNAVTALLCFALPEREAHEALYRRTETLLD 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                 +    ++  EL LL+++G+GLDLT+C VTG  + L ++SP++G AV  +    +
Sbjct: 121 LLGQMDLWPLAYLHWELALLEDLGYGLDLTECAVTGAREGLDYISPRTGRAVTAAGAGDW 180

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKY 216
           A+++L LP  L ++ +  D + L S F++T +FL ++
Sbjct: 181 ADRLLPLPPCLLRQGEAPDEEIL-SGFRVTGHFLAEH 216


>gi|89053018|ref|YP_508469.1| DNA repair protein RecO [Jannaschia sp. CCS1]
 gi|119361461|sp|Q28V18|RECO_JANSC RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|88862567|gb|ABD53444.1| DNA repair protein RecO [Jannaschia sp. CCS1]
          Length = 244

 Score =  139 bits (350), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 75/217 (34%), Positives = 121/217 (55%), Gaps = 4/217 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+ D I+L VR +GE + I+E+ T   G HLG VR G S +M P+LQ G  +   WR+
Sbjct: 1   MDWRADGILLAVRRHGEASAIIELFTADQGCHLGVVRGGASRKMAPLLQVGAQLDATWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLN 119
           RL+ ++G +  E+++   A+++   + L GL S+  L  F LPER     L+      L+
Sbjct: 61  RLSDHIGSYTVELVKGRAAEVMEDRVALAGLSSVCALLSFSLPERAAYPGLFARTLAVLD 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                    + ++  E+ LL  +GFGLDL++C  TGVTQDL ++SP++G AV R+    +
Sbjct: 121 GLGAER-WAEAYLGWEMALLTEMGFGLDLSQCAATGVTQDLAFISPRTGRAVSRAAAGEW 179

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKY 216
           A+++L L   L  E      + + +   +T +FL  +
Sbjct: 180 ADRLLPLSPAL--EGMARGPEDILAGLAVTGHFLATH 214


>gi|296116242|ref|ZP_06834859.1| putative DNA repair protein recO [Gluconacetobacter hansenii ATCC
           23769]
 gi|295977176|gb|EFG83937.1| putative DNA repair protein recO [Gluconacetobacter hansenii ATCC
           23769]
          Length = 265

 Score =  139 bits (349), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 81/247 (32%), Positives = 135/247 (54%), Gaps = 9/247 (3%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+  A++L    YGE ++I  V+T ++G + G VR G + + +P+ QAGNL+   W +
Sbjct: 7   MEWEAPALVLSAVPYGESSMIAHVLTGEHGLYHGMVRGGGARQGRPVWQAGNLITARWNA 66

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLF-RFLPEREPCLELYDMLN---- 115
           RL + LG  R E++ +  A++L  +  L  L S+  L    LPEREP L +++ L     
Sbjct: 67  RLPEQLGSLRGELVHASAARVLEYAHPLAMLASLCALADSSLPEREPHLAVFEELTRLLA 126

Query: 116 -IFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRS 174
            I L   +         ++ E++LL ++GFGLDL+ C V+G   DL WVSP+SG AV   
Sbjct: 127 RISLEPAEAERSGMAALIRWEMLLLSDLGFGLDLSCCAVSGQADDLAWVSPRSGRAVSDG 186

Query: 175 VGLPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYAL--QHNIIHCHLLR-EN 231
               + +++L+LP FL    Q    +   +  +LT +FL + A   +H  +    +R  +
Sbjct: 187 HAGQWRDRLLMLPPFLLDPTQDGTPEQWLAGLRLTGHFLARDAFGQRHRPLPAARIRLLD 246

Query: 232 FLGKLLE 238
            +G+++E
Sbjct: 247 MVGRMVE 253


>gi|254436668|ref|ZP_05050162.1| DNA repair protein RecO [Octadecabacter antarcticus 307]
 gi|198252114|gb|EDY76428.1| DNA repair protein RecO [Octadecabacter antarcticus 307]
          Length = 242

 Score =  138 bits (348), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 76/215 (35%), Positives = 118/215 (54%), Gaps = 2/215 (0%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRL 62
           W+D+  ++ VR +GE + I+EV T   G   G VR G S ++ P LQ G  + V W++RL
Sbjct: 4   WRDEGALVRVRKHGESSAIIEVFTASRGLTAGIVRGGTSRKIAPTLQPGAQLDVTWKARL 63

Query: 63  AQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLNCH 121
             +LG F  E + S  A+++   L L GL ++  L  F LP+RE    LY      L+  
Sbjct: 64  EDHLGSFTVEPIRSRTAQVMQDRLALAGLNAVTGLLSFLLPDREAHAPLYARTIQLLDLL 123

Query: 122 KIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAE 181
               V    ++Q E+ LL  +GFG+DL+ C V+G+  DL +VSP++G AV R     +A+
Sbjct: 124 GQNDVWPLAYLQWEVALLDEMGFGMDLSACAVSGLNDDLFYVSPRTGRAVSRLAAGEWAD 183

Query: 182 KMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKY 216
           ++L LP  L  +    D + +  A + T +FLN +
Sbjct: 184 RLLPLPHVLLGKGDA-DLNEIVLALRTTGHFLNNH 217


>gi|86135730|ref|ZP_01054309.1| DNA repair protein RecO [Roseobacter sp. MED193]
 gi|85826604|gb|EAQ46800.1| DNA repair protein RecO [Roseobacter sp. MED193]
          Length = 244

 Score =  138 bits (348), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 76/216 (35%), Positives = 118/216 (54%), Gaps = 2/216 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D  I+L  R +GE   I++V T  +GRH G V  G S +  P+LQ G  + + WR+
Sbjct: 1   MEWRDHGILLTRRRHGEGAAIIDVFTEHHGRHAGIVHGGASRKKAPVLQPGAQLDLLWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLN 119
           RL ++LG ++ E L S  A  LS  L L GL ++  L  F LPER    +LY      L+
Sbjct: 61  RLQEHLGSYQAEPLRSRAAAALSGRLALAGLNAVTGLLGFCLPERAAYPDLYKQSEQLLD 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
             +   +    +++ E+ LL  +GFGLDL+ C V+G  +DL ++SPK+G AV R     +
Sbjct: 121 LLEQEEIWPLAYLRWEMALLAAMGFGLDLSACAVSGSNEDLAYISPKTGRAVSRQEAGQW 180

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNK 215
             ++L LP  L    +  D + +    + T +FL++
Sbjct: 181 VNRLLPLPPVLRGLGEAPDHE-VAEGLRTTGFFLSE 215


>gi|260576291|ref|ZP_05844283.1| DNA repair protein RecO [Rhodobacter sp. SW2]
 gi|259021559|gb|EEW24863.1| DNA repair protein RecO [Rhodobacter sp. SW2]
          Length = 238

 Score =  138 bits (348), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 92/241 (38%), Positives = 130/241 (53%), Gaps = 6/241 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D   +L VR +GE   I+EV T  +GRH G VR G S R+ P+LQ G  + V WR+
Sbjct: 1   MEWRDQGALLSVRPHGESAAIIEVFTAAHGRHAGVVRGGASRRIAPLLQPGAQLDVVWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLN 119
           RL  ++G F  E + S  A +L   L L GL +I  + R  LPER P   LY      L+
Sbjct: 61  RLEGHIGAFTVEPVRSR-AGVLGDRLALAGLNAICAMVRVALPERAPHDLLYAATIAVLD 119

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
             +        +++ EL+LL+ +GFGLDL +C VTG   DL +VSPK+G AV R     +
Sbjct: 120 ALETAPDWPARYLRWELLLLEELGFGLDLGRCAVTGSRDDLAYVSPKTGRAVSRDGAGEW 179

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLEL 239
           A ++L LP  L  +     AD L +   +T +FL +     ++ H   L E    +LLEL
Sbjct: 180 AARLLPLPDCLLGQGPASGAD-LAAGLAVTGHFLTRE--MASLRHVQHLPEAR-ARLLEL 235

Query: 240 I 240
           +
Sbjct: 236 L 236


>gi|329850744|ref|ZP_08265589.1| DNA repair protein RecO [Asticcacaulis biprosthecum C19]
 gi|328841059|gb|EGF90630.1| DNA repair protein RecO [Asticcacaulis biprosthecum C19]
          Length = 244

 Score =  138 bits (347), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 82/221 (37%), Positives = 117/221 (52%), Gaps = 3/221 (1%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRL 62
           ++D+AI+L  + +GE   IL V+T  +G +   V  G S RM+  LQ G  V   +R+R 
Sbjct: 4   FEDEAIVLSAKLHGESGAILHVLTENHGVYAAHVAGGASRRMKAALQPGASVLFRFRARH 63

Query: 63  AQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFR-FLPEREPCLELYDMLNIFLNCH 121
           ++ LG    E   S    +L  S+ L GLQ    + R  LPERE     Y  L+  L   
Sbjct: 64  SEQLGTASVEASGS-GPDVLDDSVALLGLQCACLMTRQVLPERERHPGAYYALSALLGAF 122

Query: 122 KIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAE 181
             P +   I+V+ E  LL+ +G+GLDL+ C VTG   DL++VSPKS  AV R  G  Y +
Sbjct: 123 VAPDIWPAIYVRYEAGLLEELGYGLDLSACAVTGSRDDLVYVSPKSARAVSRGAGEAYRD 182

Query: 182 KMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQ-HN 221
           K+LVLP FL   +  + A  +     LT +FL ++    HN
Sbjct: 183 KLLVLPQFLLSSQGGLIAGDVGRGLALTGFFLERHVFHPHN 223


>gi|146278602|ref|YP_001168761.1| DNA repair protein RecO [Rhodobacter sphaeroides ATCC 17025]
 gi|172046019|sp|A4WVP2|RECO_RHOS5 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|145556843|gb|ABP71456.1| DNA repair protein RecO [Rhodobacter sphaeroides ATCC 17025]
          Length = 237

 Score =  138 bits (347), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 75/216 (34%), Positives = 118/216 (54%), Gaps = 4/216 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           + W+D+  +L VR +GE   I+EV T  +GRHLG VR G S R  P+LQ G  + + W++
Sbjct: 2   LEWRDEGALLSVRRHGESAAIIEVFTASHGRHLGVVRGGASRRHAPVLQPGAQLDLTWKA 61

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFR-FLPEREPCLELYDMLNIFLN 119
           RL  ++G F  E L +    +    L L GL +I  +    LPEREP + L+      ++
Sbjct: 62  RLDDHMGAFTVEPLRARTG-IFGDRLALAGLNAICAMLHVVLPEREPHVGLWRESIELMD 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
               P      +++ E+ LL+  GFGLDLT+C VTG  +DL +VSP++G AV R+    +
Sbjct: 121 ALAAPGWP-AAYLRWEMRLLEEAGFGLDLTRCAVTGSREDLAFVSPRTGRAVGRAAAGDW 179

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNK 215
           A+++  LP  L   +       ++    +T +FL +
Sbjct: 180 ADRLFPLPLALLG-QGPASGPEVRQGLAITGHFLAR 214


>gi|114765537|ref|ZP_01444645.1| DNA repair protein RecO [Pelagibaca bermudensis HTCC2601]
 gi|114542130|gb|EAU45162.1| DNA repair protein RecO [Roseovarius sp. HTCC2601]
          Length = 242

 Score =  138 bits (347), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 77/216 (35%), Positives = 115/216 (53%), Gaps = 2/216 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D  I+L  R +GE + ILEV T ++GRH+G +R G S ++ P LQ G  + + WR+
Sbjct: 1   MDWRDTGILLSTRRHGETSAILEVFTAEHGRHMGVLRGGTSRKIAPSLQPGAQLDLTWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLN 119
           RL  ++G +  E   S  A  +S  L L GL ++V L  F LPERE    LY      L+
Sbjct: 61  RLEDHMGAWTVEPQRSRAASAMSDRLSLAGLNAVVALLSFCLPEREAHPALYARTESLLD 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                 +    +++ E+ LL  +GFGLDL+ C VTG  + L +VSP++G AV       +
Sbjct: 121 LLAERELWPLAYMRWEMALLDEMGFGLDLSACAVTGTNEPLDYVSPRTGRAVSAFGAGDW 180

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNK 215
             ++L LP  +       D + L  A + T +FL  
Sbjct: 181 VARLLPLPPVMLGRGSAPDGEILD-ALRTTGHFLEN 215


>gi|294678824|ref|YP_003579439.1| DNA repair protein RecO [Rhodobacter capsulatus SB 1003]
 gi|294477644|gb|ADE87032.1| DNA repair protein RecO [Rhodobacter capsulatus SB 1003]
          Length = 240

 Score =  137 bits (344), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 89/229 (38%), Positives = 123/229 (53%), Gaps = 16/229 (6%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M WQD   IL  R +GE + I+EV T  +GRHLG VR G S +M  +L  G+ V V WR+
Sbjct: 1   MDWQDSGTILSTRLHGESSAIVEVFTATHGRHLGVVRGGASRKMAAVLMPGSHVAVAWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLN 119
           RL   LG F  E L S  A  LS  L L GL ++  L  F L ER P   LY        
Sbjct: 61  RLEDQLGSFTVEPLASR-AGALSDRLALMGLNAVCALLSFVLAERAPHPRLYAATEPLF- 118

Query: 120 CHKIPSVIGKI-------FVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVC 172
                +VIG+        ++  E+ LL+++GFGLDL++C VTG   DL +VSP++G AV 
Sbjct: 119 -----TVIGQAAEGWVVDYLIWEMALLEDLGFGLDLSRCAVTGTRDDLAFVSPRTGRAVS 173

Query: 173 RSVGLPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHN 221
           R+    +A K+L LP  L  +      + +     LT +FL ++A +H+
Sbjct: 174 RAGAGDWAPKLLPLPLCLLGQGPATWTE-IGQGLTLTGHFLTRFASEHS 221


>gi|159042759|ref|YP_001531553.1| DNA repair protein RecO [Dinoroseobacter shibae DFL 12]
 gi|254790521|sp|A8LLE2|RECO_DINSH RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|157910519|gb|ABV91952.1| DNA repair protein RecO [Dinoroseobacter shibae DFL 12]
          Length = 241

 Score =  136 bits (343), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 68/189 (35%), Positives = 107/189 (56%), Gaps = 1/189 (0%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRL 62
           W+++ ++L VR +GE ++I+E  TR +GRHLG VR G S ++ P+LQ G  + + W++RL
Sbjct: 4   WREEGVLLSVRPHGETSVIVEAFTRAHGRHLGVVRGGVSRKLAPVLQPGAQLDLRWKARL 63

Query: 63  AQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLNCH 121
             ++G F  E +    A +L   L L  + S + L RF L ER      YD     L+  
Sbjct: 64  EDHMGAFTVEPVRGRAAAVLGDRLALSAMSSALALARFSLAERAAYPGFYDQTVALLDAL 123

Query: 122 KIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAE 181
              +     ++  E+ LL  +GFGLDL+ C V GV +DL +VSP++G AV R     + +
Sbjct: 124 AEGTGWLPAYLDWEMALLDQMGFGLDLSGCAVRGVNEDLAFVSPRTGRAVSRQAAGAWVD 183

Query: 182 KMLVLPSFL 190
           ++L LP  +
Sbjct: 184 RLLPLPEVM 192


>gi|221234572|ref|YP_002517008.1| DNA repair protein RecO [Caulobacter crescentus NA1000]
 gi|254790515|sp|B8GVD0|RECO_CAUCN RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|220963744|gb|ACL95100.1| DNA repair protein recO [Caulobacter crescentus NA1000]
          Length = 243

 Score =  135 bits (341), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 71/217 (32%), Positives = 112/217 (51%), Gaps = 1/217 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D+A +L  RS+GE   I+E++T   G+    V    S RM+P LQ G  V V +R+
Sbjct: 1   MEWEDEAYVLSARSHGETGAIVELLTEARGKVAAHVAGAASRRMKPFLQPGARVIVRYRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSS-SLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLN 119
           ++   LG    E +    + L            +       LPERE     +  L   + 
Sbjct: 61  KVEGQLGSATLEPMGEGPSSLFDDRLALAGLSAAAAVAAAALPEREAHPGAFHALEALIR 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
             +IP +   ++V+ E  LL+ +GFGLDL+KC  TG   DL++VSP++G AV R  G PY
Sbjct: 121 VLEIPEIWPAVYVRYEAGLLQELGFGLDLSKCAATGAFDDLVYVSPRTGRAVSREAGKPY 180

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKY 216
            +K+L LP F+   +  +    +K+   +T +FL ++
Sbjct: 181 HDKLLPLPPFMLSSQGGLAEGDVKAGLDITGHFLEQF 217


>gi|295690015|ref|YP_003593708.1| DNA repair protein RecO [Caulobacter segnis ATCC 21756]
 gi|295431918|gb|ADG11090.1| DNA repair protein RecO [Caulobacter segnis ATCC 21756]
          Length = 243

 Score =  135 bits (339), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 69/217 (31%), Positives = 113/217 (52%), Gaps = 1/217 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D+A +L  RS+GE   I+E++T+  G+    V    S RM+P LQ G  V   +R+
Sbjct: 1   MEWEDEAYVLSARSHGETGAIVELLTQDRGKFAAHVAGAASRRMKPFLQPGARVIARYRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSS-SLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLN 119
           R++  LG    E +    + L            +       LPERE     +  L   + 
Sbjct: 61  RMSDQLGSASLEPMGEGPSSLFDDRLALAGLSAAAAVAAAALPEREAHPGAFHALEALIR 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
             ++  +   ++V+ E  LL+ +GFGLDL++C  TGV  DL++VSP++G AV R  G PY
Sbjct: 121 VLEVSEIWPAVYVRYEAGLLQELGFGLDLSRCAATGVFDDLVYVSPRTGRAVSREAGRPY 180

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKY 216
            +K+L LP F+   +  +    +K+   +T +FL ++
Sbjct: 181 HDKLLPLPPFMLSSQGGLAEGDVKAGLDITGHFLEQF 217


>gi|157803626|ref|YP_001492175.1| DNA repair protein RecO [Rickettsia canadensis str. McKiel]
 gi|254790734|sp|A8EYF7|RECO_RICCK RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|157784889|gb|ABV73390.1| DNA repair protein RecO [Rickettsia canadensis str. McKiel]
          Length = 241

 Score =  135 bits (339), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 83/239 (34%), Positives = 128/239 (53%), Gaps = 7/239 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M  +D  +I+  +   E   I+ V T+ YG + G V+   S + + I Q GN+V   W +
Sbjct: 1   MNIKDIGVIVAKKPLKENTFIITVFTKNYGLYSGVVK-ASSKKSKFIYQEGNIVDFLWMA 59

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFR-FLPEREPCLELYDML-NIFL 118
           RL +++G  + E+++S+    +++   LY   SI+ L +  L ERE     +  L N   
Sbjct: 60  RLHEHIGIAKCELIKSYTGYFITNKTKLYAFNSIISLIKELLHEREEYSNFFSFLINYLD 119

Query: 119 NCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
           N  K      + ++  EL LL   G+ LDL+KC V+ V QDL +VSPKSG A+   VG P
Sbjct: 120 NLSK--KFFFRDYINFELALLDIAGYKLDLSKCAVSNVKQDLYYVSPKSGRALSYEVGKP 177

Query: 179 YAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLL 237
           Y +K+L+LP FL  +   I  +  + A  LT+YF N+Y L HN  H    R+ F+  +L
Sbjct: 178 YKDKLLILPKFLLSDNSKITLEEKRQALTLTNYFFNRY-LFHNNRHAE-ARQAFMEYIL 234


>gi|148557387|ref|YP_001264969.1| DNA repair protein RecO [Sphingomonas wittichii RW1]
 gi|254790737|sp|A5VEW5|RECO_SPHWW RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|148502577|gb|ABQ70831.1| DNA repair protein RecO [Sphingomonas wittichii RW1]
          Length = 243

 Score =  134 bits (338), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 79/214 (36%), Positives = 114/214 (53%), Gaps = 7/214 (3%)

Query: 7   AIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQNL 66
           AII  +R++GE   I+  +T  +G   G+VR G+S R++P+L AGNLV   +R+R A+ L
Sbjct: 7   AIICAMRAHGEHGAIVRALTPDHGLLAGYVRGGRSRRLRPVLVAGNLVEAEFRARTAEQL 66

Query: 67  GEFRFEVLESHCAKLLSSSLF--LYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC-HKI 123
                E+  S    L        +  L S+      L E +P   LY+ L+  L      
Sbjct: 67  PGLTVELSHSRAGLLAEPLAAAAIDWLSSLTAAS--LAEGQPHARLYEALDAVLAAIEYA 124

Query: 124 PSVIG--KIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAE 181
           PS  G     V+ ELML+ ++G+ LDL+ C  TG   DL +VSPKSGGAV R+ G PYA 
Sbjct: 125 PSARGWAAAAVRYELMLMADLGYALDLSACAATGARDDLAYVSPKSGGAVSRAAGEPYAA 184

Query: 182 KMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNK 215
           ++L LP+FL       D   +    +LT +FL +
Sbjct: 185 RLLPLPAFLVDPSADSDWSDIVDGMRLTGHFLAR 218


>gi|83593184|ref|YP_426936.1| DNA repair protein RecO [Rhodospirillum rubrum ATCC 11170]
 gi|119361481|sp|Q2RT96|RECO_RHORT RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|83576098|gb|ABC22649.1| Recombination protein O, RecO [Rhodospirillum rubrum ATCC 11170]
          Length = 252

 Score =  134 bits (337), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 84/241 (34%), Positives = 124/241 (51%), Gaps = 7/241 (2%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRL 62
           W D  I+L  R +GE  +I+ +++  +GRH G VR G+  R++  LQ G+LV+  W++RL
Sbjct: 4   WSDRGIVLAARPHGEDGVIVSLLSAGHGRHSGIVRGGRGKRLRAALQPGSLVQATWKARL 63

Query: 63  AQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFR-FLPEREPCLELYDMLNIFL--- 118
             +LG    E+L      LL     L  L +   L    LPER P  ++YD     L   
Sbjct: 64  EDHLGSLVVELLAGVAGGLLDDRDRLAALAAACALAETVLPERAPQADVYDATLALLDAL 123

Query: 119 --NCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVG 176
                  P V    FV+ E+ LL  +GFGLDL+ C V+G   DL +VSP+SG AV R  G
Sbjct: 124 AEGGEGTPLVWAGAFVRWEIGLLAALGFGLDLSCCAVSGECGDLAYVSPRSGRAVGREAG 183

Query: 177 LPYAEKMLVLPSFLWK-EEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGK 235
            P+  ++L LP+FL    E   +A ++    +L+ YFL  + L          R+ F+ +
Sbjct: 184 APWQARLLALPAFLLSPAEVPANAQAVGDGLRLSGYFLEGHVLAPQGRGLPASRQRFVER 243

Query: 236 L 236
           L
Sbjct: 244 L 244


>gi|330994746|ref|ZP_08318668.1| DNA repair protein recO [Gluconacetobacter sp. SXCC-1]
 gi|329758007|gb|EGG74529.1| DNA repair protein recO [Gluconacetobacter sp. SXCC-1]
          Length = 263

 Score =  134 bits (337), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 81/246 (32%), Positives = 121/246 (49%), Gaps = 10/246 (4%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+  A++L    YGE + I+ V+T +YG + G  R G + R +   Q GNLVR  W +
Sbjct: 1   MEWEAPALVLSATPYGEGSAIVHVLTGEYGLYHGLARGGSASRGRATWQTGNLVRARWTA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLF-RFLPEREPCLELYDMLN---- 115
           RL + LG    E + +  A+LL   L L  L S+  L    LPEREP   ++  L     
Sbjct: 61  RLPEQLGSITAETVHASAARLLDYPLPLAMLASLCALADDCLPEREPHPAIFQGLTSLLA 120

Query: 116 -IFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRS 174
            I L+     +      V+ ELMLL ++GFGLDL  C + G  +DL WVSP++G AV   
Sbjct: 121 RISLDPQWAETEAMPEIVRWELMLLSDLGFGLDLGGCALGGSREDLRWVSPRTGRAVSDE 180

Query: 175 VGLPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLG 234
               + +++L LP F+   +Q           +L+ +FL + A        H       G
Sbjct: 181 KAGAWRDRLLPLPGFILHPQQVATPRDWHDGLRLSGHFLRRDAFGQR----HRPVPEARG 236

Query: 235 KLLELI 240
           +L ++I
Sbjct: 237 RLADMI 242


>gi|16125811|ref|NP_420375.1| DNA repair protein RecO [Caulobacter crescentus CB15]
 gi|20139676|sp|Q9A802|RECO_CAUCR RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|13422953|gb|AAK23543.1| conserved hypothetical protein [Caulobacter crescentus CB15]
          Length = 250

 Score =  134 bits (336), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 70/217 (32%), Positives = 112/217 (51%), Gaps = 1/217 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           + W+D+A +L  RS+GE   I+E++T   G+    V    S RM+P LQ G  V V +R+
Sbjct: 8   LEWEDEAYVLSARSHGETGAIVELLTEARGKVAAHVAGAASRRMKPFLQPGARVIVRYRA 67

Query: 61  RLAQNLGEFRFEVLESHCAKLLSS-SLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLN 119
           ++   LG    E +    + L            +       LPERE     +  L   + 
Sbjct: 68  KVEGQLGSATLEPMGEGPSSLFDDRLALAGLSAAAAVAAAALPEREAHPGAFHALEALIR 127

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
             +IP +   ++V+ E  LL+ +GFGLDL+KC  TG   DL++VSP++G AV R  G PY
Sbjct: 128 VLEIPEIWPAVYVRYEAGLLQELGFGLDLSKCAATGAFDDLVYVSPRTGRAVSREAGKPY 187

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKY 216
            +K+L LP F+   +  +    +K+   +T +FL ++
Sbjct: 188 HDKLLPLPPFMLSSQGGLAEGDVKAGLDITGHFLEQF 224


>gi|310815097|ref|YP_003963061.1| DNA repair protein RecO [Ketogulonicigenium vulgare Y25]
 gi|308753832|gb|ADO41761.1| DNA repair protein RecO [Ketogulonicigenium vulgare Y25]
          Length = 241

 Score =  133 bits (335), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 78/215 (36%), Positives = 115/215 (53%), Gaps = 5/215 (2%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRL 62
           WQD+ I+L    +GE  +I +V T++ G+  G VR G   RMQP+L  GN + + WR+RL
Sbjct: 4   WQDEGILLTTHRHGEAGVIAQVFTQERGKISGLVRGGAGSRMQPVLIPGNQLSLRWRARL 63

Query: 63  AQNLGEFRFEVLESHCAKLLSSSL-FLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCH 121
             +LG  + E++ S    L+   L    G      L   +PER P    Y      L+  
Sbjct: 64  DDHLGSLQPELIRSRAGFLMQDRLSLAAGAAVTALLAATMPERVPHTAFYAQSTALLDLV 123

Query: 122 KIP---SVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
            +    S+    ++Q E++LL+  GFGLDLT C VTG   DL +VSPKSG AV +S    
Sbjct: 124 GVEDWQSLWPLAYLQWEMVLLREGGFGLDLTTCAVTGAADDLCYVSPKSGRAVSKSGAGA 183

Query: 179 YAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFL 213
           +AE++L LP+ + + E   D   +  A   T++FL
Sbjct: 184 WAERLLPLPAVM-RGEGDADTSDILQALATTEWFL 217


>gi|239947680|ref|ZP_04699433.1| DNA repair protein RecO [Rickettsia endosymbiont of Ixodes
           scapularis]
 gi|239921956|gb|EER21980.1| DNA repair protein RecO [Rickettsia endosymbiont of Ixodes
           scapularis]
          Length = 234

 Score =  132 bits (333), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 78/223 (34%), Positives = 121/223 (54%), Gaps = 5/223 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M  +D  +I+  +   E   I+ V T+ +G + G V+   S + + I Q GN+V   W++
Sbjct: 1   MNIKDIGVIIAKKPLKENTFIITVFTKNHGLYSGVVKES-SKKSKFIYQEGNIVDFLWQA 59

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFL-PEREPCLELYDML-NIFL 118
           RL +++G  + E+++S+    + +   LY   S++ L + L  ERE     +  L N   
Sbjct: 60  RLHEHIGMAKCELIKSYTGYFIINKAKLYAFNSVISLIKELFHEREEHSNFFSFLINYLD 119

Query: 119 NCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
           N  K  +   + ++  EL LL   G+ LDLTKC V+ VT DL +VSPKSG A+   VG P
Sbjct: 120 NLSK--NFCFRDYINFELALLAETGYKLDLTKCDVSHVTTDLTYVSPKSGRALSYKVGKP 177

Query: 179 YAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHN 221
           Y +K+L+LP FL  E   I  +  K A  LT+YF N+Y   +N
Sbjct: 178 YKDKLLILPRFLLSENSEITLEEKKQAITLTNYFFNRYLFHNN 220


>gi|157825871|ref|YP_001493591.1| DNA repair protein RecO [Rickettsia akari str. Hartford]
 gi|254764658|sp|A8GNV8|RECO_RICAH RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|157799829|gb|ABV75083.1| DNA repair protein RecO [Rickettsia akari str. Hartford]
          Length = 237

 Score =  132 bits (331), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 82/239 (34%), Positives = 130/239 (54%), Gaps = 7/239 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M  +D  +I+  +   E   I+ V T+ +G + G V+   S + + I Q GN+V   W++
Sbjct: 1   MNIKDVGVIISKKPLKENTFIITVCTKNHGLYSGVVKES-SKKSKFIYQEGNIVDFLWQA 59

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFL-PEREPCLELYD-MLNIFL 118
           RL +++G  + E+++S+   L+ +   LY   SI+ L + L  ERE     +  +LN   
Sbjct: 60  RLHEHIGIAKCELIKSYTGYLIINKTKLYAFNSIISLIKELCHEREKHSNFFSFLLNYLD 119

Query: 119 NCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
           N  K  +   + ++  EL LL   G+ LDLTKC VT VT DL +VSPKS  A+   VG P
Sbjct: 120 NLSK--NFCFRDYINFELTLLAKTGYKLDLTKCGVTHVTTDLTYVSPKSARALSYEVGKP 177

Query: 179 YAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLL 237
           Y +K+L+LP FL  ++  I  +  + A  LT+YF N+Y   +N       R+ F+G +L
Sbjct: 178 YKDKLLILPKFLLSDDSEITLEEKRQALTLTNYFFNRYLFHNN--RQPEARQTFVGYIL 234


>gi|167645704|ref|YP_001683367.1| DNA repair protein RecO [Caulobacter sp. K31]
 gi|189039651|sp|B0T3I3|RECO_CAUSK RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|167348134|gb|ABZ70869.1| DNA repair protein RecO [Caulobacter sp. K31]
          Length = 243

 Score =  131 bits (329), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 73/217 (33%), Positives = 121/217 (55%), Gaps = 1/217 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D+A +L  R +GE   I+E++T++ G+ +  V    S RM+P LQAG  V   +R+
Sbjct: 1   MEWEDEAFVLSARVHGETGAIVELLTQERGKFVAHVSGAASRRMKPFLQAGAKVIARYRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFL-PEREPCLELYDMLNIFLN 119
           R++  +G    E +    + L    L L GL +   +     PERE     +  L   + 
Sbjct: 61  RMSDQMGAATLEPMGEGPSSLFDEPLALSGLSAAASVAAGALPEREAHPGAFHALEALIA 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
              IP++   ++V+ E  LL+++GFGLDL+KC  TG   DL++VSP++G AV R+ G PY
Sbjct: 121 ALAIPAIWPAVYVRFEAGLLQDLGFGLDLSKCAATGSLDDLVYVSPRTGRAVSRAAGQPY 180

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKY 216
            +K+L LP F+   +  +    +K+   +T +FL ++
Sbjct: 181 HDKLLPLPPFMLSAQGGLVEGDVKAGLDITGHFLEQF 217


>gi|148284965|ref|YP_001249055.1| DNA repair protein RecO [Orientia tsutsugamushi str. Boryong]
 gi|254764648|sp|A5CF17|RECO_ORITB RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|146740404|emb|CAM80867.1| DNA repair protein [Orientia tsutsugamushi str. Boryong]
          Length = 241

 Score =  130 bits (328), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 78/220 (35%), Positives = 125/220 (56%), Gaps = 2/220 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M ++D AIIL  R+  E   I+ V+T+ YG + G +++  S +   I Q GN+V   W +
Sbjct: 1   MNFRDKAIILKKRNIKENLAIVTVLTQSYGIYSGIIKDLHSKKNTIIYQIGNIVDFCWSA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPL-FRFLPEREPCLELYDMLNIFLN 119
           RL ++LG    E+++S+   ++S+   L+   S++ L      ERE    L++     L 
Sbjct: 61  RLDKHLGTINCELVKSYSYLIMSNKRNLFYTHSLIELTLMSFKERELHANLFEKWLGNLE 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
              + ++  K ++  EL++LK  G+ L L +C VT  TQ+L++VSPKSG A+  +VG PY
Sbjct: 121 SINVGNINIKNYINFELLILKEAGYQLTLDRCGVTNCTQNLIYVSPKSGQAISAAVGEPY 180

Query: 180 AEKMLVLPSFLWKEE-QTIDADSLKSAFQLTDYFLNKYAL 218
             K+L+LP FL     +  D   +++AF LT YF NKY L
Sbjct: 181 KHKLLLLPKFLVHNNCEPEDIYEIQAAFNLTAYFFNKYVL 220


>gi|229586870|ref|YP_002845371.1| DNA repair protein RecO [Rickettsia africae ESF-5]
 gi|259563683|sp|C3PNW8|RECO_RICAE RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|228021920|gb|ACP53628.1| DNA repair protein RecO [Rickettsia africae ESF-5]
          Length = 237

 Score =  130 bits (327), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 73/223 (32%), Positives = 124/223 (55%), Gaps = 5/223 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M  +D  +I+  ++  E   I+ V T+ +G + G V+   S + + I Q GN++   W++
Sbjct: 1   MNIKDIGVIIAKKTLKENTFIITVFTKNHGLYSGVVKEF-SKKSKFIYQEGNIIDFLWQA 59

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFR-FLPEREPCLELYDML-NIFL 118
           RL +++G  + E+++S+    +++   LY   S++ L +    ERE   + +  L N   
Sbjct: 60  RLHEHIGMAKCELIKSYTGYFITNKAKLYAFNSVISLIKELFHEREEHSKFFSFLINYLD 119

Query: 119 NCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
           N  K  +   + ++  EL LL   G+ LDLTKC V+ VT DL++VSPKS  A+  +VG P
Sbjct: 120 NLSK--NFCFRDYINFELALLAETGYKLDLTKCGVSHVTTDLIYVSPKSARALSYAVGKP 177

Query: 179 YAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHN 221
           Y +K+L+LP FL  +   I  +  + A  LT+YF N+Y   +N
Sbjct: 178 YKDKLLMLPRFLLSDNSEITLEEKRQALALTNYFFNRYLFHNN 220


>gi|119385562|ref|YP_916617.1| DNA repair protein RecO [Paracoccus denitrificans PD1222]
 gi|254764650|sp|A1B5X7|RECO_PARDP RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|119376157|gb|ABL70921.1| DNA repair protein RecO [Paracoccus denitrificans PD1222]
          Length = 242

 Score =  130 bits (326), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 74/215 (34%), Positives = 110/215 (51%), Gaps = 6/215 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W  +A ++ ++ +GE  +IL V++R+ G   G V  G S +   +LQ GN V + WR+
Sbjct: 1   MEWSGEASVMALQRHGESAVILTVLSRETGLIRGLVPGGASAKRAAMLQPGNRVSLRWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLN 119
           RL + LG F  E   +    LL S   L G+ ++  L  F LPER+P   L D     L+
Sbjct: 61  RLEEQLGTFAVEPARARPG-LLGSGDALAGVNAVTALLTFALPERDPHPRLADATEALLD 119

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                    + ++  E+ LL  +GFGLDLT C VTG  + L +VSP+SG AV       +
Sbjct: 120 LMDAGEGWAEAYLHWEMRLLDELGFGLDLTSCAVTGAREGLAYVSPRSGRAVSAQAAGEW 179

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLN 214
           A ++L LP+ L           ++ A  LT +FL 
Sbjct: 180 APRLLPLPAMLGGRGN----GGIEDALALTGHFLQ 210


>gi|67459260|ref|YP_246884.1| DNA repair protein RecO [Rickettsia felis URRWXCal2]
 gi|75536308|sp|Q4UL54|RECO_RICFE RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|67004793|gb|AAY61719.1| DNA repair protein RecO [Rickettsia felis URRWXCal2]
          Length = 237

 Score =  129 bits (323), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 76/223 (34%), Positives = 121/223 (54%), Gaps = 5/223 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M  +D  +I+  +   E   I+ V T+ +G + G V+   S + + I Q GN+V   W++
Sbjct: 1   MNIKDVGVIIAKKPLKENTFIITVFTKNHGLYSGVVKES-SKKSKFIYQEGNIVDFLWQA 59

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFL-PEREPCLELYDML-NIFL 118
           RL +++G  + E+++S+    + +   LY   S++ L + L  ERE     +  L N   
Sbjct: 60  RLHEHIGMAKCELIKSYTGYFIINKAKLYAFNSVISLIKELFHEREEHSNFFSFLINYLD 119

Query: 119 NCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
           N  K  +   + ++  EL LL   G+ LDLTKC VT VT DL +VSPKS  A+   VG P
Sbjct: 120 NLSK--NFCFRDYINFELALLAETGYKLDLTKCGVTHVTTDLNYVSPKSARALSYEVGKP 177

Query: 179 YAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHN 221
           Y +K+L+LP FL  ++  I  +  + A  LT+YF N+Y   +N
Sbjct: 178 YKDKLLILPKFLLSDDSEITLEEKRQASTLTNYFFNRYLFHNN 220


>gi|189184083|ref|YP_001937868.1| DNA repair protein RecO [Orientia tsutsugamushi str. Ikeda]
 gi|254764649|sp|B3CTD7|RECO_ORITI RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|189180854|dbj|BAG40634.1| DNA repair protein RecO [Orientia tsutsugamushi str. Ikeda]
          Length = 241

 Score =  129 bits (323), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 78/220 (35%), Positives = 124/220 (56%), Gaps = 2/220 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M ++D AIIL  R+  E   I+ V+T+ YG + G +++  S +   I Q GN+V   W +
Sbjct: 1   MNFRDKAIILKKRNIKENLAIVTVLTQSYGIYSGIIKDLHSKKNTIIYQIGNIVDFCWSA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPL-FRFLPEREPCLELYDMLNIFLN 119
           RL ++LG    E+++S+   ++S+   L    S++ L      ERE    L++     L 
Sbjct: 61  RLDEHLGTINCELVKSYSYLIMSNKRNLLYTHSLIELTLMSFKERELHANLFEKWLENLE 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                ++  K ++  EL++LK  G+ L+L +C VT  TQ+L++VSPKSG A+  +VG PY
Sbjct: 121 SINTGNINVKNYINFELLILKEAGYRLNLDRCGVTNCTQNLIYVSPKSGQAISATVGEPY 180

Query: 180 AEKMLVLPSFLWKEE-QTIDADSLKSAFQLTDYFLNKYAL 218
             K+L+LP FL     +  D   +++AF LT YF NKY L
Sbjct: 181 KHKLLLLPKFLVHNNCEPEDIYEIQAAFNLTAYFFNKYIL 220


>gi|15892735|ref|NP_360449.1| DNA repair protein RecO [Rickettsia conorii str. Malish 7]
 gi|34581542|ref|ZP_00143022.1| hypothetical protein [Rickettsia sibirica 246]
 gi|81595557|sp|Q92HF9|RECO_RICCN RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|15619911|gb|AAL03350.1| unknown [Rickettsia conorii str. Malish 7]
 gi|28262927|gb|EAA26431.1| unknown [Rickettsia sibirica 246]
          Length = 237

 Score =  128 bits (322), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 73/223 (32%), Positives = 122/223 (54%), Gaps = 5/223 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M  +D  +I+  +   E   I+ V T+ +G + G V+   S + + I Q GN++   W++
Sbjct: 1   MNIKDIGVIIAKKPLKENTFIITVFTKNHGLYSGVVKEF-SKKSKFIYQEGNIIDFLWQA 59

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFR-FLPEREPCLELYDML-NIFL 118
           RL +++G  + E+++S+    +++   LY   S++ L +    ERE   + +  L N   
Sbjct: 60  RLHEHIGMAKCELIKSYTGYFITNKAKLYAFNSVISLIKELFHEREEHSKFFSFLINYLD 119

Query: 119 NCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
           N  K  +   + ++  EL LL   G+ LDLTKC V+ VT DL++VSPKS  A+   VG P
Sbjct: 120 NLSK--NFCFRDYINFELALLAETGYKLDLTKCGVSHVTTDLIYVSPKSARALSYEVGKP 177

Query: 179 YAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHN 221
           Y +K+L+LP FL  +   I  +  + A  LT+YF N+Y   +N
Sbjct: 178 YKDKLLMLPRFLLSDNSEITLEEKRQALALTNYFFNRYLFHNN 220


>gi|329890071|ref|ZP_08268414.1| recombinational DNA repair protein RecF pathway [Brevundimonas
           diminuta ATCC 11568]
 gi|328845372|gb|EGF94936.1| recombinational DNA repair protein RecF pathway [Brevundimonas
           diminuta ATCC 11568]
          Length = 200

 Score =  128 bits (321), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 66/174 (37%), Positives = 96/174 (55%), Gaps = 1/174 (0%)

Query: 44  MQPILQAGNLVRVNWRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LP 102
           M+P LQ G  V  + RSR +  LG  R E +    A L    L L GL +   + +  LP
Sbjct: 1   MRPFLQPGARVVADLRSRTSDQLGSARLEPVGEGPAALFDDPLALTGLSAAAAVAQGALP 60

Query: 103 EREPCLELYDMLNIFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLW 162
           EREP    +      +    +P V   IFV+ E  LL+++GFGLDL++C  TG   DL+W
Sbjct: 61  EREPHPGAFYAFEALMGAFAVPEVWPAIFVRFEAGLLEDLGFGLDLSRCASTGSMDDLVW 120

Query: 163 VSPKSGGAVCRSVGLPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKY 216
           VSP++G AV R  G PYA+K+L LP F+   +  +    +K+  +LT +FL ++
Sbjct: 121 VSPRTGRAVSREAGAPYADKLLALPPFMLGAQAGLGEGDVKAGLELTGHFLEQF 174


>gi|269958745|ref|YP_003328532.1| DNA repair protein RecO [Anaplasma centrale str. Israel]
 gi|269848574|gb|ACZ49218.1| DNA repair protein RecO [Anaplasma centrale str. Israel]
          Length = 238

 Score =  128 bits (321), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 73/227 (32%), Positives = 123/227 (54%), Gaps = 10/227 (4%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W++  +++G R YG+++++L ++TR  G   G  R  +    +P LQ G+L+   WR+
Sbjct: 1   MQWREMGVVMGTRPYGDEHLLLSILTRNRGLRRGLTRFTKK---RP-LQIGDLIDATWRA 56

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLN 119
           +L  NLG F +EV+ S         + L  L SI  +    LPE EP   LYD    F  
Sbjct: 57  KLPTNLGHFTYEVITSAFYSYFRDRIKLMCLSSITHIMSTALPENEPHPTLYDSFQDFAA 116

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
             +  +     ++++EL++L  +GF LDL+KC V+    +LL++SPK+G A+  +VG  Y
Sbjct: 117 AAEAEAPWYNHYLKLELLVLSQLGFALDLSKCAVSNSKDNLLFISPKTGRALSEAVGCAY 176

Query: 180 AEKMLVLPSFLWK-----EEQTIDADSLKSAFQLTDYFLNKYALQHN 221
            +K+L LP  L       E +   AD    + ++  +FL+++ LQ +
Sbjct: 177 RDKLLPLPKVLRSISCGVETECCSADEFALSLKILGFFLHRHLLQES 223


>gi|157828681|ref|YP_001494923.1| DNA repair protein RecO [Rickettsia rickettsii str. 'Sheila Smith']
 gi|165933400|ref|YP_001650189.1| DNA repair protein RecO [Rickettsia rickettsii str. Iowa]
 gi|254790735|sp|B0BY57|RECO_RICRO RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|254790736|sp|A8GSP0|RECO_RICRS RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|157801162|gb|ABV76415.1| DNA repair protein RecO [Rickettsia rickettsii str. 'Sheila Smith']
 gi|165908487|gb|ABY72783.1| DNA repair protein [Rickettsia rickettsii str. Iowa]
          Length = 237

 Score =  128 bits (321), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 73/223 (32%), Positives = 121/223 (54%), Gaps = 5/223 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M  +D  +I+  +   E   I+ V T+ +G + G V+   S + + I Q GN++   W++
Sbjct: 1   MNIKDIGVIIAKKPLKENTFIITVFTKNHGLYSGVVKEF-SKKSKFIYQEGNIIDFLWQA 59

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFR-FLPEREPCLELYDML-NIFL 118
           RL +++G  + E+++S+    +++   LY   S++ L +    ERE   + +  L N   
Sbjct: 60  RLHEHIGMAKCELIKSYTGYFITNKTKLYAFNSVISLIKELFHEREEHSKFFSFLINYLD 119

Query: 119 NCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
           N  K      + ++  EL LL   G+ LDLTKC V+ VT DL++VSPKS  A+   VG P
Sbjct: 120 NLSK--HFCFRDYINFELALLAETGYKLDLTKCGVSHVTTDLIYVSPKSARALSYEVGKP 177

Query: 179 YAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHN 221
           Y +K+L+LP FL  +   I  +  + A  LT+YF N+Y   +N
Sbjct: 178 YKDKLLMLPRFLLSDNSEITLEEKRQALALTNYFFNRYLFHNN 220


>gi|83951646|ref|ZP_00960378.1| DNA repair protein RecO [Roseovarius nubinhibens ISM]
 gi|83836652|gb|EAP75949.1| DNA repair protein RecO [Roseovarius nubinhibens ISM]
          Length = 257

 Score =  128 bits (321), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 74/216 (34%), Positives = 122/216 (56%), Gaps = 3/216 (1%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRL 62
           W+D  ++L VR +GE ++I++V+T+ +GR+ G VR G S +++P+LQ G  + + WR+RL
Sbjct: 4   WRDRGLLLAVRPHGETSVIIDVLTQDHGRYAGVVRGGTSRKLRPVLQPGAELDLVWRARL 63

Query: 63  AQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLNCH 121
             ++G F  E + +  A  L     L GL ++  + RF L ERE    L++     L   
Sbjct: 64  DSHMGAFTVEPIRASLAVGLGVRQALAGLNAVTAMLRFALAEREAHGPLFERSLGLLEMI 123

Query: 122 KIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTG-VTQDLLWVSPKSGGAVCRSVGLPYA 180
               +    ++  E+ LL  +GFGLDL+ C V G    DL +VSP++G AV R     +A
Sbjct: 124 GEAELWPLAYLHWEMALLDELGFGLDLSTCAVLGREANDLSFVSPRTGRAVSRKGAGEWA 183

Query: 181 EKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKY 216
           +++L LP+ L  E     A+ L   F +T +FL+++
Sbjct: 184 DRLLPLPNCLL-EIAPAPAEDLVQGFAVTGHFLSQH 218


>gi|15604714|ref|NP_220921.1| DNA repair protein RecO [Rickettsia prowazekii str. Madrid E]
 gi|292572163|gb|ADE30078.1| DNA repair protein RecO [Rickettsia prowazekii Rp22]
          Length = 236

 Score =  127 bits (319), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 72/223 (32%), Positives = 120/223 (53%), Gaps = 5/223 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M  +D  +I+  +   E   I+ V T+ +G + G ++   S + + I Q GN+V   W++
Sbjct: 1   MNIKDIGVIISKKPLKENTFIIRVFTKNHGLYSGVIKES-SKKNKFIYQEGNIVDFLWKA 59

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFR--FLPEREPCLELYDMLNIFL 118
           RL +++G  + E+++S+    + +   LY   S++ L +  F    E  +    ++N   
Sbjct: 60  RLHEHIGIAKCELIKSYTGYFIINKAKLYAFNSVISLIQELFHEREEHSIFFSFLINYLD 119

Query: 119 NCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
           N  K  +   + ++  EL LL   G+ LDLTKC V+ VT DL +VSPKS  A+   VG P
Sbjct: 120 NLSK--NFCFRDYISFELNLLAETGYKLDLTKCCVSHVTTDLTYVSPKSARALSYKVGKP 177

Query: 179 YAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHN 221
           Y +K+L+LP FL  ++  I  +  K A  LT+YF N+Y   +N
Sbjct: 178 YRDKLLILPKFLLAKDSEITLEEKKQALTLTNYFFNRYLFHNN 220


>gi|238650314|ref|YP_002916166.1| DNA repair protein RecO [Rickettsia peacockii str. Rustic]
 gi|259563684|sp|C4K0L7|RECO_RICPU RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|238624412|gb|ACR47118.1| DNA repair protein RecO [Rickettsia peacockii str. Rustic]
          Length = 237

 Score =  127 bits (318), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 72/223 (32%), Positives = 123/223 (55%), Gaps = 5/223 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M  +D  +I+  +   E   I+ V T+ +G + G V+   S + + I Q GN++   W++
Sbjct: 1   MNIKDIGVIIAKKPLKENTFIITVFTKNHGLYSGVVKEF-SKKSKFIYQEGNIIDFLWQA 59

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFR-FLPEREPCLELY-DMLNIFL 118
           RL +++G  + E+++S+    +++   LY   S++ L +    ERE   + +  ++N   
Sbjct: 60  RLHEHIGMAKCELIKSYTGYFITNKAKLYAFNSVISLIKELFHEREEHSKFFLFLINYLD 119

Query: 119 NCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
           N  K  +   + ++  EL LL   G+ LDLTKC V+ VT DL++VSPKS  A+   VG P
Sbjct: 120 NLSK--NFCFRDYINFELALLAETGYKLDLTKCGVSHVTTDLIYVSPKSARALSYEVGKP 177

Query: 179 YAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHN 221
           Y +K+L+LP FL  +   I  +  + A  LT+YF N+Y   +N
Sbjct: 178 YKDKLLMLPRFLLSDNSEITLEEKRQALALTNYFFNRYLFHNN 220


>gi|126726092|ref|ZP_01741934.1| DNA repair protein RecO [Rhodobacterales bacterium HTCC2150]
 gi|126705296|gb|EBA04387.1| DNA repair protein RecO [Rhodobacterales bacterium HTCC2150]
          Length = 245

 Score =  126 bits (316), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 83/217 (38%), Positives = 125/217 (57%), Gaps = 3/217 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D   I+ VR +GE + I+EV T+  GRH G VR   S ++ P LQ G  V V+WR+
Sbjct: 1   MEWRDQGAIISVRHHGETSAIVEVFTKNQGRHAGVVRGATSRKIAPFLQPGGQVDVSWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLN 119
           RL ++LG F  E ++S  A ++S+ L L GL ++  L +F LPERE    LY+     L+
Sbjct: 61  RLNEHLGTFTIEPIQSR-AHVMSNPLALAGLNAVCALLQFTLPERESHPRLYETSIALLD 119

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                S     ++  E++LL ++GFGLDL++C VTG   DL +VSPKSG AV +S    +
Sbjct: 120 SISETSDWPLDYLHWEMLLLDDLGFGLDLSECAVTGTQGDLAYVSPKSGRAVSKSGAGEW 179

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKY 216
           A+++L L   L   + ++    L    + T +FL  +
Sbjct: 180 ADRLLPLTPCLIS-DASVGVTELIEGLRTTGHFLENH 215


>gi|56416838|ref|YP_153912.1| DNA repair protein RecO [Anaplasma marginale str. St. Maries]
 gi|81599148|sp|Q5PAM3|RECO_ANAMM RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|56388070|gb|AAV86657.1| hypothetical protein AM680 [Anaplasma marginale str. St. Maries]
          Length = 238

 Score =  125 bits (315), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 73/227 (32%), Positives = 121/227 (53%), Gaps = 10/227 (4%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W++  +++G R YG+++++L ++TR  G   G  R  +    +P LQ G+L+   WR+
Sbjct: 1   MQWREMGVVMGTRPYGDEHLLLSILTRNRGLRRGLTRFTKK---RP-LQIGDLIDATWRA 56

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLN 119
           +L  NLG F  EV+ S         + L  L SI  +    LPE EP   LYD    F  
Sbjct: 57  KLPTNLGHFTCEVIASAFYSYFRDRIKLMCLSSITHIMSTALPENEPHPTLYDSFQDFAA 116

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
             +  +     ++++EL++L  +GF LDL+KC V+    +LL++SPK+G A+  +VG  Y
Sbjct: 117 AAEAEAPWYNHYLKLELLVLSQLGFALDLSKCAVSNSKDNLLFISPKTGRALSEAVGCAY 176

Query: 180 AEKMLVLPSFLWK-----EEQTIDADSLKSAFQLTDYFLNKYALQHN 221
            +K+L LP  L       E +   AD    + ++  +FL ++ LQ +
Sbjct: 177 RDKLLPLPKVLRSISCGVETECCSADEFALSLRILGFFLRRHLLQES 223


>gi|306845265|ref|ZP_07477841.1| DNA repair protein RecO [Brucella sp. BO1]
 gi|306274424|gb|EFM56231.1| DNA repair protein RecO [Brucella sp. BO1]
          Length = 182

 Score =  125 bits (314), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 67/174 (38%), Positives = 98/174 (56%), Gaps = 5/174 (2%)

Query: 66  LGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPS 125
           +G F  E L    A+L+ + + LYG+Q      R LPER+P   LY+ L + +     P 
Sbjct: 1   MGTFTIEPLSFAAARLIETPVALYGIQLAAAHLRLLPERDPHRGLYETLRLIIEHFDDPL 60

Query: 126 VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKMLV 185
             G++ ++ E+M+L+ +GFGLDL +C  TG   DL++VSPKSG AVCR  G P+AEK+L 
Sbjct: 61  AAGELLLRFEVMMLEELGFGLDLKECAATGRKDDLIYVSPKSGRAVCREAGAPWAEKLLS 120

Query: 186 LPSFLWKEEQTIDA---DSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKL 236
           LPSF+   +  + A   D L  AF +T YFL ++  +         R  FL  +
Sbjct: 121 LPSFV--NDTALRASCYDDLDRAFTMTGYFLMRHVWEPRAQTPPDSRSGFLNAV 172


>gi|51473730|ref|YP_067487.1| DNA repair protein RecO [Rickettsia typhi str. Wilmington]
 gi|81610783|sp|Q68WI7|RECO_RICTY RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|51460042|gb|AAU04005.1| possible RecO-like recombinational DNA repair protein [Rickettsia
           typhi str. Wilmington]
          Length = 236

 Score =  125 bits (314), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 72/223 (32%), Positives = 119/223 (53%), Gaps = 5/223 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M  +D  +I+  +   E   I+ V T+ +G + G ++   S + + I Q GN+V   W++
Sbjct: 1   MNIKDIGVIISKKPLKENTFIIRVFTKNHGLYSGVIK-ASSKKNKFIYQEGNIVDFLWQA 59

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFR--FLPEREPCLELYDMLNIFL 118
           RL +++G  + E+++S+    + +   LY   S+  L +  F    E  +    ++N   
Sbjct: 60  RLHEHIGIAKCELIKSYTGYFIINKAKLYAFNSVKFLIQELFHEREEHSIFFAFLINYLD 119

Query: 119 NCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
           N  K  +   + ++  EL LL   G+ +DLTKC V+ VT DL +VSPKS  A+   VG P
Sbjct: 120 NLSK--NFCFRDYINFELNLLAETGYKIDLTKCCVSHVTTDLTYVSPKSARALSYKVGKP 177

Query: 179 YAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHN 221
           Y +K+L+LP FL  E+  I  +  K A  LT+YF N+Y   +N
Sbjct: 178 YRDKLLILPKFLLSEDSKITLEEKKQALTLTNYFFNRYLFHNN 220


>gi|99035892|ref|ZP_01314943.1| hypothetical protein Wendoof_01000221 [Wolbachia endosymbiont of
           Drosophila willistoni TSC#14030-0811.24]
          Length = 240

 Score =  125 bits (314), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 80/227 (35%), Positives = 128/227 (56%), Gaps = 17/227 (7%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVR--NGQSHRMQPILQAGNLVRVNW 58
           M W+D+ II+  + YG+KN+IL + T+ +G+  G  +  N  +++     Q  NL+   W
Sbjct: 1   MRWKDEGIIIAAKKYGDKNLILSLFTKNHGKRRGLTKLTNNSNYK----FQISNLLHAEW 56

Query: 59  RSRLAQNLGEFRFEVLES---HCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLN 115
            ++L +NLG F+ E++ES   H  +    S+ +    SI  L + LPE EPC  LYD   
Sbjct: 57  SAKLPENLGFFKCELIESPFHHFFQDRLKSITIVSFSSI--LEKVLPESEPCAMLYDNFR 114

Query: 116 IFLNCHKIPSVIGKI-FVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRS 174
            F++  K  +   +  ++ +EL+LL  +GF LDL+KC VTGV ++L ++SPK+G AV + 
Sbjct: 115 YFIDVIKHNNQSWQSHYLNLELLLLTQLGFKLDLSKCAVTGVKENLQFISPKTGRAVSKK 174

Query: 175 VGLPYAEKMLVLPSFLWKE-----EQTIDADSLKSAFQLTDYFLNKY 216
           VG  YA+K+L  P  L        + +      +   ++T YFLNKY
Sbjct: 175 VGDYYADKLLPFPQMLHDVYNNNLQNSYSFQEFQLGLKVTGYFLNKY 221


>gi|190570798|ref|YP_001975156.1| recO-related protein [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|213019675|ref|ZP_03335480.1| recO-related protein [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
 gi|254790742|sp|B3CPG9|RECO_WOLPP RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|190357070|emb|CAQ54467.1| recO-related protein [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|212994716|gb|EEB55359.1| recO-related protein [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
          Length = 242

 Score =  124 bits (312), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 79/227 (34%), Positives = 129/227 (56%), Gaps = 17/227 (7%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVR--NGQSHRMQPILQAGNLVRVNW 58
           M W+D+ +I+ V+ YG+KN+IL + T+ +G+  G  R  N  +++     Q  NL+   W
Sbjct: 1   MRWKDEGVIIAVKKYGDKNLILSLFTKNHGKCRGLTRLTNNSNYK----FQISNLLHAEW 56

Query: 59  RSRLAQNLGEFRFEVLES---HCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLN 115
            ++L +NLG  + E++ES   H  +    S+ +    SI+   + LPE E C++LYD   
Sbjct: 57  SAKLPENLGFLKCELIESPFHHFFQDRLKSIAIVSFSSILE--KVLPESESCIKLYDNFR 114

Query: 116 IFLNCHKIPSVIGKI-FVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRS 174
            F++  K  S   +  ++ +EL+LL  +GF LDL+KC VTGV ++L ++SPK+G AV + 
Sbjct: 115 HFIDVIKHNSQFWQSHYLNLELLLLTQLGFKLDLSKCAVTGVKENLQFISPKTGRAVSKK 174

Query: 175 VGLPYAEKMLVLPSFLWKE-----EQTIDADSLKSAFQLTDYFLNKY 216
           VG  YA+K+L  P  L        + +      +   ++T YFLNKY
Sbjct: 175 VGDCYADKLLPFPQMLHDVYNNNLQNSYSYQEFRLGLKITGYFLNKY 221


>gi|225631179|ref|ZP_03787882.1| DNA repair protein RecO [Wolbachia endosymbiont of Muscidifurax
           uniraptor]
 gi|225591127|gb|EEH12306.1| DNA repair protein RecO [Wolbachia endosymbiont of Muscidifurax
           uniraptor]
          Length = 240

 Score =  124 bits (312), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 84/227 (37%), Positives = 127/227 (55%), Gaps = 17/227 (7%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVR--NGQSHRMQPILQAGNLVRVNW 58
           M W+D+ II+  + YG+KN+IL + T+ +G+  G  +  N  +++     Q  NL+   W
Sbjct: 1   MRWKDEGIIIAAKKYGDKNLILSLFTKNHGKRRGLTKLTNNSNYK----FQISNLLHAEW 56

Query: 59  RSRLAQNLGEFRFEVLES---HCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLN 115
            ++L +NLG F  E++ES   H  +    S+ +    SI  L + LPE EPC  LYD   
Sbjct: 57  SAKLPENLGFFECELIESPFHHFFQDRLKSITIVSFSSI--LEKVLPESEPCAMLYDNFR 114

Query: 116 IFLNCHKIPSVIGKI-FVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRS 174
            F++  K  +   +  ++ +EL+LL  +GF LDL+KC VTGV ++L ++SPK+G AV + 
Sbjct: 115 YFIDVIKHNNQSWQSHYLNLELLLLTQLGFKLDLSKCAVTGVKENLQFISPKTGRAVSKK 174

Query: 175 VGLPYAEKMLVLPSFLWK-EEQTIDADSLKSAFQL----TDYFLNKY 216
           VG  YA+K+L  P  L      T+        FQL    T YFLNKY
Sbjct: 175 VGDYYADKLLPFPQMLHDVYNNTLQNSYSFQEFQLGLKVTGYFLNKY 221


>gi|222475203|ref|YP_002563619.1| DNA repair protein RecO [Anaplasma marginale str. Florida]
 gi|254790506|sp|B9KIQ1|RECO_ANAMF RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|222419340|gb|ACM49363.1| DNA repair protein RecO [Anaplasma marginale str. Florida]
          Length = 238

 Score =  124 bits (312), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 73/227 (32%), Positives = 121/227 (53%), Gaps = 10/227 (4%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W++  +++G R YG+++++L ++TR  G   G  R  +    +P LQ G+L+   WR+
Sbjct: 1   MQWREMGVVMGTRPYGDEHLLLSILTRNRGLRRGLTRLTKK---RP-LQIGDLIDATWRA 56

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLN 119
           +L  NLG F  EV+ S         + L  L SI  +    LPE EP   LYD    F  
Sbjct: 57  KLPTNLGHFTCEVIASAFYSYFRDRIKLMCLSSITHIMSTALPENEPHPTLYDSFQDFAA 116

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
             +  +     ++++EL++L  +GF LDL+KC V+    +LL++SPK+G A+  +VG  Y
Sbjct: 117 AAEAEAPWYNHYLKLELLVLSQLGFALDLSKCAVSNSKDNLLFISPKTGRALSEAVGHAY 176

Query: 180 AEKMLVLPSFLWK-----EEQTIDADSLKSAFQLTDYFLNKYALQHN 221
             K+L LP  L       E +   AD    + ++  +FL+++ LQ +
Sbjct: 177 RNKLLPLPKVLRSISCGVETECCSADEFALSLKILGFFLHRHLLQES 223


>gi|157964679|ref|YP_001499503.1| DNA repair protein RecO [Rickettsia massiliae MTU5]
 gi|157844455|gb|ABV84956.1| DNA repair protein RecO [Rickettsia massiliae MTU5]
          Length = 274

 Score =  124 bits (312), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 74/223 (33%), Positives = 120/223 (53%), Gaps = 5/223 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M  +D  +I+  +   E   I+ V T+ +G + G V+   S + +   Q GN+V   W++
Sbjct: 38  MNIKDIGVIIAKKPLKENTFIITVFTKNHGLYSGVVKEF-SRKSKFTYQEGNIVDFLWQA 96

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFR-FLPEREPCLELYDML-NIFL 118
           RL ++LG  + E+++S+    +++   LY   S++ L +    ERE   +    L N   
Sbjct: 97  RLHEHLGMAKCELIKSYTGYFITNKAKLYAFNSVISLIKELFHEREEHSKFCSFLINYLD 156

Query: 119 NCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
           N  K  +   + ++  EL LL   G+ LDLTKC V+ VT DL++VSPKS  A+   VG P
Sbjct: 157 NLSK--NFCFRDYINFELALLAETGYKLDLTKCGVSHVTTDLIYVSPKSARALSYEVGKP 214

Query: 179 YAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHN 221
           Y +K+L+LP FL  +   I  +  + A  LT+YF N+Y   +N
Sbjct: 215 YKDKLLMLPRFLLSDNIEITLEEKRQALALTNYFFNRYLFHNN 257


>gi|306837524|ref|ZP_07470399.1| DNA repair protein RecO [Brucella sp. NF 2653]
 gi|306407416|gb|EFM63620.1| DNA repair protein RecO [Brucella sp. NF 2653]
          Length = 182

 Score =  124 bits (311), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 66/171 (38%), Positives = 97/171 (56%), Gaps = 5/171 (2%)

Query: 66  LGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPS 125
           +G F  E L    A+L+ + + LYG+Q      R LPER+P   LY+ L + +     P 
Sbjct: 1   MGTFTIEPLGFAAARLIETPVALYGIQLAAAHLRLLPERDPHRGLYETLRLIIEHFDDPL 60

Query: 126 VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKMLV 185
             G++ ++ E+M+L+ +GFGLDL +C  TG   DL++VSPKSG AVCR  G P+A+K+L 
Sbjct: 61  AAGELLLRFEVMMLEELGFGLDLKECAATGRKDDLIYVSPKSGRAVCREAGAPWADKLLA 120

Query: 186 LPSFLWKEEQTIDA---DSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFL 233
           LPSF+   +  + A   D L  AF +T YFL ++  +         R  FL
Sbjct: 121 LPSFV--NDTALRASCYDDLDRAFTMTGYFLMRHVWEPRAQTPPDSRSGFL 169


>gi|58418862|gb|AAW70877.1| Recombinational DNA repair protein RecO [Wolbachia endosymbiont
           strain TRS of Brugia malayi]
          Length = 245

 Score =  124 bits (311), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 79/225 (35%), Positives = 124/225 (55%), Gaps = 13/225 (5%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVR--NGQSHRMQPILQAGNLVRVNW 58
           M W+D+ II+  + YG+K++IL +  + +G+  G  R  N  S++     Q  NL+   W
Sbjct: 6   MRWKDEGIIIAAKKYGDKSLILSLFMKNHGKCRGLTRLTNDSSYK----FQVSNLLHAEW 61

Query: 59  RSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLF-RFLPEREPCLELYDMLNIF 117
            ++L +NLG F+ E++ES        SL    + S   +  + LPE EPC  LYD    F
Sbjct: 62  SAKLPENLGFFKCELIESPFHHFFQDSLKSITIVSFSSILEKVLPESEPCAVLYDNFQYF 121

Query: 118 LNCHKIPSVIGK-IFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVG 176
           ++  K  S   +  ++ +EL+LL  +GF LDL+KC VTGV ++L ++SPK+G AV + VG
Sbjct: 122 IDVIKHGSEPWQGHYLNLELLLLAQLGFKLDLSKCAVTGVKENLQFISPKTGRAVSKKVG 181

Query: 177 LPYAEKMLVLPSFLWKE-----EQTIDADSLKSAFQLTDYFLNKY 216
             YA+K+L  P  L        + +      +   ++T YFLNKY
Sbjct: 182 DYYADKLLPFPQMLHDVYNNNLQNSYSYQEFQLGLKVTGYFLNKY 226


>gi|42520114|ref|NP_966029.1| DNA repair protein RecO [Wolbachia endosymbiont of Drosophila
           melanogaster]
 gi|81652824|sp|Q73IE9|RECO_WOLPM RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|42409851|gb|AAS13963.1| recO-related protein [Wolbachia endosymbiont of Drosophila
           melanogaster]
          Length = 240

 Score =  124 bits (311), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 80/227 (35%), Positives = 128/227 (56%), Gaps = 17/227 (7%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVR--NGQSHRMQPILQAGNLVRVNW 58
           M W+D+ II+  + YG+KN+IL + T+ +G+  G  +  N  +++     Q  NL+   W
Sbjct: 1   MRWKDEGIIIAAKKYGDKNLILSLFTKNHGKRRGLTKLTNNSNYK----FQISNLLHAEW 56

Query: 59  RSRLAQNLGEFRFEVLES---HCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLN 115
            ++L +NLG  + E++ES   H  +    S+ +    SI  L + LPE EPC  LYD L 
Sbjct: 57  SAKLPENLGFLKCELIESPFHHFFQDRLKSITIVSFSSI--LEKVLPESEPCAMLYDNLR 114

Query: 116 IFLNCHKIPSVIGKI-FVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRS 174
            F++  K  +   +  ++ +EL+LL  +GF LDL+KC VTGV ++L ++SPK+G AV + 
Sbjct: 115 YFIDVIKHNNQSWQSHYLNLELLLLTQLGFKLDLSKCAVTGVKENLQFISPKTGRAVSKK 174

Query: 175 VGLPYAEKMLVLPSFLWKE-----EQTIDADSLKSAFQLTDYFLNKY 216
           VG  YA+K+L  P  L        + +      +   ++T YFLNKY
Sbjct: 175 VGDYYADKLLPFPQMLHDVYNNNLQNSYSFQEFQLGLKVTGYFLNKY 221


>gi|161899045|ref|YP_198119.2| DNA repair protein RecO [Wolbachia endosymbiont strain TRS of
           Brugia malayi]
          Length = 240

 Score =  124 bits (310), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 79/225 (35%), Positives = 124/225 (55%), Gaps = 13/225 (5%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVR--NGQSHRMQPILQAGNLVRVNW 58
           M W+D+ II+  + YG+K++IL +  + +G+  G  R  N  S++     Q  NL+   W
Sbjct: 1   MRWKDEGIIIAAKKYGDKSLILSLFMKNHGKCRGLTRLTNDSSYK----FQVSNLLHAEW 56

Query: 59  RSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLF-RFLPEREPCLELYDMLNIF 117
            ++L +NLG F+ E++ES        SL    + S   +  + LPE EPC  LYD    F
Sbjct: 57  SAKLPENLGFFKCELIESPFHHFFQDSLKSITIVSFSSILEKVLPESEPCAVLYDNFQYF 116

Query: 118 LNCHKIPSVIGK-IFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVG 176
           ++  K  S   +  ++ +EL+LL  +GF LDL+KC VTGV ++L ++SPK+G AV + VG
Sbjct: 117 IDVIKHGSEPWQGHYLNLELLLLAQLGFKLDLSKCAVTGVKENLQFISPKTGRAVSKKVG 176

Query: 177 LPYAEKMLVLPSFLWKE-----EQTIDADSLKSAFQLTDYFLNKY 216
             YA+K+L  P  L        + +      +   ++T YFLNKY
Sbjct: 177 DYYADKLLPFPQMLHDVYNNNLQNSYSYQEFQLGLKVTGYFLNKY 221


>gi|58697108|ref|ZP_00372549.1| DNA repair protein RecO [Wolbachia endosymbiont of Drosophila
           simulans]
 gi|58698226|ref|ZP_00373146.1| DNA repair protein RecO [Wolbachia endosymbiont of Drosophila
           ananassae]
 gi|225630040|ref|YP_002726831.1| DNA repair protein RecO [Wolbachia sp. wRi]
 gi|254790743|sp|C0R5J8|RECO_WOLWR RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|58535253|gb|EAL59332.1| DNA repair protein RecO [Wolbachia endosymbiont of Drosophila
           ananassae]
 gi|58536603|gb|EAL59934.1| DNA repair protein RecO [Wolbachia endosymbiont of Drosophila
           simulans]
 gi|225592021|gb|ACN95040.1| DNA repair protein RecO [Wolbachia sp. wRi]
          Length = 240

 Score =  124 bits (310), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 78/227 (34%), Positives = 127/227 (55%), Gaps = 17/227 (7%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVR--NGQSHRMQPILQAGNLVRVNW 58
           M W+D+ II+  + YG+KN+IL + T+ +G+  G  +  N  +++     Q  NL+   W
Sbjct: 1   MRWKDEGIIIAAKKYGDKNLILSLFTKNHGKRRGLTKLTNNSNYK----FQISNLLHAEW 56

Query: 59  RSRLAQNLGEFRFEVLES---HCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLN 115
            ++L +NLG F+ E++ES   H  +    S+ +    SI+   + LPE EPC  LYD   
Sbjct: 57  SAKLPENLGFFKCELIESSFHHFFQDRLKSITIVSFSSILE--KVLPESEPCAVLYDNFR 114

Query: 116 IFLNCHKIPSVIGKI-FVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRS 174
            F++  K  +   +  ++ +EL+LL  +GF LDL+KC VTGV ++L ++SPK+G AV + 
Sbjct: 115 YFIDVIKHNNQSWQSHYLNLELLLLTQLGFKLDLSKCAVTGVKENLQFISPKTGRAVSKK 174

Query: 175 VGLPYAEKMLVLPSFLWKE-----EQTIDADSLKSAFQLTDYFLNKY 216
            G  YA+K+L  P  L        + +      +   ++T YFLNKY
Sbjct: 175 AGDYYADKLLPFPQMLHDVYNNNLQNSYSFQEFQLGLKVTGYFLNKY 221


>gi|254995034|ref|ZP_05277224.1| DNA repair protein RecO [Anaplasma marginale str. Mississippi]
          Length = 233

 Score =  121 bits (304), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 71/221 (32%), Positives = 118/221 (53%), Gaps = 10/221 (4%)

Query: 7   AIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQNL 66
            +++G R YG+++++L ++TR  G   G  R  +    +P LQ G+L+   WR++L  NL
Sbjct: 2   GVVMGTRPYGDEHLLLSILTRNRGLRRGLTRLTKK---RP-LQIGDLIDATWRAKLPTNL 57

Query: 67  GEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLNCHKIPS 125
           G F +EV+ S         + L  L SI  +    LPE EP   LYD    F    +  +
Sbjct: 58  GHFTYEVIASAFYSYFRDRIKLMCLSSITHIMSTALPENEPHPTLYDSFQDFAAAAEAEA 117

Query: 126 VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKMLV 185
                ++++EL++L  +GF LDL+KC V+    +LL++SPK+G A+  +VG  Y  K+L 
Sbjct: 118 PWYNHYLKLELLVLSQLGFALDLSKCAVSNSKDNLLFISPKTGRALSEAVGHAYRNKLLP 177

Query: 186 LPSFLWK-----EEQTIDADSLKSAFQLTDYFLNKYALQHN 221
           LP  L       E +   AD    + ++  +FL+++ LQ +
Sbjct: 178 LPKVLRSISCGVETECCSADEFALSLKILGFFLHRHLLQES 218


>gi|161702946|ref|YP_303133.2| DNA repair protein RecO [Ehrlichia canis str. Jake]
          Length = 244

 Score =  121 bits (303), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 80/251 (31%), Positives = 138/251 (54%), Gaps = 21/251 (8%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQS--HRMQPILQAGNLVRVNW 58
           M WQD  I++ +R YG+  II+ + T+++G   G  R  +   HR    LQ G+ V V W
Sbjct: 1   MRWQDQGIVIAIRKYGDDQIIISIFTQKHGLKKGLARYQKKTIHR----LQIGDHVNVTW 56

Query: 59  RSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLF-RFLPEREPCLELYDMLNIF 117
            ++L  NLG F++E+++S     + ++L    +     +  + LPE E    +Y+ L+IF
Sbjct: 57  SAKLISNLGYFKYEIIKSTLHHYIHNNLKTMCIAFFTSILDQVLPENEENYTIYNHLDIF 116

Query: 118 LNCHKIPSVIGKI-FVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVG 176
           +N  +   V  +I ++ +EL LL  +GFGLDL++C V    ++L+++SPK+G A+ ++VG
Sbjct: 117 MNSVQNKDVNWQIKYLTLELTLLSELGFGLDLSQCAVNNTNENLIFISPKTGKAISQTVG 176

Query: 177 LPYAEKML--------VLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLL 228
           LPY + +L        V  ++ +K  +T      K +  +T YFL K+ L    I     
Sbjct: 177 LPYKKSLLPLPPLLYNVYNNYTYKYSKT----DFKVSLNVTGYFLKKHFLTEKNITLIKY 232

Query: 229 RENFLGKLLEL 239
           R+  + KL++L
Sbjct: 233 RDEII-KLIDL 242


>gi|72394258|gb|AAZ68535.1| recO-related protein [Ehrlichia canis str. Jake]
          Length = 248

 Score =  120 bits (301), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 79/249 (31%), Positives = 137/249 (55%), Gaps = 21/249 (8%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQS--HRMQPILQAGNLVRVNWRS 60
           WQD  I++ +R YG+  II+ + T+++G   G  R  +   HR    LQ G+ V V W +
Sbjct: 7   WQDQGIVIAIRKYGDDQIIISIFTQKHGLKKGLARYQKKTIHR----LQIGDHVNVTWSA 62

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLF-RFLPEREPCLELYDMLNIFLN 119
           +L  NLG F++E+++S     + ++L    +     +  + LPE E    +Y+ L+IF+N
Sbjct: 63  KLISNLGYFKYEIIKSTLHHYIHNNLKTMCIAFFTSILDQVLPENEENYTIYNHLDIFMN 122

Query: 120 CHKIPSVIGKI-FVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
             +   V  +I ++ +EL LL  +GFGLDL++C V    ++L+++SPK+G A+ ++VGLP
Sbjct: 123 SVQNKDVNWQIKYLTLELTLLSELGFGLDLSQCAVNNTNENLIFISPKTGKAISQTVGLP 182

Query: 179 YAEKML--------VLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRE 230
           Y + +L        V  ++ +K  +T      K +  +T YFL K+ L    I     R+
Sbjct: 183 YKKSLLPLPPLLYNVYNNYTYKYSKT----DFKVSLNVTGYFLKKHFLTEKNITLIKYRD 238

Query: 231 NFLGKLLEL 239
             + KL++L
Sbjct: 239 EII-KLIDL 246


>gi|94498593|ref|ZP_01305147.1| Recombinational DNA repair protein (RecF pathway)-like
           [Sphingomonas sp. SKA58]
 gi|94421957|gb|EAT07004.1| Recombinational DNA repair protein (RecF pathway)-like
           [Sphingomonas sp. SKA58]
          Length = 244

 Score =  119 bits (298), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 77/234 (32%), Positives = 116/234 (49%), Gaps = 6/234 (2%)

Query: 7   AIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQNL 66
           AI+  VR++GE   I  ++T  +G   G+VR G+S  M+P+L  GN+V+ ++R+R    L
Sbjct: 8   AIVCAVRAHGEHGAIARLLTPDHGLMAGYVRGGRSRAMRPVLLPGNVVKADFRARTEDQL 67

Query: 67  GEFRFEVLESHCAKLLSSSLFLYGLQ-SIVPLFRFLPEREPCLELYDMLNIFLNC-HKIP 124
                E+  S  A LL+  L    +  S       LPE  P   LY  L   L+     P
Sbjct: 68  AGLAVELAHSR-APLLAEPLPAAAIDWSCALTAAALPEATPYPALYQALAGLLDAVEAAP 126

Query: 125 SVIG--KIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEK 182
           +  G     V+ EL+LL  +GFGLDL++C   G   DL +VSP+S  AV R+  L Y ++
Sbjct: 127 AARGWAVALVRYELLLLTELGFGLDLSRCAALGDVNDLAFVSPRSAAAVSRAGALGYEQR 186

Query: 183 MLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKL 236
           +L LP FL        AD +    +LT +FL +  +          R+  + +L
Sbjct: 187 LLPLPPFLVGGGAGDWAD-IMDGLRLTGFFLERSVMTERRTDVLAARDRLVERL 239


>gi|255003183|ref|ZP_05278147.1| DNA repair protein RecO [Anaplasma marginale str. Puerto Rico]
 gi|255004314|ref|ZP_05279115.1| DNA repair protein RecO [Anaplasma marginale str. Virginia]
          Length = 233

 Score =  119 bits (298), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 71/221 (32%), Positives = 117/221 (52%), Gaps = 10/221 (4%)

Query: 7   AIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQNL 66
            +++G R YG+++++L ++TR  G   G  R  +    +P LQ G+L+   WR++L  NL
Sbjct: 2   GVVMGTRPYGDEHLLLSILTRNRGLRRGLTRLTKK---RP-LQIGDLIDATWRAKLPTNL 57

Query: 67  GEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLNCHKIPS 125
           G F  EV+ S         + L  L SI  +    LPE EP   LYD    F    +  +
Sbjct: 58  GHFTCEVIASAFYSYFRDRIKLMCLSSITHIMSTALPENEPHPTLYDSFQDFAAAAEAEA 117

Query: 126 VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKMLV 185
                ++++EL++L  +GF LDL+KC V+    +LL++SPK+G A+  +VG  Y  K+L 
Sbjct: 118 PWYNHYLKLELLVLSQLGFALDLSKCAVSNSKDNLLFISPKTGRALSEAVGHAYRNKLLP 177

Query: 186 LPSFLWK-----EEQTIDADSLKSAFQLTDYFLNKYALQHN 221
           LP  L       E +   AD    + ++  +FL+++ LQ +
Sbjct: 178 LPKVLRSISCGVETECCSADEFALSLKILGFFLHRHLLQES 218


>gi|58617232|ref|YP_196431.1| DNA repair protein RecO [Ehrlichia ruminantium str. Gardel]
 gi|58416844|emb|CAI27957.1| Putative DNA repair protein recO [Ehrlichia ruminantium str.
           Gardel]
          Length = 244

 Score =  119 bits (297), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 60/186 (32%), Positives = 111/186 (59%), Gaps = 14/186 (7%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M WQD  I++ +R Y +  +I+ V+T+++G   G  +     +    LQ G+ + V W +
Sbjct: 1   MRWQDQGIVIAIRKYCDNQVIISVLTKKHGLKKGLTK--YYKKTINRLQIGDYINVTWSA 58

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSI-VPLFRF-----LPEREPCLELYDML 114
           RL  NLG F++E+++S     ++++L     Q++ +  F F     LPE E    +Y   
Sbjct: 59  RLISNLGYFKYELIKSTIYYYMTNNL-----QTLCLAFFTFILDQVLPENEENYVIYHYF 113

Query: 115 NIFLNCHKIPSVIGKI-FVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCR 173
           +IF+N  +  ++  +I ++++E++LL  +GFGLDL+KC V    + L+++SPK+G A+ +
Sbjct: 114 DIFINSIQSKNINWQIKYLKLEMVLLSELGFGLDLSKCAVNQTQESLIFISPKTGKAISK 173

Query: 174 SVGLPY 179
           ++GLPY
Sbjct: 174 NIGLPY 179


>gi|294012225|ref|YP_003545685.1| DNA repair protein RecO [Sphingobium japonicum UT26S]
 gi|292675555|dbj|BAI97073.1| DNA repair protein RecO [Sphingobium japonicum UT26S]
          Length = 244

 Score =  117 bits (294), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 75/234 (32%), Positives = 118/234 (50%), Gaps = 6/234 (2%)

Query: 7   AIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQNL 66
           A++  +R +GE   I  ++T  +G   G+VR G+S R++P+L  GN V+  +R+R  + L
Sbjct: 8   ALVCALRPHGEHGAIARLLTPGHGLLAGYVRGGRSRRLRPVLLPGNAVKAEFRARTEEQL 67

Query: 67  GEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLNC-HKIP 124
                E LE   A LL+  L    +     L    LPE  P   L+  L+  L      P
Sbjct: 68  AGLTVE-LEHSRAPLLAEPLPAAAIDWACALTAVALPEATPYPALHQALDGVLGAVEAAP 126

Query: 125 SVIG--KIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEK 182
           +  G     ++ EL+LL  +GFGLDL +C  TG   DL +VSP+S  AV R+  + Y ++
Sbjct: 127 AARGWATALIRYELLLLAELGFGLDLGRCAATGGNDDLAYVSPRSAAAVSRAGAVGYEDR 186

Query: 183 MLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKL 236
           +L LP+FL  E    +  ++    +LT +FL +  L    +     RE  + +L
Sbjct: 187 LLPLPAFLL-EGGAGEWPAILDGLRLTGFFLERSVLTDWRVDVLAARERLVDRL 239


>gi|57239220|ref|YP_180356.1| DNA repair protein RecO [Ehrlichia ruminantium str. Welgevonden]
 gi|58579178|ref|YP_197390.1| DNA repair protein RecO [Ehrlichia ruminantium str. Welgevonden]
 gi|57161299|emb|CAH58220.1| putative DNA repair protein RecO [Ehrlichia ruminantium str.
           Welgevonden]
 gi|58417804|emb|CAI27008.1| Putative DNA repair protein recO [Ehrlichia ruminantium str.
           Welgevonden]
          Length = 244

 Score =  117 bits (294), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 60/186 (32%), Positives = 110/186 (59%), Gaps = 14/186 (7%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M WQD  I++ +R Y +  +I+ V+T+++G   G  +     +    LQ G+ + V W +
Sbjct: 1   MRWQDQGIVIAIRKYCDNQVIISVLTKKHGLKKGLTK--YYKKTINRLQIGDYINVTWSA 58

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSI-VPLFRF-----LPEREPCLELYDML 114
           RL  NLG F++E+++S     ++++L     Q++ +  F F     LPE E    +Y   
Sbjct: 59  RLISNLGYFKYELIKSTIYYYITNNL-----QTLCLAFFTFILDQVLPENEENYVIYHYF 113

Query: 115 NIFLNCHKIPSVIGKI-FVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCR 173
           +IF+N  +  ++  +I ++++E++LL  +GFGLDL+KC V    + L+++SPK+G A+  
Sbjct: 114 DIFINSIQSKNINWQIKYLKLEMVLLSELGFGLDLSKCAVNQTQESLIFISPKTGKAISE 173

Query: 174 SVGLPY 179
           ++GLPY
Sbjct: 174 NIGLPY 179


>gi|209545462|ref|YP_002277691.1| DNA repair protein RecO [Gluconacetobacter diazotrophicus PAl 5]
 gi|209533139|gb|ACI53076.1| DNA repair protein RecO [Gluconacetobacter diazotrophicus PAl 5]
          Length = 254

 Score =  117 bits (293), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 70/223 (31%), Positives = 113/223 (50%), Gaps = 6/223 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+  A++L    YGE + I+ ++T   G   G  R G +   + + Q GNL+R +WR 
Sbjct: 1   MEWEAPALVLSASPYGESSAIVHLLTEDLGLVHGLARGGTARANRALWQPGNLIRASWRG 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFR-FLPEREPCLELYDMLNIFLN 119
           RL   LG    E++    A+L+S+ L L  L S   +    LPEREP   ++ +L  F +
Sbjct: 61  RLPDQLGNLSGELVHGSAARLMSAPLALAMLASACAVADGTLPEREPHPRIFHLLTRFFS 120

Query: 120 CHKI-PSVIG----KIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRS 174
              + P + G       ++ E  LL ++G+G+DL+ C VTG + +L WVSP++G AV  +
Sbjct: 121 LLSLDPDMAGWGGMAALLRWEACLLGDLGYGMDLSACAVTGGSAELAWVSPRTGRAVSDA 180

Query: 175 VGLPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYA 217
               +  ++L LP     E         +   +LT +FL + A
Sbjct: 181 AAGEWRPRLLRLPPLFLNESDPGTVQDWRDGLRLTGHFLARDA 223


>gi|162148788|ref|YP_001603249.1| DNA repair protein recO [Gluconacetobacter diazotrophicus PAl 5]
 gi|189039658|sp|A9HRQ4|RECO_GLUDA RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|161787365|emb|CAP56960.1| putative DNA repair protein recO [Gluconacetobacter diazotrophicus
           PAl 5]
          Length = 254

 Score =  117 bits (292), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 70/223 (31%), Positives = 113/223 (50%), Gaps = 6/223 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+  A++L    YGE + I+ ++T   G   G  R G +   + + Q GNL+R +WR 
Sbjct: 1   MEWEAPALVLSASPYGESSAIVHLLTEDLGLVHGLARGGTARANRALWQPGNLIRASWRG 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFR-FLPEREPCLELYDMLNIFLN 119
           RL   LG    E++    A+L+S+ L L  L S   +    LPEREP   ++ +L  F +
Sbjct: 61  RLPDQLGNLSGELVHGSAARLMSAPLALAMLASACAVADGTLPEREPHPRIFHLLTRFFS 120

Query: 120 CHKI-PSVIG----KIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRS 174
              + P + G       ++ E  LL ++G+G+DL+ C VTG + +L WVSP++G AV  +
Sbjct: 121 LLSLDPDMAGWGGMAALLRWEACLLGDLGYGMDLSACAVTGGSAELAWVSPRTGRAVSDA 180

Query: 175 VGLPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYA 217
               +  ++L LP     E         +   +LT +FL + A
Sbjct: 181 AAGEWRPRLLRLPPLFLDESDPGTVQDWRDGLRLTGHFLARDA 223


>gi|114327658|ref|YP_744815.1| DNA repair protein recO [Granulibacter bethesdensis CGDNIH1]
 gi|122327371|sp|Q0BTG0|RECO_GRABC RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|114315832|gb|ABI61892.1| DNA repair protein recO [Granulibacter bethesdensis CGDNIH1]
          Length = 250

 Score =  114 bits (286), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 72/221 (32%), Positives = 115/221 (52%), Gaps = 9/221 (4%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W    I+L  + YGE + +  V +   G + G VR G S +   I Q GNLV   W +
Sbjct: 1   MEWTAPCIVLSAQPYGEADCLAAVFSEDQGLYRGLVRGGTSRQRGGIWQPGNLVMARWTA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFR-FLPEREPCLELYDMLNIFLN 119
           RLA  LG    E++    A  +   L L  L+S+  +    LP+RE     +  L   L 
Sbjct: 61  RLADQLGSLTAELIHPAAALAMDDPLNLAVLRSLCTVAEGALPDREAHPAAFIPLPGLLT 120

Query: 120 CHKIPSVIGKIF---VQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVG 176
             ++    G++    ++ E +LL+ +G+GLDL +C VTG    L +VSP++G AV     
Sbjct: 121 --RLSLGGGQVVEDAIRWEAILLRELGYGLDLQRCAVTGQVSGLHYVSPRTGRAVSSDAA 178

Query: 177 LPYAEKMLVLPSFLWKEEQTIDADSL--KSAFQLTDYFLNK 215
            P+ +++L LP+FL  + +T D+D +  +   +LT YFL++
Sbjct: 179 EPWLDRLLPLPAFLLHQAET-DSDPVAWRDGLRLTGYFLSR 218


>gi|254796817|ref|YP_003081654.1| DNA repair protein RecO [Neorickettsia risticii str. Illinois]
 gi|254590066|gb|ACT69428.1| DNA repair protein RecO [Neorickettsia risticii str. Illinois]
          Length = 238

 Score =  112 bits (280), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 65/194 (33%), Positives = 109/194 (56%), Gaps = 8/194 (4%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+++ I+L  +   E   +  + T+ YG     ++ G   R +  +  GN+V   W +
Sbjct: 1   MQWENEGIVLSNKGLVENKAVTTLFTKDYG-----LKRGLCSR-KATIDVGNVVYCKWSA 54

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVP-LFRFLPEREPCLELYDMLNIFLN 119
           RL   LG FR EV E     L +    L  L +++  L + LPE EP  E+Y +    L 
Sbjct: 55  RLESQLGYFRVEVKEIISPFLFTDYKKLKLLNAVLSILLKVLPENEPQKEIYKIFIQLLQ 114

Query: 120 CHKI-PSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
             K   S   + +++++L +L+++GF LDL++C VTG T++L ++SPK+G AV ++VG  
Sbjct: 115 AFKSETSCYYRQYIEMDLSILRHLGFQLDLSRCTVTGETKNLFYISPKTGRAVTKAVGEA 174

Query: 179 YAEKMLVLPSFLWK 192
           Y +K+L+LP  L+K
Sbjct: 175 YKDKLLLLPPSLYK 188


>gi|332188696|ref|ZP_08390410.1| DNA repair protein RecO [Sphingomonas sp. S17]
 gi|332011260|gb|EGI53351.1| DNA repair protein RecO [Sphingomonas sp. S17]
          Length = 243

 Score =  111 bits (277), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 86/228 (37%), Positives = 119/228 (52%), Gaps = 9/228 (3%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M+    AIIL VR +GE   I+  +TR  G   G+VR G+S  ++P+LQ GN +   WR+
Sbjct: 1   MHRVAPAIILSVRPHGEHGAIVRALTRDDGVQPGYVRGGRSRALRPVLQPGNAIIGEWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPL-FRFLPEREPCLELYDMLNIFLN 119
           R A+ L     E   S  A L    L   G++ +  L    LPE +P   LYD L+  L 
Sbjct: 61  RTAEQLPALTLEPGHSR-AGLHGEPLAAAGIEWLCALTAAALPEEQPYPILYDALDAVLT 119

Query: 120 C-HKIPSVIG--KIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVG 176
                PS  G     V+ EL+LL  +GFGLDL +C VTG T DL +VSPKSG AV     
Sbjct: 120 AIESAPSARGWAGALVRYELLLLGQLGFGLDLERCTVTGGTDDLAFVSPKSGAAVSVGAA 179

Query: 177 LPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNK---YALQHN 221
             Y  ++  LP FL +E    D   + +A ++T +FL +     L+H+
Sbjct: 180 FGYEARLFSLPLFL-REGGAADWPDIFAAGRITAHFLARDILAGLRHD 226


>gi|88608141|ref|YP_506346.1| putative DNA repair protein RecO [Neorickettsia sennetsu str.
           Miyayama]
 gi|88600310|gb|ABD45778.1| putative DNA repair protein RecO [Neorickettsia sennetsu str.
           Miyayama]
          Length = 237

 Score =  109 bits (273), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 66/194 (34%), Positives = 106/194 (54%), Gaps = 8/194 (4%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+++ I+L  +   E   +  + T+ YG     ++ G   R   I   GN+V   W  
Sbjct: 1   MQWENEGIVLSNKGLVENKAVTTLFTKDYG-----LKRGLCSRKTTI-DVGNVVYCRWSG 54

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVP-LFRFLPEREPCLELYDMLNIFLN 119
           RL   LG FR EV E     L +    L  L +++  L + LPE EP  E+Y      L 
Sbjct: 55  RLEVQLGYFRVEVKEIISPFLFTDYKKLKLLNAVLSILLKVLPENEPQKEIYKTFIQLLQ 114

Query: 120 CHKIPSVIG-KIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
             K  ++   + +++++L +L+ +GF LDL++C VTG T+DL ++SPK+G AV ++VG  
Sbjct: 115 AFKSNTLCYYRQYIEMDLSILQYLGFQLDLSRCAVTGETKDLFYISPKTGRAVTKAVGEA 174

Query: 179 YAEKMLVLPSFLWK 192
           Y +K+L+LP  L+K
Sbjct: 175 YKDKLLLLPPSLYK 188


>gi|91205107|ref|YP_537462.1| DNA repair protein RecO [Rickettsia bellii RML369-C]
 gi|157827560|ref|YP_001496624.1| DNA repair protein RecO [Rickettsia bellii OSU 85-389]
 gi|122425954|sp|Q1RJU1|RECO_RICBR RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|254790733|sp|A8GXI7|RECO_RICB8 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|91068651|gb|ABE04373.1| DNA repair protein RecO [Rickettsia bellii RML369-C]
 gi|157802864|gb|ABV79587.1| DNA repair protein RecO [Rickettsia bellii OSU 85-389]
          Length = 241

 Score =  109 bits (272), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 74/222 (33%), Positives = 119/222 (53%), Gaps = 4/222 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M  +D  +I+  +   E   I+ V T+ +G + G  +   S + + I Q GN+V   W++
Sbjct: 1   MNIKDIGVIIAKKPLKENTFIITVFTKNHGLYSGVAKES-SKKSKFIYQEGNVVDFLWQA 59

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFL-PEREPCLELYDMLNIFLN 119
           RL +++G  + E+++S+    + +   LY   S++ L + L  ERE     + +L  +L+
Sbjct: 60  RLHEHIGIAKCELVKSYIGHFIINKAKLYAFNSVISLIKELFHEREEHYNFFSLLINYLD 119

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
            +   +     ++  EL LL  +G+ LD TKC V+  TQDL ++SPKSG AV   VG PY
Sbjct: 120 -NLAKNFCFHDYINFELALLAEMGYELDFTKCGVSNTTQDLAYLSPKSGRAVSYEVGAPY 178

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHN 221
            +K+L LP FL      I  +  + A  LT YF N+Y L HN
Sbjct: 179 KDKLLPLPKFLLSGNDKITLEEKRQALNLTSYFFNRY-LFHN 219


>gi|258543012|ref|YP_003188445.1| DNA repair protein RecO [Acetobacter pasteurianus IFO 3283-01]
 gi|256634090|dbj|BAI00066.1| DNA repair protein RecO [Acetobacter pasteurianus IFO 3283-01]
 gi|256637150|dbj|BAI03119.1| DNA repair protein RecO [Acetobacter pasteurianus IFO 3283-03]
 gi|256640202|dbj|BAI06164.1| DNA repair protein RecO [Acetobacter pasteurianus IFO 3283-07]
 gi|256643259|dbj|BAI09214.1| DNA repair protein RecO [Acetobacter pasteurianus IFO 3283-22]
 gi|256646314|dbj|BAI12262.1| DNA repair protein RecO [Acetobacter pasteurianus IFO 3283-26]
 gi|256649367|dbj|BAI15308.1| DNA repair protein RecO [Acetobacter pasteurianus IFO 3283-32]
 gi|256652353|dbj|BAI18287.1| DNA repair protein RecO [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256655411|dbj|BAI21338.1| DNA repair protein RecO [Acetobacter pasteurianus IFO 3283-12]
          Length = 263

 Score =  107 bits (268), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 75/236 (31%), Positives = 116/236 (49%), Gaps = 6/236 (2%)

Query: 7   AIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQNL 66
           A++L     GE +  + V+T  YG   G    G S   + + Q GN+V+ +   R A   
Sbjct: 15  ALVLFAGVQGETSARVHVLTEDYGPLRGIAYGGASKAGRALWQPGNVVKTSLHKRSAAAP 74

Query: 67  GEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLNCHKIPS 125
            +   E+L +  A+LL + L L  +QS+  L    LPE +PC  L+      L       
Sbjct: 75  LQISAELLYACAARLLDAPLALSMVQSVCVLADVTLPEADPCPFLFAETVRLLTFLGYDP 134

Query: 126 VIGKI-----FVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
           VI +       V+ E+ LL  +GFGLDL+ C VTG T++L +VSP++G AV       + 
Sbjct: 135 VIAEREGMPHVVRWEMALLATLGFGLDLSACAVTGSTENLHYVSPRTGRAVSEEGAGEWK 194

Query: 181 EKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKL 236
           +++L LPSFL   EQT +A    +  +LT +FL + A     +     R+    +L
Sbjct: 195 DRLLPLPSFLQDTEQTGNAADWLAGLRLTGHFLARDAFGQRHLPLPAARQRLYDRL 250


>gi|296535950|ref|ZP_06898099.1| recombination protein O [Roseomonas cervicalis ATCC 49957]
 gi|296263723|gb|EFH10199.1| recombination protein O [Roseomonas cervicalis ATCC 49957]
          Length = 250

 Score =  106 bits (265), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 81/238 (34%), Positives = 118/238 (49%), Gaps = 2/238 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M WQ  AI+L  R +GE   ++ V+T  +GRH G V  G S     + Q GNLV V WR 
Sbjct: 1   MEWQAPAIVLEARPHGEGAAVVSVLTEDHGRHAGLVHGGASRAQSGLWQPGNLVEVRWRG 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFR-FLPEREPCLELYD-MLNIFL 118
           RLA+ LG    E++    A  L   L L  LQS   L    LPERE    ++  +L +  
Sbjct: 61  RLAEQLGSLSGEMVHPTAALALDEPLTLALLQSACALATDALPEREAQPRIFSGLLALMA 120

Query: 119 NCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
              +    +   +++ E +LL+ +G+GLDL+ C VTG  ++L  VSP+SG AV      P
Sbjct: 121 QLGRGAPALLADYIRWEALLLEGLGYGLDLSVCAVTGAAENLTHVSPRSGRAVSAEAAAP 180

Query: 179 YAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKL 236
           Y +++L LP FL   +   D        +LT +FL + A           RE  + ++
Sbjct: 181 YRDRLLPLPLFLLGGQDERDPAEWLKGLRLTGHFLERDAFGARHRAVPPARERLVSRI 238


>gi|329115619|ref|ZP_08244341.1| DNA repair protein RecO [Acetobacter pomorum DM001]
 gi|326695047|gb|EGE46766.1| DNA repair protein RecO [Acetobacter pomorum DM001]
          Length = 263

 Score =  105 bits (262), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 74/236 (31%), Positives = 116/236 (49%), Gaps = 6/236 (2%)

Query: 7   AIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQNL 66
           A++L     GE +  + V+T  YG   G    G S   + + Q GN+V+ ++  R A   
Sbjct: 15  ALVLFAGVQGETSARIHVLTEDYGPLRGIAYGGASKAGRALWQPGNVVKTSFHKRSAAAP 74

Query: 67  GEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLNCHKIPS 125
            +   E+L +  A+LL + L L  +QS+  L    LPE +PC  L+      L       
Sbjct: 75  LQISGELLYACAARLLDAPLALGMVQSVCVLADVTLPEADPCPFLFAETVRLLTFLGYDP 134

Query: 126 VIGKI-----FVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
           V+ +       V+ E+ LL  +GFGLDL+ C VTG T++L +VSP++G AV       + 
Sbjct: 135 VVAEREGMPHVVRWEMALLVTLGFGLDLSACAVTGSTENLHYVSPRTGRAVSEEGAGEWK 194

Query: 181 EKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKL 236
           +++L LPSFL   EQT  A    +  +LT +FL + A     +     R+    +L
Sbjct: 195 DRLLPLPSFLRDTEQTGHAADWLAGLRLTGHFLARDAFGQRHLPLPAARQRLYDRL 250


>gi|326402842|ref|YP_004282923.1| DNA repair protein RecO [Acidiphilium multivorum AIU301]
 gi|325049703|dbj|BAJ80041.1| DNA repair protein RecO [Acidiphilium multivorum AIU301]
          Length = 251

 Score =  104 bits (260), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 64/190 (33%), Positives = 98/190 (51%), Gaps = 1/190 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W + AI+L V ++GE ++   V+   +G   G  R G   R  PI Q GNL+   W +
Sbjct: 1   MEWSEPAIVLSVAAFGESDLRTIVLAETHGAWHGLARGGAGRRGAPIWQEGNLINARWVA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLN 119
           RL + LG    E++    A  ++  L L  L++   +    LPERE     +  L   L 
Sbjct: 61  RLPEQLGSISGELVHPAAAIAMADPLALAVLRAACAVAAGALPEREAHRGAFIRLARLLG 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
              I        V+ EL LL+ +G+GLDL+ C ++G  +DL +VSP++G AV R     +
Sbjct: 121 GIGIAGTALPALVRFELELLRELGYGLDLSSCALSGAAEDLAFVSPRTGRAVARGAAGDW 180

Query: 180 AEKMLVLPSF 189
           A ++L LP+F
Sbjct: 181 APRLLKLPAF 190


>gi|218515340|ref|ZP_03512180.1| DNA repair protein RecO [Rhizobium etli 8C-3]
          Length = 84

 Score =  104 bits (259), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 47/84 (55%), Positives = 62/84 (73%)

Query: 1  MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
          M WQD AIILG++ +GE ++I EVMTR  GRHLG VR+G+S  MQP+LQ GN V V WR+
Sbjct: 1  MQWQDHAIILGIKRHGETSVIAEVMTRDRGRHLGLVRSGRSRAMQPVLQPGNAVEVIWRA 60

Query: 61 RLAQNLGEFRFEVLESHCAKLLSS 84
          RL ++LGEFR E +    A+L+ +
Sbjct: 61 RLDEHLGEFRVEPVTLRAARLMET 84


>gi|307294438|ref|ZP_07574282.1| DNA repair protein RecO [Sphingobium chlorophenolicum L-1]
 gi|306880589|gb|EFN11806.1| DNA repair protein RecO [Sphingobium chlorophenolicum L-1]
          Length = 244

 Score =  104 bits (259), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 73/238 (30%), Positives = 116/238 (48%), Gaps = 6/238 (2%)

Query: 7   AIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQNL 66
           A++  +R +GE   I  ++T  +G   G+VR G+S RM+P+L   N V+  +R+R  + L
Sbjct: 8   ALVCALRPHGEHGAIARLLTPDHGLLAGYVRGGRSRRMRPVLLPANAVKAEFRARTEEQL 67

Query: 67  GEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLNC---HK 122
                E+  S  A LL+  L    +     L    LPE  P   LY  L+  L       
Sbjct: 68  AGLTVELDHSR-APLLAEPLPAAAIDWACALTAVALPEGTPYPALYQALDGVLGAVEAAP 126

Query: 123 IPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEK 182
                    ++ EL++L  +GFGLDLT+C  TG   DL ++SP+S  AV R+    Y ++
Sbjct: 127 AARGWAAALIRYELLMLAELGFGLDLTRCAATGGRDDLAYISPRSAAAVSRAGAAGYEDR 186

Query: 183 MLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLELI 240
           +L LP+FL  E    D  ++    +LT +FL +  L    +     RE  + +L  ++
Sbjct: 187 LLPLPAFLL-EGGAGDWPAILDGLRLTGFFLERSVLTDWRVDVLAARERLVDRLKRVV 243


>gi|148260213|ref|YP_001234340.1| DNA repair protein RecO [Acidiphilium cryptum JF-5]
 gi|254790500|sp|A5FXT9|RECO_ACICJ RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|146401894|gb|ABQ30421.1| DNA repair protein RecO [Acidiphilium cryptum JF-5]
          Length = 251

 Score =  103 bits (258), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 64/191 (33%), Positives = 98/191 (51%), Gaps = 1/191 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W + AI+L V ++GE ++   V+   +G   G  R G   R  PI Q GNL+   W +
Sbjct: 1   MEWSEPAIVLSVAAFGESDLRTIVLAETHGAWHGLARGGAGRRGAPIWQEGNLINARWVA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLN 119
           RL + LG    E++    A  ++  L L  L++   +    LPERE     +  L   L 
Sbjct: 61  RLPEQLGSISGELVHPAAAIAMADPLALAVLRAACAVAAGALPEREAHRGAFIRLARLLG 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
              I        V+ EL LL+ +G+GLDL+ C ++G  +DL +VSP++G AV R     +
Sbjct: 121 GIGIAGTALPALVRFELELLRELGYGLDLSSCALSGAAEDLAFVSPRTGRAVARGAAGDW 180

Query: 180 AEKMLVLPSFL 190
             ++L LP+FL
Sbjct: 181 VPRLLKLPAFL 191


>gi|88607051|ref|YP_505316.1| DNA repair protein RecO [Anaplasma phagocytophilum HZ]
 gi|123494993|sp|Q2GJY5|RECO_ANAPZ RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|88598114|gb|ABD43584.1| DNA repair protein RecO [Anaplasma phagocytophilum HZ]
          Length = 245

 Score = 97.8 bits (242), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 66/228 (28%), Positives = 107/228 (46%), Gaps = 10/228 (4%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M WQD  +I+ +  YG+   IL V TR +G     +R    ++ +  LQ G+ V V WR+
Sbjct: 1   MQWQDHGMIVSMTPYGDTRSILSVFTRNHGICNAMIR---LNKKKQSLQIGDRVCVTWRA 57

Query: 61  RLAQNLGEFR-FEVLESHCAKLLSSSLFLYGLQSIVP-LFRFLPEREPCLELYDMLNIFL 118
           RLA NLG F   E++ S           L  L S+   +++ +P  +    LYD L  F 
Sbjct: 58  RLANNLGYFNSCEIISSAFYAYFQDHSKLLCLSSVTSTIYKSVPTNDAHPILYDYLIEFA 117

Query: 119 NCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
              +        ++++EL +L  +GF LDL++C V     +LL++SPK+G A+    G+ 
Sbjct: 118 EAAECGGHWYNEYLKLELEILSQLGFALDLSRCAVYHCEDNLLYISPKTGRAISERAGVS 177

Query: 179 YAEKMLVLPSFLWKEEQTIDADSLKS-----AFQLTDYFLNKYALQHN 221
           Y   +  LP  L         +           Q+  YFL+++ L  +
Sbjct: 178 YRHLLFPLPQILRDLHNGTHTEQCSRKEFLLCLQILGYFLHRHLLSDD 225


>gi|83311360|ref|YP_421624.1| recombinational DNA repair protein [Magnetospirillum magneticum
          AMB-1]
 gi|82946201|dbj|BAE51065.1| Recombinational DNA repair protein [Magnetospirillum magneticum
          AMB-1]
          Length = 206

 Score = 96.3 bits (238), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 42/94 (44%), Positives = 54/94 (57%)

Query: 1  MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
          M W DD ++L VR +GE   +  ++TR +GRH G V  GQ    +PILQ GNLVR  W  
Sbjct: 1  MEWDDDGVVLAVRRHGETGAVASLLTRSHGRHAGLVHGGQGRANRPILQPGNLVRARWTG 60

Query: 61 RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSI 94
          RL + LG FR E+L +H A  L  +  L  L S 
Sbjct: 61 RLPEQLGNFRLEMLHAHAAAFLDDAARLAALGSA 94


>gi|241761300|ref|ZP_04759388.1| DNA repair protein RecO [Zymomonas mobilis subsp. mobilis ATCC
           10988]
 gi|241374207|gb|EER63704.1| DNA repair protein RecO [Zymomonas mobilis subsp. mobilis ATCC
           10988]
          Length = 254

 Score = 94.4 bits (233), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 69/226 (30%), Positives = 114/226 (50%), Gaps = 25/226 (11%)

Query: 5   DDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQ 64
           + A++L  R + E   I+ ++T Q G   G+++   S   +P+L  GN V+ +WR ++ +
Sbjct: 6   EPALLLTSRFHSENGAIIRLLTEQ-GLLTGYIQGAHSRYRRPLLFVGNYVQASWRDKVGR 64

Query: 65  NLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLF-RFLPEREPCLELYDMLNIFLNCHKI 123
           +L     E+  S    ++   L    L  I P     LPE +P  E Y    +F N  ++
Sbjct: 65  SLPSINIELRHSR-GLIMEHPLAALFLSWICPFTASVLPEGQP--EPY----LFQNLKRL 117

Query: 124 PSVIGKI---------FVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRS 174
            ++I K           V+ EL+LL  +G+GL L++C++TG    L WVSPK   AV R 
Sbjct: 118 LAIIEKTDEPVLWMTELVRFELLLLSELGYGLHLSRCIITGQEACLDWVSPKHHAAVSRQ 177

Query: 175 VGLPYAEKMLVLPSFLWKEEQTI------DADSLKSAFQLTDYFLN 214
               + +K+LVLP FL K   ++      D +SL+   +L+ +FL 
Sbjct: 178 AAQGHEKKLLVLPDFL-KAPFSVSCLDLPDQESLQQGLKLSGFFLR 222


>gi|260752832|ref|YP_003225725.1| DNA repair protein RecO [Zymomonas mobilis subsp. mobilis NCIMB
           11163]
 gi|283856306|ref|YP_162408.2| DNA repair protein RecO [Zymomonas mobilis subsp. mobilis ZM4]
 gi|258552195|gb|ACV75141.1| DNA repair protein RecO [Zymomonas mobilis subsp. mobilis NCIMB
           11163]
 gi|283775302|gb|AAV89297.2| DNA repair protein RecO [Zymomonas mobilis subsp. mobilis ZM4]
          Length = 254

 Score = 93.2 bits (230), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 68/226 (30%), Positives = 114/226 (50%), Gaps = 25/226 (11%)

Query: 5   DDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQ 64
           + A++L  R + E   I+ ++T Q G   G+++   S   +P+L  GN V+ +WR ++ +
Sbjct: 6   EPALLLTSRFHSENGAIIRLLTEQ-GLLTGYIQGAHSRYRRPLLFVGNYVQASWRDKVGR 64

Query: 65  NLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLF-RFLPEREPCLELYDMLNIFLNCHKI 123
           +L     E+  S    ++   L    L  I P     LPE +P  E Y    +F N  ++
Sbjct: 65  SLPSINIELRHSR-GLIMEHPLAALFLSWICPFTASVLPEGQP--EPY----LFQNLKRL 117

Query: 124 PSVIGKI---------FVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRS 174
            ++I K           V+ EL+LL  +G+GL L++C++TG    L WVSPK   AV R 
Sbjct: 118 LAIIEKTDEPVLWMTELVRFELLLLSELGYGLHLSRCIITGQEACLDWVSPKHHAAVSRQ 177

Query: 175 VGLPYAEKMLVLPSFLWKEEQTI------DADSLKSAFQLTDYFLN 214
               + +K+LVLP FL K   ++      D ++L+   +L+ +FL 
Sbjct: 178 AAQGHEKKLLVLPDFL-KAPFSVSCLDLPDQEALQQGLKLSGFFLR 222


>gi|6647943|sp|Q9ZD01|Y549_RICPR RecName: Full=Uncharacterized protein RP549
 gi|3861098|emb|CAA14998.1| unknown [Rickettsia prowazekii]
          Length = 135

 Score = 90.9 bits (224), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 57/91 (62%)

Query: 131 FVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKMLVLPSFL 190
           ++  EL LL   G+ LDLTKC V+ VT DL +VSPKS  A+   VG PY +K+L+LP FL
Sbjct: 29  YISFELNLLAETGYKLDLTKCCVSHVTTDLTYVSPKSARALSYKVGKPYRDKLLILPKFL 88

Query: 191 WKEEQTIDADSLKSAFQLTDYFLNKYALQHN 221
             ++  I  +  K A  LT+YF N+Y   +N
Sbjct: 89  LAKDSEITLEEKKQALTLTNYFFNRYLFHNN 119


>gi|23011689|ref|ZP_00051976.1| COG1381: Recombinational DNA repair protein (RecF pathway)
           [Magnetospirillum magnetotacticum MS-1]
          Length = 117

 Score = 83.6 bits (205), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 56/91 (61%), Gaps = 6/91 (6%)

Query: 132 VQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKMLVLPSFLW 191
           V+ EL LL  +GFGLDL+ C  TG    L++VSPKSG AV  S G PY +++L LP FL 
Sbjct: 2   VRFELALLAGLGFGLDLSHCAATGANDALVYVSPKSGRAVSASAGEPYRDRLLPLPPFLR 61

Query: 192 KEE------QTIDADSLKSAFQLTDYFLNKY 216
             +      QT D  +++  F LT YFL+++
Sbjct: 62  DRDQPGSGWQTPDEHAVREGFTLTGYFLDQH 92


>gi|103486573|ref|YP_616134.1| recombinational DNA repair protein (RecF pathway)-like protein
           [Sphingopyxis alaskensis RB2256]
 gi|98976650|gb|ABF52801.1| Recombinational DNA repair protein (RecF pathway)-like protein
           [Sphingopyxis alaskensis RB2256]
          Length = 192

 Score = 73.2 bits (178), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 51/140 (36%), Positives = 72/140 (51%), Gaps = 5/140 (3%)

Query: 12  VRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQNLGEFRF 71
           +R++GE   IL  +T + G   G+VR G+S R++PIL  GN V +  RSR  + LG    
Sbjct: 1   MRAHGEHGAILRALTHEAGLVAGYVRGGRSRRLRPILMPGNRVALELRSRTEEQLGGATV 60

Query: 72  EVLESHCAKLLSSSLFLYGLQSIVPL-FRFLPEREPCLELYDMLNIFLNCHKI-PSVI-- 127
           E+LES  A LL   L    +  +  L    LPE +P   LY  L+  L    + PS    
Sbjct: 61  ELLESR-APLLGEPLAAAAIDWVTSLTVAVLPEGQPFPALYIALSAVLEAIGVAPSARQW 119

Query: 128 GKIFVQIELMLLKNIGFGLD 147
                + EL+LL  +GFGL+
Sbjct: 120 ALALGRYELLLLAELGFGLE 139


>gi|296282559|ref|ZP_06860557.1| hypothetical protein CbatJ_03005 [Citromicrobium bathyomarinum
           JL354]
          Length = 198

 Score = 71.6 bits (174), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 48/150 (32%), Positives = 75/150 (50%), Gaps = 7/150 (4%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M  +  AI+L  R +GE  +I  ++T + G    +V  GQ  R++P++  GN V  + R+
Sbjct: 1   MQLKAPAIVLAARPHGENAVIARMLTHEAGMVAAYVAGGQGRRLRPVVIPGNSVEADIRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPL-FRFLPEREPCLELYDMLNIFLN 119
           R A  L   + E++ S  A  L+  L    +  +  L    LPER P   LYD L   L+
Sbjct: 61  RSASQLPFGKVELVASR-APWLNEPLPAAAILWVTALTASTLPERNPYPSLYDALGGLLD 119

Query: 120 --CHKIPSVIG--KIFVQIELMLLKNIGFG 145
             CH  PS  G     +  E++LL+ +G+G
Sbjct: 120 AICHA-PSARGWAPALLSYEVLLLRELGYG 148


>gi|330814140|ref|YP_004358379.1| GTP-binding protein Era [Candidatus Pelagibacter sp. IMCC9063]
 gi|327487235|gb|AEA81640.1| GTP-binding protein Era [Candidatus Pelagibacter sp. IMCC9063]
          Length = 228

 Score = 70.5 bits (171), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 59/240 (24%), Positives = 102/240 (42%), Gaps = 16/240 (6%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D   +L + +Y E + I   +T ++G H G +    S + +  LQ GN   +NW+S
Sbjct: 1   MNWKDIGYLLKISNYSENSSIATFVTCEHGLHKGVIYGATSKKKKNYLQIGNKFSLNWKS 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPL-FRFLPEREPCLELYDMLNIFLN 119
           +    LG +  E+  +  AK     + L  +QS+  L  + L ER    EL+D  + F+N
Sbjct: 61  KSEDALGYYDLELKNAVTAKFFDEPIKLSFIQSLSELCCKTLAERYDYSELFDYTDFFIN 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDL-LWVSPKSGGAVCRSVGLP 178
                + + K+++  E  LL  IGF L+           +L  W+             L 
Sbjct: 121 NISKANAL-KLYILWEKELLTAIGFELNPDNKNFNFYKNNLSQWI-------------LE 166

Query: 179 YAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLE 238
             ++  + P+FL       +   L     +  + L ++  + N I    +RE    KL E
Sbjct: 167 IDKQKFLYPNFLIDSNSVYEDTDLYEGLVINKFILKRFVFEPNRIRFPEVRERIEKKLNE 226


>gi|262277164|ref|ZP_06054957.1| DNA repair protein RecO [alpha proteobacterium HIMB114]
 gi|262224267|gb|EEY74726.1| DNA repair protein RecO [alpha proteobacterium HIMB114]
          Length = 208

 Score = 67.0 bits (162), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 50/168 (29%), Positives = 84/168 (50%), Gaps = 15/168 (8%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W D   +L V +  E + +++V +R++G   G V    S + +P LQ GN +++N+ S
Sbjct: 1   MRWSDIGYLLSVSATKENSSLVKVFSREHGCVTGVVYGSSSKKKKPDLQIGNKIKLNFNS 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQ-SIVPLFRFLPEREP---CLELYDMLNI 116
           +    LG F  E++E+   K  +    L  L  SI  + + +PE++    C + YD L  
Sbjct: 61  KNEDALGYFSIELMENISIKFFNDLKKLNLLIISIEVISKIMPEQQKYTECFDEYDQL-- 118

Query: 117 FLNCHKIPSVIG---KIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLL 161
                 I S+ G   K ++  E   LKNIG+G+DL +     V + +L
Sbjct: 119 ------IKSLEGDSLKSYLIWEFNFLKNIGYGVDLNEEGFNPVIKSIL 160


>gi|71083742|ref|YP_266462.1| recombination protein O [Candidatus Pelagibacter ubique HTCC1062]
 gi|91763222|ref|ZP_01265186.1| Recombination protein O [Candidatus Pelagibacter ubique HTCC1002]
 gi|71062855|gb|AAZ21858.1| Recombination protein O [Candidatus Pelagibacter ubique HTCC1062]
 gi|91717635|gb|EAS84286.1| Recombination protein O [Candidatus Pelagibacter ubique HTCC1002]
          Length = 226

 Score = 67.0 bits (162), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 43/149 (28%), Positives = 76/149 (51%), Gaps = 2/149 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W D A ++    Y E +II EV T  +G+  G +  G S +++  LQ GN + VN+ S
Sbjct: 1   MNWDDSAYLVSKNRYSENSIIAEVFTENHGKISGIIFGGTSKKIKNYLQIGNKIYVNYNS 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFL-PEREPCLELYDMLNIFLN 119
           +    +G F+ E+L++        +  L  + S + L + L  E +   E++ +++ F  
Sbjct: 61  KSVTRIGYFKIEILKALTPLYFDQNQKLSCITSAMHLIKLLTAEAQSNKEIFKLIDKFFE 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDL 148
                + I K ++  EL LLK +G+ L+L
Sbjct: 121 ILNSENWIQK-YIFWELELLKLLGYDLEL 148


>gi|149186742|ref|ZP_01865053.1| hypothetical protein ED21_29626 [Erythrobacter sp. SD-21]
 gi|148829650|gb|EDL48090.1| hypothetical protein ED21_29626 [Erythrobacter sp. SD-21]
          Length = 198

 Score = 65.1 bits (157), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 49/165 (29%), Positives = 78/165 (47%), Gaps = 9/165 (5%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M+ +  AI+L  R +GE  +I  ++T + G    +V  G+  +++P++  GNLV    R+
Sbjct: 1   MHLRAPAILLAARPHGETAVIARLLTEESGVVAAYVAGGRGRQLRPVVIPGNLVEAEIRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPL-FRFLPEREPCLELYDMLNIFLN 119
           +    L   R E+ +S     L+  L    +     L    LPER P   LY  L   L 
Sbjct: 61  KSDSQLPFARLELAQSR-GPWLTEPLPAAAIAWTCALTASALPERNPYPSLYSALAALLE 119

Query: 120 --CHKIPSVIG--KIFVQIELMLLKNIGFGLDLTKCVVTGVTQDL 160
             C+  PS  G        E++LL+ +G+G   TK V+ G+ Q L
Sbjct: 120 AICNA-PSARGWAGALATYEVLLLRELGYG--GTKPVIEGLEQAL 161


>gi|87200674|ref|YP_497931.1| recombinational DNA repair protein (RecF pathway)-like
           [Novosphingobium aromaticivorans DSM 12444]
 gi|87136355|gb|ABD27097.1| Recombinational DNA repair protein (RecF pathway)-like protein
           [Novosphingobium aromaticivorans DSM 12444]
          Length = 202

 Score = 63.5 bits (153), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 44/149 (29%), Positives = 71/149 (47%), Gaps = 5/149 (3%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M  +  AI+  VR +GE   ++ +MT ++G    +V   +   ++P+L  GNL+    R 
Sbjct: 1   MQIRAPAILCSVRPHGEHGAVVRLMTEEHGLAAAYVAGARGRELRPLLIPGNLLEAEVRG 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPL-FRFLPEREPCLELYDMLNIFLN 119
           R A  L   R E++ S     L+  L   G+     L    LPE  P   LYD L   L+
Sbjct: 61  RAASQLPSARLELVASR-GPWLTEPLPSAGIGWACALTAATLPEGHPYPLLYDSLGALLD 119

Query: 120 CHKI-PSVIG--KIFVQIELMLLKNIGFG 145
              + PS  G  ++    E++LL+ +G+G
Sbjct: 120 AICLAPSARGWARVLAGYEVLLLREVGYG 148


>gi|85374495|ref|YP_458557.1| hypothetical protein ELI_08340 [Erythrobacter litoralis HTCC2594]
 gi|84787578|gb|ABC63760.1| hypothetical protein ELI_08340 [Erythrobacter litoralis HTCC2594]
          Length = 200

 Score = 63.2 bits (152), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 43/143 (30%), Positives = 71/143 (49%), Gaps = 5/143 (3%)

Query: 7   AIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQNL 66
           AI+L  R +GE  +I  ++T ++G   G+V  G+  +++P++  GNLV +  R++    L
Sbjct: 9   AILLAARPHGETAVIARLLTEEFGMVAGYVAGGRGRQLRPVVIPGNLVELELRAKSDSQL 68

Query: 67  GEFRFEVLESHCAKLLSSSLFLYGLQSIVPL-FRFLPEREPCLELYDMLNIFLNCH-KIP 124
              + E++ES     LS  L    +Q    L    LPER     LY  L   L+   + P
Sbjct: 69  PFAKLELVESR-GPWLSEPLPAAAIQWATALTATALPERNAYPNLYSALVALLDAVCQAP 127

Query: 125 SVIG--KIFVQIELMLLKNIGFG 145
           S  G     +  E +LL+ +G+G
Sbjct: 128 SARGWAPALLSYEALLLRELGYG 150


>gi|85709082|ref|ZP_01040148.1| DNA repair protein RecO [Erythrobacter sp. NAP1]
 gi|85690616|gb|EAQ30619.1| DNA repair protein RecO [Erythrobacter sp. NAP1]
          Length = 200

 Score = 58.2 bits (139), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 42/144 (29%), Positives = 67/144 (46%), Gaps = 7/144 (4%)

Query: 7   AIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQNL 66
           AI++  R++GE  +I  +MT ++G    +V  G+  +++P++  GN +    RS+    L
Sbjct: 7   AILVAARAHGETAVIARLMTEEHGLVAAYVAGGRGRQLRPVVIPGNSLEAEIRSKSDSQL 66

Query: 67  GEFRFEVLESHCAKLLSSSLFLYGLQSIVPL-FRFLPEREPCLELYDMLNIFLN--CHKI 123
              R E+  S  A  ++  L    +     L    LPER P   L+      L   CH  
Sbjct: 67  PFARIELAVSR-APWMTEPLPAAAIGWACALTASTLPERNPYPSLFSAFEALLEAICHA- 124

Query: 124 PSVIG--KIFVQIELMLLKNIGFG 145
           PS  G     V  E MLL+ +G+G
Sbjct: 125 PSARGWLAAMVAYEAMLLRELGYG 148


>gi|326386768|ref|ZP_08208389.1| recombinational DNA repair protein (RecF pathway)-like protein
           [Novosphingobium nitrogenifigens DSM 19370]
 gi|326208821|gb|EGD59617.1| recombinational DNA repair protein (RecF pathway)-like protein
           [Novosphingobium nitrogenifigens DSM 19370]
          Length = 202

 Score = 56.2 bits (134), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 41/145 (28%), Positives = 66/145 (45%), Gaps = 7/145 (4%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQN 65
           +AI+  +R +GE   I+  +T  +G    +V   +   ++P+L  GN + V  R+R    
Sbjct: 6   EAILCAMRPHGEHGGIIRALTGDHGMVAAYVSGARGRTLRPVLIPGNTLAVEIRARGGSQ 65

Query: 66  LGEFRFEVLESHCAKLLSSSLFLYGLQSIVPL-FRFLPEREPCLELYDMLNIFLN--CHK 122
           L   R E++ S  A  L   L    +     L    LPE  P   L+  L   L+  CH 
Sbjct: 66  LPGARTELVASR-APWLGEPLPAAAIDWATALTAATLPEGHPYPALHTALGALLDAICHA 124

Query: 123 IPSVIG--KIFVQIELMLLKNIGFG 145
            PS  G  ++    E +LL+ +G+G
Sbjct: 125 -PSARGWARVLAGYEALLLREVGYG 148


>gi|6647944|sp|Q9ZD02|Y548_RICPR RecName: Full=Uncharacterized protein RP548
 gi|3861097|emb|CAA14997.1| unknown [Rickettsia prowazekii]
          Length = 115

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 56/107 (52%), Gaps = 2/107 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M  +D  +I+  +   E   I+ V T+ +G + G ++   S + + I Q GN+V   W++
Sbjct: 1   MNIKDIGVIISKKPLKENTFIIRVFTKNHGLYSGVIKES-SKKNKFIYQEGNIVDFLWKA 59

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFR-FLPEREP 106
           RL +++G  + E+++S+    + +   LY   S++ L +    ERE 
Sbjct: 60  RLHEHIGIAKCELIKSYTGYFIINKAKLYAFNSVISLIQELFHEREE 106


>gi|253576084|ref|ZP_04853416.1| DNA repair protein RecO [Paenibacillus sp. oral taxon 786 str. D14]
 gi|251844427|gb|EES72443.1| DNA repair protein RecO [Paenibacillus sp. oral taxon 786 str. D14]
          Length = 249

 Score = 48.5 bits (114), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 55/202 (27%), Positives = 83/202 (41%), Gaps = 22/202 (10%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR------MQPILQAGNLV 54
           M ++ + I++    YGE N I+ + T   G+    VR  +  +       QP    G  V
Sbjct: 1   MLYRVEGIVIRSMDYGEGNKIITLCTETSGKIGVLVRGAKKVKSRHGALTQPFTH-GEYV 59

Query: 55  RVNWRSRLAQ-NLGEFRFEVLESHCAKLLSSSLFL--YGLQSIVPLFRFLPEREPCLELY 111
                  L   N GE    ++ESH +  L   LFL  Y   +   L + L + E     +
Sbjct: 60  FFRQNGGLGTLNQGE----MIESHFS--LREDLFLAAYASYACELLDKTLQDEEVGSFWF 113

Query: 112 DMLNIFLN---CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSG 168
             L   L+     K P ++  +F   E+ +L+  G+G     CV  G   D  +VSP+ G
Sbjct: 114 TQLKACLDGLSSGKDPQIVTHLF---EMKILQAAGYGPSFESCVSCGRVDDSPYVSPRLG 170

Query: 169 GAVCRSVGLPYAEKMLVLPSFL 190
           G +CRS        M V P  L
Sbjct: 171 GRLCRSCRHQDPAAMQVTPGVL 192


>gi|172056863|ref|YP_001813323.1| DNA repair protein RecO [Exiguobacterium sibiricum 255-15]
 gi|229485534|sp|B1YL74|RECO_EXIS2 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|171989384|gb|ACB60306.1| DNA repair protein RecO [Exiguobacterium sibiricum 255-15]
          Length = 249

 Score = 48.5 bits (114), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 57/239 (23%), Positives = 101/239 (42%), Gaps = 31/239 (12%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQ------SHRMQPILQAGNLV 54
           M  + + ++L    YGE N I+ ++TR+YG+     R  +      +   QP ++A   +
Sbjct: 1   MIDKAEGLVLRTVVYGESNKIITLLTREYGKLAVMARGAKKPGSRFNAASQPFVRA---I 57

Query: 55  RVNWRSRLAQNLGEFR-FEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDM 113
            V  RSR    LG+ +  +V+  +        L  Y +  +    + L ER P   LYD+
Sbjct: 58  YVYPRSR---GLGQLKSADVITGYSKIRQDVFLMAYAMYLLELADKALDERVPQPALYDL 114

Query: 114 LNIFLNCHK---IPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGA 170
               L        P V+  I   +EL LL+++G    L  C V G  +     S   GG 
Sbjct: 115 FVDGLEAMDEGLDPDVVSFI---VELRLLRHLGIAPHLNGCTVCGSVEAPFAFSLNHGGL 171

Query: 171 VCR----------SVGLPYAEKMLVLPSFLWKEEQTIDA--DSLKSAFQLTDYFLNKYA 217
           +CR          S+    A+ + V   + +    T+D   ++ +   Q+ D ++ +Y+
Sbjct: 172 LCRRHRQEDEHAVSLTESVAKMLYVFSVYDFSRIGTVDVKPETKRLLRQIMDAYMERYS 230


>gi|188585832|ref|YP_001917377.1| DNA repair protein RecO [Natranaerobius thermophilus JW/NM-WN-LF]
 gi|179350519|gb|ACB84789.1| DNA repair protein RecO [Natranaerobius thermophilus JW/NM-WN-LF]
          Length = 257

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 47/186 (25%), Positives = 90/186 (48%), Gaps = 26/186 (13%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQ--SHRMQPILQA---GNLVRVN 57
           +  DA+++  R Y + + I+ + T  YGR    V+  +    ++  I+Q+   GN    +
Sbjct: 5   YNSDAVVIRSRDYRDYDKIINLFTPYYGRVSAVVKGVKKPKSKLAGIVQSFTYGNYQLYS 64

Query: 58  WRS--RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLN 115
            +S  RL Q      F+ L +    L+S+ + +  L     + + +PE E   E   +  
Sbjct: 65  GKSLGRLVQGKVLHGFQELRTDLV-LMSAGMCILEL-----IDKAIPEGE---EYPALFG 115

Query: 116 IFLNCHKI------PSVIGKIFVQIELMLLKNIGFGLDLTKCVVTG-VTQDLLWVSPKSG 168
           + L+C  +      PS++ +IF   E  L+ N+G   +L+ C+  G +TQ  L+  P++G
Sbjct: 116 VTLSCFHLLEKSYPPSLVLRIF---EAKLIHNLGVSPELSGCINHGSITQGNLYFDPETG 172

Query: 169 GAVCRS 174
           G +C +
Sbjct: 173 GLICET 178


>gi|171463194|ref|YP_001797307.1| DNA repair protein RecO [Polynucleobacter necessarius subsp.
           necessarius STIR1]
 gi|254764652|sp|B1XTL6|RECO_POLNS RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|171192732|gb|ACB43693.1| DNA repair protein RecO [Polynucleobacter necessarius subsp.
           necessarius STIR1]
          Length = 244

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 45/167 (26%), Positives = 72/167 (43%), Gaps = 35/167 (20%)

Query: 5   DDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNG---QSHRMQPILQAGNLVRVNWRSR 61
           + A +L    Y E ++IL+V TRQYGR +  +  G   Q   ++P+LQ    + V+W  +
Sbjct: 9   EPAFVLHSIPYKETSLILDVFTRQYGR-MALIAKGAKRQHSTLRPVLQRFQPLLVSWSGK 67

Query: 62  LAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVP------------LFRFLPEREPCLE 109
                 E R           L+ S ++ G+ S+V             L +FL   +   +
Sbjct: 68  -----SELR----------TLTKSEWVGGMPSLVGDALLCGFYLNELLVKFLAREDDYEK 112

Query: 110 LYD----MLNIFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCV 152
           LYD     +N   N       + +I  Q EL LL+  G+   L +CV
Sbjct: 113 LYDRYAETINALSNLEFESKGLEEILRQFELSLLQETGYAAALDRCV 159


>gi|241895550|ref|ZP_04782846.1| recombination protein O [Weissella paramesenteroides ATCC 33313]
 gi|241871128|gb|EER74879.1| recombination protein O [Weissella paramesenteroides ATCC 33313]
          Length = 263

 Score = 47.0 bits (110), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 42/174 (24%), Positives = 77/174 (44%), Gaps = 10/174 (5%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQN 65
           DAI++  R + EK+++++++TRQ G+ + ++R+G+S R Q   +   L    +   +   
Sbjct: 6   DAIVMYQRDHKEKDLMVKMLTRQAGKRMFYIRHGKSQRYQFSAEIQPLRTATFEGTINST 65

Query: 66  LGEFRFEVLESHCAKLLSSSLFLYGLQSIV--PLFRFLPEREPCLELYDM----LNIFLN 119
              F  +V  +     L + + L    + +   +     + +P    YD+    LN  LN
Sbjct: 66  GMSFINDVKATKDTSFLMTDIVLNAYMTYILGLIDAAFVDNQPIPRWYDLVIEALNK-LN 124

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCR 173
               P  I   F   E+ LL   G      KCV+ G +   L  S +  G +C+
Sbjct: 125 SGLDPQGIANYF---EIQLLPVFGMQPTWGKCVICGRSDLPLDFSEEFNGTLCQ 175


>gi|320106411|ref|YP_004182001.1| DNA repair protein RecO [Terriglobus saanensis SP1PR4]
 gi|319924932|gb|ADV82007.1| DNA repair protein RecO [Terriglobus saanensis SP1PR4]
          Length = 245

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 46/183 (25%), Positives = 82/183 (44%), Gaps = 24/183 (13%)

Query: 4   QDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQ--PILQAGNLVRVNWRSR 61
           QD+AI+L    + E ++++ + TR  GR  G  R+    R +    L+    VR NW  +
Sbjct: 5   QDEAIVLRTWPFQEADLLVSLFTRHQGRVKGVARHAMRSRRRFGGALEPMTYVRANWAEK 64

Query: 62  LAQNLGEFR-FEVLES------HCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDML 114
             Q L     FE+L S        A+  + S+    L+S       LPE+ P  +++ + 
Sbjct: 65  PRQELVRLNSFEILWSPLREPVDYARSAALSVVAEVLESA------LPEQAPEDDVFRLA 118

Query: 115 NIFLNCHKIPSVIGKIFVQIELMLL---KNIGFGLDLTKCVVTGVT--QDLLWVSPKSGG 169
              +   +    +G++++ +   LL   + +G+  DL+ C V G +      + SP   G
Sbjct: 119 LTTIERMQ----VGEVWLPVTYFLLWVTRLLGWMPDLSSCAVCGESLRGKGFFYSPARDG 174

Query: 170 AVC 172
           A C
Sbjct: 175 ATC 177


>gi|304398618|ref|ZP_07380490.1| DNA repair protein RecO [Pantoea sp. aB]
 gi|304353829|gb|EFM18204.1| DNA repair protein RecO [Pantoea sp. aB]
          Length = 242

 Score = 44.7 bits (104), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 59/234 (25%), Positives = 100/234 (42%), Gaps = 41/234 (17%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNWRS 60
           WQ  A +L  R + E +++L++ +   GR     +  +S R  ++  LQ    + V W  
Sbjct: 4   WQR-AFVLHSRPFSETSLLLDLFSESEGRVRVLAKGARSRRSNLKGALQPFTPLLVRWSG 62

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLF------RFLPEREPCLELYDML 114
           R          EV     A+ +S +L L G+     L+      R L +  P  EL+   
Sbjct: 63  R---------GEVKTLRNAEAVSLALPLSGITLYCGLYVNELVSRVLQQESPFPELF--- 110

Query: 115 NIFLNC-HKIPSVIGK---IFVQIELMLLKNIGFGLDLTKCVVTG--VTQDLLWVSPKSG 168
             +LNC   + S  GK      + EL LL ++G+G+D   C  +G  V+ D+ +   +  
Sbjct: 111 FDYLNCLQALASTHGKPEPALRRFELALLGHLGYGVDFLHCAGSGEPVSDDMTYSYREER 170

Query: 169 GAVCRSVGLPYAEKMLVLPSFLWKEEQTI------DADSLKSAFQLTDYFLNKY 216
           G +        A  ++   SF  +E   +      DAD+L++A + T   L  Y
Sbjct: 171 GFI--------ASLVVNNRSFTGRELHALCEREFPDADTLRAAKRFTRIALKPY 216


>gi|224542129|ref|ZP_03682668.1| hypothetical protein CATMIT_01304 [Catenibacterium mitsuokai DSM
           15897]
 gi|224524966|gb|EEF94071.1| hypothetical protein CATMIT_01304 [Catenibacterium mitsuokai DSM
           15897]
          Length = 245

 Score = 44.3 bits (103), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 53/231 (22%), Positives = 97/231 (41%), Gaps = 26/231 (11%)

Query: 4   QDDAIILGVRSYGEKNIILEVMTRQYGRHLGF---VRNGQSHRMQPILQAG-NLVRVNWR 59
           + + ++L +    E + IL + T  YGR   +   +R   S   + +  +  +L  +N R
Sbjct: 8   KTEGVVLKITPSKESDAILSIYTHDYGRISVYGKGIRKINSKNARGVTPSSLSLFELNIR 67

Query: 60  ---SRLAQNLG-EFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLN 115
              S L +  G E+   + +     +L+  L  Y        +R++PE +P L+ Y  L 
Sbjct: 68  KGLSTLVRATGIEYYIHIQDHIETDILAQCLLEY-------YYRYVPENKPDLDTYAFLV 120

Query: 116 IFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSV 175
             L           I+  I + ++K+ G  L++  CV  G T  +   S   GG VCR  
Sbjct: 121 DALKAIDTGYSYKLIYALILVFIMKDNGIELEVDGCVHCGHTS-VTSFSLVDGGFVCRKH 179

Query: 176 GLPYAEKM----LVLPSFLWK------EEQTIDADSLKSAFQLTDYFLNKY 216
             P   +M    L     ++K      +  +ID   LK    + +Y++++Y
Sbjct: 180 QTPQDVQMSIEALKAIRHIYKTPMAHIDTLSIDESVLKEILFIFEYYIDEY 230


>gi|320529425|ref|ZP_08030513.1| DNA repair protein RecO [Selenomonas artemidis F0399]
 gi|320138391|gb|EFW30285.1| DNA repair protein RecO [Selenomonas artemidis F0399]
          Length = 242

 Score = 43.9 bits (102), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 49/190 (25%), Positives = 82/190 (43%), Gaps = 17/190 (8%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYG--RHLGFVRNGQSHRMQPILQAGNLVRVNW 58
           M +  + IILG +++GE + ++ V TR+ G  R   F       R +  L     + V+ 
Sbjct: 1   MLYTAEGIILGAKNWGEADKVMTVFTRERGMLRAAAF----GCRRPRSALAGAMQMFVHA 56

Query: 59  RSRLAQN--LGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFR-FLPEREPCLELYDMLN 115
             +LA+   L   +  V+ +H AKL +    L     +  + R FLPE  P  + +D L 
Sbjct: 57  DFQLAEGPRLETVKTAVVRAHHAKLSADLTALAYATFVAEVVREFLPEGVPDEQFFDRLA 116

Query: 116 IFLNCHKI--PSVIGKIFVQIELMLLKNIGFGLDLTKCVVTG--VTQDLLWVSPKSGGAV 171
             L   +   P +     V   L +L   G G    +C+  G  +T +  + + + GGA+
Sbjct: 117 QILTAFETRNPRITALAAV---LQILSAAGLGQTYERCLHCGTEITGNAFFHA-REGGAL 172

Query: 172 CRSVGLPYAE 181
           C       AE
Sbjct: 173 CAGCRTADAE 182


>gi|297544410|ref|YP_003676712.1| DNA repair protein RecO [Thermoanaerobacter mathranii subsp.
           mathranii str. A3]
 gi|296842185|gb|ADH60701.1| DNA repair protein RecO [Thermoanaerobacter mathranii subsp.
           mathranii str. A3]
          Length = 248

 Score = 43.9 bits (102), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 41/173 (23%), Positives = 75/173 (43%), Gaps = 6/173 (3%)

Query: 4   QDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLA 63
           + +AI+L   S GE + +  + T+ YG+     +  +  + + +      +  N+     
Sbjct: 5   KTEAIVLKNNSIGETDKMATLFTKNYGKLRAVAKGARRSKSRFVNAIRPFMVANYVIFEG 64

Query: 64  QNLGEF-RFEVLESHCAKLLSSSLFLYGLQSIVP--LFRFLPEREPCLELYDMLNIFLNC 120
           QN     ++E++ESH  K +   L  + + S +   + + L E +   +LY  L      
Sbjct: 65  QNYYYIDQWELIESH--KNIEKDLVKFSVASYISETVNKILEENQKSEKLYQFLKHSFKA 122

Query: 121 HKIPSVIGKIF-VQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVC 172
                +   IF V   L L+  +G+   L  C+V G  +DL + S   GG VC
Sbjct: 123 VNELQIDPLIFIVSYNLKLVSLLGYMPQLDNCIVCGKREDLKYFSNSCGGVVC 175


>gi|308187804|ref|YP_003931935.1| DNA repair protein recO (Recombination protein O) [Pantoea vagans
           C9-1]
 gi|308058314|gb|ADO10486.1| DNA repair protein recO (Recombination protein O) [Pantoea vagans
           C9-1]
          Length = 259

 Score = 43.5 bits (101), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 59/234 (25%), Positives = 98/234 (41%), Gaps = 41/234 (17%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQ--PILQAGNLVRVNWRS 60
           WQ  A +L  R + E +++L++ +   GR     +  +S R Q    LQ    + V W  
Sbjct: 21  WQR-AFVLHSRPFSETSLLLDLFSENEGRVRVLAKGARSRRSQLKGALQPFTPLLVRWSG 79

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLF------RFLPEREPCLELYDML 114
           R          +V     A+ +S +L L G+     L+      R L    P  EL+   
Sbjct: 80  R---------GDVKTLRNAEAVSLALPLSGITLYCGLYVNELVSRVLQPESPFQELF--- 127

Query: 115 NIFLNC-HKIPSVIGK---IFVQIELMLLKNIGFGLDLTKCVVTG--VTQDLLWVSPKSG 168
             +LNC   + S  GK      + EL LL ++G+G+D   C  +G  V+ D+ +   +  
Sbjct: 128 FDYLNCLQALASTHGKPEPALRRFELALLGHLGYGVDFLHCAGSGEPVSDDMTYSYREER 187

Query: 169 GAVCRSVGLPYAEKMLVLPSFLWKEEQTI------DADSLKSAFQLTDYFLNKY 216
           G +        A  ++   SF  +E   +      DAD+L++A + T   L  Y
Sbjct: 188 GFI--------ASLVVNQRSFTGRELHALCEREFPDADTLRAAKRFTRIALKPY 233


>gi|317049178|ref|YP_004116826.1| DNA repair protein RecO [Pantoea sp. At-9b]
 gi|316950795|gb|ADU70270.1| DNA repair protein RecO [Pantoea sp. At-9b]
          Length = 242

 Score = 43.5 bits (101), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 60/223 (26%), Positives = 91/223 (40%), Gaps = 19/223 (8%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQ--PILQAGNLVRVNWRS 60
           WQ  A +L  R Y E +++L++ +   GR     +  +S R Q    LQ    + V W  
Sbjct: 4   WQR-AFVLHSRPYSETSLLLDLFSESEGRVRVLAKGARSRRSQLKGALQPFTPLLVRWGG 62

Query: 61  RLAQNLGEFR-FEVLESHCAKLLSSSLFLY-GLQSIVPLFRFLPEREPCLELY-DMLNIF 117
           R     GE +     E+    L  S + LY GL     L R L +  P  +L+ D LN  
Sbjct: 63  R-----GEVKTLRNAEAVSLALPLSGITLYCGLYVNELLSRVLEQEIPFSDLFFDYLNCI 117

Query: 118 LNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTG--VTQDLLWVSPKSGGAVCRSV 175
                          + EL LL ++G+G+D   C  +G  V   + +   +  G +   V
Sbjct: 118 QALAAASGTPEPALRRFELALLGHLGYGVDFLHCAGSGEEVDDGMTYSYREEKGFIASLV 177

Query: 176 --GLPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKY 216
                +  + L     LW E    DADSL++A + T   L  Y
Sbjct: 178 VNQRSFTGRQL---RALW-ERDFPDADSLRAAKRFTRMALKPY 216


>gi|289578135|ref|YP_003476762.1| DNA repair protein RecO [Thermoanaerobacter italicus Ab9]
 gi|289527848|gb|ADD02200.1| DNA repair protein RecO [Thermoanaerobacter italicus Ab9]
          Length = 248

 Score = 43.1 bits (100), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 40/173 (23%), Positives = 75/173 (43%), Gaps = 6/173 (3%)

Query: 4   QDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLA 63
           + +AI+L   S GE + +  + T+ YG+     +  +  + + +      +  N+     
Sbjct: 5   KTEAIVLKNNSIGETDKMATLFTKNYGKLRAVAKGARRSKSRFVNAIRPFMVANYVIFEG 64

Query: 64  QNLGEF-RFEVLESHCAKLLSSSLFLYGLQSIVP--LFRFLPEREPCLELYDMLNIFLNC 120
           QN     ++E++ESH  K +   L  + + S +   + + L E +   +LY  L      
Sbjct: 65  QNYYYIDQWELIESH--KNIEKDLVKFSVASYISETVNKILEENQKSEKLYQFLKHSFKA 122

Query: 121 HKIPSVIGKIFV-QIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVC 172
                +   IF+    L L+  +G+   L  C+V G  +DL + S   GG VC
Sbjct: 123 VDELQIDPLIFIASYNLKLVSLLGYMPQLDNCIVCGKREDLKYFSNSCGGVVC 175


>gi|323141986|ref|ZP_08076837.1| DNA repair protein RecO [Phascolarctobacterium sp. YIT 12067]
 gi|322413518|gb|EFY04386.1| DNA repair protein RecO [Phascolarctobacterium sp. YIT 12067]
          Length = 253

 Score = 43.1 bits (100), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 50/192 (26%), Positives = 73/192 (38%), Gaps = 33/192 (17%)

Query: 5   DDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQ 64
           DDA++L V+++   +      T+++G+ L F+  G  +              N   RL Q
Sbjct: 11  DDALVLHVKNWQTADKYAVCFTKEHGK-LRFIAYGARYEK------------NIHGRLLQ 57

Query: 65  NLGEFRFEVLESHCAKLLSSSLFLYGLQSI-----------VPLFRFLPE-REPCLELYD 112
                  EV +      L S   L   +S+             L   L E R P  ELY+
Sbjct: 58  PFANLHIEVQQGQKIDKLRSCELLQMPKSMDMQQMAYAAVASELTAVLTEDRVPQPELYE 117

Query: 113 MLNIFLNC--HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTG---VTQDLLWVSPKS 167
           ML   L     + P ++    +   + LL   GF   LT CV  G     Q+  W SP  
Sbjct: 118 MLGAALAALMQRNPRLV---VLSYAIKLLAATGFAPQLTHCVHCGEAVTAQENAWFSPLQ 174

Query: 168 GGAVCRSVGLPY 179
           GG +C S    Y
Sbjct: 175 GGLICSSCRSTY 186


>gi|183602375|ref|ZP_02963741.1| DNA repair protein RecO [Bifidobacterium animalis subsp. lactis
           HN019]
 gi|219683310|ref|YP_002469693.1| DNA repair protein RecO [Bifidobacterium animalis subsp. lactis
           AD011]
 gi|241191271|ref|YP_002968665.1| DNA repair protein RecO [Bifidobacterium animalis subsp. lactis
           Bl-04]
 gi|241196677|ref|YP_002970232.1| DNA repair protein RecO [Bifidobacterium animalis subsp. lactis DSM
           10140]
 gi|254790512|sp|B8DSY8|RECO_BIFA0 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|183218294|gb|EDT88939.1| DNA repair protein RecO [Bifidobacterium animalis subsp. lactis
           HN019]
 gi|219620960|gb|ACL29117.1| DNA repair protein RecO [Bifidobacterium animalis subsp. lactis
           AD011]
 gi|240249663|gb|ACS46603.1| DNA repair protein RecO [Bifidobacterium animalis subsp. lactis
           Bl-04]
 gi|240251231|gb|ACS48170.1| DNA repair protein RecO [Bifidobacterium animalis subsp. lactis DSM
           10140]
 gi|289177386|gb|ADC84632.1| RecO [Bifidobacterium animalis subsp. lactis BB-12]
 gi|295794264|gb|ADG33799.1| DNA repair protein RecO [Bifidobacterium animalis subsp. lactis V9]
          Length = 239

 Score = 43.1 bits (100), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 47/197 (23%), Positives = 88/197 (44%), Gaps = 25/197 (12%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGF---VRNGQSH---RMQPILQAGNLV-- 54
           ++D+A++L     GE + I+ ++TR +G+       VR  +S    R++P ++   L+  
Sbjct: 4   YRDEAVVLRTAKLGEADRIITLLTRDHGKVRAVAKGVRRTKSRFGARLEPFMRVDLLLGE 63

Query: 55  -RVNWRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDM 113
            R     R A+++  +   +   + A   ++S        ++P      E EP    Y +
Sbjct: 64  GRTFDSVRQAESISAYAGGITGDY-ATYTAASAMCETAADLLPA-----EHEPAAAQYRL 117

Query: 114 LNIFLNC-----HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSG 168
           L   L       H  P  I   ++   L  +   G+ + L  CVV G +QD+ + S  +G
Sbjct: 118 LIAALGALSRHLHD-PQAIALSYI---LRAMSLAGWTIRLDSCVVCG-SQDVEFFSASAG 172

Query: 169 GAVCRSVGLPYAEKMLV 185
           GA+C +   P A ++ V
Sbjct: 173 GAMCPNDHTPDAVRVPV 189


>gi|293394831|ref|ZP_06639121.1| recombination protein O [Serratia odorifera DSM 4582]
 gi|291422582|gb|EFE95821.1| recombination protein O [Serratia odorifera DSM 4582]
          Length = 243

 Score = 43.1 bits (100), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 55/221 (24%), Positives = 91/221 (41%), Gaps = 15/221 (6%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNWRS 60
           WQ  A +L  R Y E +++L++ T  +GR     +  +S R  ++  LQ    + V W  
Sbjct: 4   WQR-AFVLHGRPYSETSLMLDLFTEGHGRVRLLAKGARSRRSNLKGCLQPFTPLLVRWGG 62

Query: 61  RLAQNLGEFR-FEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLEL--YDMLNIF 117
           R     G+ +     E+    L  S + LY    +  L   + E+E    L  +D L   
Sbjct: 63  R-----GDIKTLRNAEAVSLGLPLSGMMLYSGLYVNELLSRVLEQEADYSLLFFDYLQCL 117

Query: 118 LNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTG--VTQDLLWVSPKSGGAVCRSV 175
                      +   Q EL LL ++G+G+D   C  +G  V   + +   +  G +   V
Sbjct: 118 QALAAAERSPEQALRQFELALLHHLGYGVDFLHCAGSGEPVDDGMTYRYREEKGFIASLV 177

Query: 176 GLPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKY 216
              Y+     L +    E Q  DAD+L++A + T   L  Y
Sbjct: 178 VDHYSFTGRELRAL--AERQFPDADTLRAAKRFTRMALKPY 216


>gi|193214068|ref|YP_001995267.1| DNA repair protein RecO [Chloroherpeton thalassium ATCC 35110]
 gi|254790516|sp|B3QU22|RECO_CHLT3 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|193087545|gb|ACF12820.1| DNA repair protein RecO [Chloroherpeton thalassium ATCC 35110]
          Length = 259

 Score = 42.7 bits (99), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 44/164 (26%), Positives = 78/164 (47%), Gaps = 14/164 (8%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQS--HRMQPILQAGN---LVR 55
           M  +  AI+L   +YG+++ I+   TR +G+  G V+  ++   +   +L+ GN   LV 
Sbjct: 1   MIRKTQAIVLRTINYGDQSKIVTFFTRSFGKLTGLVKGYRNPKGKFASVLEIGNDLDLVL 60

Query: 56  VNWRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPC-LELYDML 114
               +R  Q + E    VL +      SS   L  L   + L R   E +   L ++++L
Sbjct: 61  YKKDTREVQLITE---AVLRAPMLGATSSLEQLSALHQTLELIRLTTENDDAHLGVFELL 117

Query: 115 NIFL---NCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTG 155
           +  L   N  +   +    + Q++L+ L  +GF L+  KCV+TG
Sbjct: 118 HATLQKINVSRKNHISFFFYFQVQLISL--LGFRLNFQKCVLTG 159


>gi|53804479|ref|YP_113918.1| DNA repair protein RecO [Methylococcus capsulatus str. Bath]
 gi|67461356|sp|Q608M9|RECO_METCA RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|53758240|gb|AAU92531.1| DNA repair protein RecO [Methylococcus capsulatus str. Bath]
          Length = 242

 Score = 42.4 bits (98), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 43/154 (27%), Positives = 64/154 (41%), Gaps = 7/154 (4%)

Query: 5   DDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQ---PILQAGNLVRVNWRSR 61
           D A +L  R Y E +++LE+ T ++GR +G +  G     Q    +LQ    + V+W  R
Sbjct: 17  DHAYLLHRRDYRETSLLLELFTLRHGR-IGVIAKGARRGRQGFAAVLQPFVPLLVSWSGR 75

Query: 62  LAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCH 121
               L             +L  ++LF  G      L R LP  +PC EL+      L   
Sbjct: 76  --GELANLNHAEAAGIGVRLQHTALFC-GFYLNELLMRLLPPHDPCPELFGTYRGGLETL 132

Query: 122 KIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTG 155
                +       EL LL+ IG+GL L     +G
Sbjct: 133 AAGEDLETALRSFELSLLEAIGYGLQLRVEAESG 166


>gi|295398007|ref|ZP_06808063.1| recombination protein O [Aerococcus viridans ATCC 11563]
 gi|294973765|gb|EFG49536.1| recombination protein O [Aerococcus viridans ATCC 11563]
          Length = 266

 Score = 42.0 bits (97), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 38/178 (21%), Positives = 75/178 (42%), Gaps = 12/178 (6%)

Query: 2   YWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQ------PILQAGNLVR 55
           Y + D I+L  R Y EK++++++ T+++G+ + F++N Q           P ++A  +  
Sbjct: 6   YARFDGIVLFTRKYKEKDLLIKIFTKEFGKRMFFIKNIQRQNNGLREIAFPYMRASFVGT 65

Query: 56  VNWRS-RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDML 114
           +N +      +  +  F        +  + + ++ GL        F+ E +    L+  L
Sbjct: 66  INDKGFSFLNDTDDVLFPKTTISDIQANAYAAYMTGLTD-AAFEDFIKEDKVFDLLWHGL 124

Query: 115 NIFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVC 172
              +     PSV+  IF   E+ LL   G   +   C + G  Q     S +  G +C
Sbjct: 125 GK-IEAGVDPSVVANIF---EIQLLPKFGVAPNFRSCAICGRDQGRFDYSMQYAGVLC 178


>gi|313896076|ref|ZP_07829630.1| DNA repair protein RecO [Selenomonas sp. oral taxon 137 str. F0430]
 gi|312975501|gb|EFR40962.1| DNA repair protein RecO [Selenomonas sp. oral taxon 137 str. F0430]
          Length = 242

 Score = 42.0 bits (97), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 48/185 (25%), Positives = 79/185 (42%), Gaps = 21/185 (11%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYG--RHLGF----VRNGQSHRMQPILQAGNLV 54
           M +  + IILG +++GE + ++ V TR+ G  R   F     R+  +  MQ        V
Sbjct: 1   MLYTAEGIILGAKNWGEADKVMTVFTRERGMLRAAAFGCRRPRSALAGAMQ------MFV 54

Query: 55  RVNWRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFR-FLPEREPCLELYDM 113
             +++      L   +  V+ +H AKL +    L     +  + R FLPE  P  + +D 
Sbjct: 55  HADFQLAEGPRLETVKTAVVRAHHAKLSADLTALAYATFVAEVVREFLPEGVPDEQFFDR 114

Query: 114 LNIFLNC--HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTG--VTQDLLWVSPKSGG 169
           L   L     + P V     V   L +L   G      +C+  G  +T D  + + + GG
Sbjct: 115 LAEILTAFERRNPRVAALAAV---LQILSAAGLRQTYERCLHCGTEITGDAFFHAGE-GG 170

Query: 170 AVCRS 174
           A+C S
Sbjct: 171 ALCPS 175


>gi|311895950|dbj|BAJ28358.1| putative DNA repair protein RecO [Kitasatospora setae KM-6054]
          Length = 248

 Score = 42.0 bits (97), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 47/218 (21%), Positives = 97/218 (44%), Gaps = 27/218 (12%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQ------SHRMQPILQAGNLVRV 56
           ++DD I+L  +  GE + I+  +TRQ+G+     R  +        R++P     + V V
Sbjct: 4   FRDDGIVLRTQKLGEADRIITFLTRQHGQVRAVARGVRRTKSKFGARLEPF----SHVDV 59

Query: 57  NWRSRLAQNLGE-----FRFEVLESHCAKLLSS-SLFLYGLQSIVPLFRFLP-EREPCLE 109
            + SR +  +G       + E +  + A+++   + +  G   +    RF   E +P ++
Sbjct: 60  QFFSRGSDLVGRTLPLCTQVETIAPYGARIVDDYTRYTAGTAMLETAERFAENEGQPAVQ 119

Query: 110 LYDMLNIFLNCHKIPSVIGKIFVQIELMLLKNI---GFGLDLTKCVVTGVTQDLLWVSPK 166
            Y +L   L    + +   +  + ++  LL+++   G+G   T C   G+     + S +
Sbjct: 120 QYLLLVGAL--RTLAAGTHQAHLVLDAFLLRSLAVNGYGASFTDCARCGLPGPNRFFSLQ 177

Query: 167 SGGAVCRSV-----GLPYAEKMLVLPSFLWKEEQTIDA 199
           +GG +C         +P  E +++L + L  + QT D 
Sbjct: 178 AGGVLCGDCRVPGSAVPSPETLVLLGALLSGDWQTADG 215


>gi|332638282|ref|ZP_08417145.1| DNA replication and repair protein RecO [Weissella cibaria KACC
           11862]
          Length = 264

 Score = 42.0 bits (97), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 46/178 (25%), Positives = 76/178 (42%), Gaps = 18/178 (10%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQN 65
           DAI++  +   EK+++++++T+Q G+ + +++NG+S R Q       L    +   L   
Sbjct: 6   DAIVMYQQDRKEKDLMVKMLTKQGGKRMFYIKNGKSKRYQFAADVQPLTVATFEGTLNPT 65

Query: 66  LGEFRFEVLESHCAKLL-----SSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
              F   V ESH ++ L      ++   Y L  I   F    + +P  + Y+     L  
Sbjct: 66  GLSFINAVKESHQSRELMMDVTKNAYMTYILGLIDAAF---VDNQPIGKWYEWAR--LAI 120

Query: 121 HKI-----PSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCR 173
            KI     P  I   F   E+ LL   G      +CVV G     L  S K  G +C+
Sbjct: 121 EKIERGLDPQGIANFF---EIKLLPAFGLEPTWGECVVCGRRDLPLDFSEKLNGTLCQ 175


>gi|259046830|ref|ZP_05737231.1| DNA repair protein RecO [Granulicatella adiacens ATCC 49175]
 gi|259036453|gb|EEW37708.1| DNA repair protein RecO [Granulicatella adiacens ATCC 49175]
          Length = 260

 Score = 41.2 bits (95), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 37/175 (21%), Positives = 80/175 (45%), Gaps = 10/175 (5%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNL-VRVNWRSRLAQ 64
           D I++  ++Y EK+++++++TR +G+ + F+RN Q     P+  A  +  R  +   + Q
Sbjct: 8   DGIVIMRQTYREKDMLVKILTRDHGKLMFFLRNAQQSN-HPLTAATQVFTRATFLGHIHQ 66

Query: 65  NLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIP 124
           N   F   + +SH  K  +  L     Q+++     L +      + +     L    I 
Sbjct: 67  NGFSF---LKDSHDIKPATIVLQDVKAQAVLAYLTQLTDAVMDDHIVNKTVFQLLWDSIE 123

Query: 125 SVIGKIFVQI-----ELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRS 174
           ++   I  ++     E+ +L+  G  ++   CV+     DL+  S +  G +C++
Sbjct: 124 AINNGIDAEVILRFFEIKILRYFGVEVEWQHCVICNRDTDLVDFSIQKHGCLCKN 178


>gi|145588595|ref|YP_001155192.1| DNA repair protein RecO [Polynucleobacter necessarius subsp.
           asymbioticus QLW-P1DMWA-1]
 gi|254764653|sp|A4SVW4|RECO_POLSQ RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|145047001|gb|ABP33628.1| DNA replication and repair protein RecO [Polynucleobacter
           necessarius subsp. asymbioticus QLW-P1DMWA-1]
          Length = 244

 Score = 41.2 bits (95), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 43/170 (25%), Positives = 70/170 (41%), Gaps = 35/170 (20%)

Query: 4   QDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR---MQPILQAGNLVRVNWRS 60
            + A +L    Y E ++IL+V TRQ+GR +  +  G       ++P+LQ    + V+W  
Sbjct: 8   DEPAFVLHSIPYKETSLILDVFTRQHGR-MALIAKGAKRPHSVLRPVLQRFQPLLVSWSG 66

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVP------------LFRFLPEREPCL 108
           +      E R           L+ S ++ G+ S+V             L +FL   +   
Sbjct: 67  K-----SELR----------TLTKSEWVGGMPSLVGDALLCGFYLNELLVKFLAREDDYE 111

Query: 109 ELYD----MLNIFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVT 154
            LYD     +N   N       + +I    EL LL+  G+   L +CV T
Sbjct: 112 RLYDRYSETINALSNLEFESKGLEEILRPFELSLLQETGYAAALDRCVET 161


>gi|117924217|ref|YP_864834.1| DNA replication and repair protein RecO [Magnetococcus sp. MC-1]
 gi|117607973|gb|ABK43428.1| DNA replication and repair protein RecO [Magnetococcus sp. MC-1]
          Length = 242

 Score = 41.2 bits (95), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 41/91 (45%)

Query: 97  LFRFLPEREPCLELYDMLNIFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGV 156
           ++R LP  +   +L+  L   L+  +      ++    +  LL N+GFG  +  C   G 
Sbjct: 103 VYRLLPVEDANPKLFGALQEALDRLEAGEAALEVVGLWQGFLLHNLGFGWQVAHCAGCGG 162

Query: 157 TQDLLWVSPKSGGAVCRSVGLPYAEKMLVLP 187
             DL + S K    VC   G P+  ++L LP
Sbjct: 163 ETDLRFFSTKRNQTVCAPCGTPHRHRLLPLP 193


>gi|326389847|ref|ZP_08211411.1| DNA repair protein RecO [Thermoanaerobacter ethanolicus JW 200]
 gi|325994115|gb|EGD52543.1| DNA repair protein RecO [Thermoanaerobacter ethanolicus JW 200]
          Length = 248

 Score = 41.2 bits (95), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 42/173 (24%), Positives = 75/173 (43%), Gaps = 6/173 (3%)

Query: 4   QDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLA 63
           + +AI+L     GE + I  + T+ YG+     +  +  + + +      V  N+     
Sbjct: 5   KTEAIVLKNNLIGETDKIATLFTKSYGKLQAVAKGARRSKSRFVNAIRPFVVANYVIFEG 64

Query: 64  QNLGEF-RFEVLESHCAKLLSSSLFLYGLQSIVP--LFRFLPEREPCLELYDMLNIFLNC 120
           QN     ++E++E+H  K +   L  + + S +   + + L E +    LY  L   L  
Sbjct: 65  QNYYYIDQWELIEAH--KNIEKDLAKFSVASYIAETINKILEENQKSERLYLFLKHSLKA 122

Query: 121 HKIPSVIGKIFVQ-IELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVC 172
                +   IF+    L L+  +G+   L  CVV G  ++L + S   GGAVC
Sbjct: 123 VDELQIDPLIFISSYNLKLVSLLGYMPQLDNCVVCGKRENLKYFSNSCGGAVC 175


>gi|167039987|ref|YP_001662972.1| DNA repair protein RecO [Thermoanaerobacter sp. X514]
 gi|300914077|ref|ZP_07131393.1| DNA repair protein RecO [Thermoanaerobacter sp. X561]
 gi|307724690|ref|YP_003904441.1| DNA repair protein RecO [Thermoanaerobacter sp. X513]
 gi|238687639|sp|B0K710|RECO_THEPX RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|166854227|gb|ABY92636.1| DNA repair protein RecO [Thermoanaerobacter sp. X514]
 gi|300889012|gb|EFK84158.1| DNA repair protein RecO [Thermoanaerobacter sp. X561]
 gi|307581751|gb|ADN55150.1| DNA repair protein RecO [Thermoanaerobacter sp. X513]
          Length = 248

 Score = 41.2 bits (95), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 42/173 (24%), Positives = 75/173 (43%), Gaps = 6/173 (3%)

Query: 4   QDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLA 63
           + +AI+L     GE + I  + T+ YG+     +  +  + + +      V  N+     
Sbjct: 5   KTEAIVLKNNLIGETDKIATLFTKSYGKLQAVAKGARRSKSRFVNAIRPFVVANYVIFEG 64

Query: 64  QNLGEF-RFEVLESHCAKLLSSSLFLYGLQSIVP--LFRFLPEREPCLELYDMLNIFLNC 120
           QN     ++E++E+H  K +   L  + + S +   + + L E +    LY  L   L  
Sbjct: 65  QNYYYIDQWELIEAH--KNIEKDLAKFSVASYIAETINKILEENQKSERLYLFLKHSLKA 122

Query: 121 HKIPSVIGKIFVQ-IELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVC 172
                +   IF+    L L+  +G+   L  CVV G  ++L + S   GGAVC
Sbjct: 123 VDELQIDPLIFISSYNLKLVSLLGYMPQLDNCVVCGKRENLKYFSNSCGGAVC 175


>gi|194290150|ref|YP_002006057.1| DNA repair protein reco [Cupriavidus taiwanensis LMG 19424]
 gi|193223985|emb|CAQ69994.1| DNA repair protein [Cupriavidus taiwanensis LMG 19424]
          Length = 295

 Score = 40.8 bits (94), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 43/164 (26%), Positives = 68/164 (41%), Gaps = 25/164 (15%)

Query: 4   QDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSH---RMQPILQAGNLVRVNWRS 60
           +    +L    Y E ++IL+V TR YGR L  V  G       ++ +LQ  + V V+W  
Sbjct: 63  EQPGFVLHAWPYRETSLILDVFTRDYGR-LSMVAKGAKRPHSALRAVLQHFHPVSVSWSG 121

Query: 61  RLAQNLGEFRFEV-------LESHCAKLLSSSLFLYGLQSIVPLFRFLPERE--PCLELY 111
           R     GE +          +       L S+ +L  L     L RF P  +  P L  +
Sbjct: 122 R-----GEVKTLTKAEWVGGMPPLAGDALLSAFYLNEL-----LMRFCPREDAHPVLFRH 171

Query: 112 DMLNIFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTG 155
            +  +    H  P+  G +    E +LL+  GF +   +C+ TG
Sbjct: 172 YLSTLTRLAHGEPA--GLVLRSFERVLLQETGFAVAFDQCLSTG 213


>gi|162449950|ref|YP_001612317.1| DNA repair protein RecO (recombination protein O) [Sorangium
           cellulosum 'So ce 56']
 gi|161160532|emb|CAN91837.1| DNA repair protein RecO (recombination protein O) [Sorangium
           cellulosum 'So ce 56']
          Length = 239

 Score = 40.8 bits (94), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 43/173 (24%), Positives = 70/173 (40%), Gaps = 15/173 (8%)

Query: 15  YGEKNIILEVMTRQYGRHLGFVRNGQ-SHRMQPILQAGNLVRVNWRSRLAQNLGEFRFEV 73
           +GE ++++ + T Q G      R  + S +  P L+  +L+RV    R    L +     
Sbjct: 24  FGEADLLVGLFTEQGGLISATARGARRSAKRFPALEPMHLLRVTLEIRPGAELAQLTEAA 83

Query: 74  LE-------SHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPSV 126
           +E       +   +L  +   L  ++ I P      E+    EL  +L+        P  
Sbjct: 84  IERPRLRLAADLGRLEVAGRALRWVREIAPAHTA--EQAAWSELNQLLDRLDEVSTPPPQ 141

Query: 127 IGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLW---VSPKSGGAVCRSVG 176
              +  +  L LL   G+GL+LT+CV  G   D        P  GG VCR+ G
Sbjct: 142 --ALLAETGLRLLVAFGWGLELTQCVRCGRACDTTQSACADPARGGLVCRACG 192


>gi|94968222|ref|YP_590270.1| DNA repair protein RecO [Candidatus Koribacter versatilis Ellin345]
 gi|119361444|sp|Q1ISF4|RECO_ACIBL RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|94550272|gb|ABF40196.1| DNA replication and repair protein RecO [Candidatus Koribacter
           versatilis Ellin345]
          Length = 244

 Score = 40.4 bits (93), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 44/178 (24%), Positives = 77/178 (43%), Gaps = 9/178 (5%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQ--PILQAGNLVRVNW 58
           M  Q +AI+L      E ++++ + TR  G+  G  +  +  R +    L+    VRV +
Sbjct: 1   MLKQSEAIVLRTYPMREADLLVTLFTRAEGKIKGVAKAAKKSRRRFGGALEPLTHVRVYY 60

Query: 59  RSRLAQNLGEF-RFEVLESHCAKLLS--SSLFLYGLQSIVPLFRFLPEREPCLELYDMLN 115
             R  Q L      +VL S  +  +    +L L  +  ++     LP+REP   ++  L+
Sbjct: 61  EDRERQELTRLDSCDVLASPMSAEVDYPRALALGHVAEVID--DLLPDREPNDAVF-RLS 117

Query: 116 IFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVT-QDLLWVSPKSGGAVC 172
           + +    +P  +       +L +++  GF  DL  CVV G    D  +  P   G VC
Sbjct: 118 LAVLGQLVPGAVWMPLTYFDLWMVRLAGFLPDLMHCVVCGEELDDRAFFHPLVDGLVC 175


>gi|269140065|ref|YP_003296766.1| DNA repair protein [Edwardsiella tarda EIB202]
 gi|267985726|gb|ACY85555.1| DNA repair protein [Edwardsiella tarda EIB202]
 gi|304559893|gb|ADM42557.1| DNA recombination and repair protein RecO [Edwardsiella tarda
           FL6-60]
          Length = 242

 Score = 40.4 bits (93), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 39/158 (24%), Positives = 65/158 (41%), Gaps = 11/158 (6%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNWRS 60
           WQ  A +L  R Y E +++L+  T  +GR     +  +S R  ++  LQ    + + W  
Sbjct: 4   WQR-AFVLHARPYSETSLMLDTFTEGHGRVRLLAKGARSRRSLLKGALQPFTPLLIRWGG 62

Query: 61  RLAQNLGEFR-FEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLE--LYDMLNIF 117
           R     GE +     E+    L  S + LY    +  L   + E+E C     +D L+  
Sbjct: 63  R-----GEVKTLRSAEAVSLALPLSGITLYSGLYVNELLARVLEQETCYSALFFDYLHCI 117

Query: 118 LNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTG 155
            +             + EL LL  +G+G+D   C  +G
Sbjct: 118 QHLAAHAGSPEPALRRFELALLTQLGYGVDFLHCAGSG 155


>gi|307266974|ref|ZP_07548491.1| DNA repair protein RecO [Thermoanaerobacter wiegelii Rt8.B1]
 gi|306918023|gb|EFN48280.1| DNA repair protein RecO [Thermoanaerobacter wiegelii Rt8.B1]
          Length = 248

 Score = 40.4 bits (93), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 42/173 (24%), Positives = 75/173 (43%), Gaps = 6/173 (3%)

Query: 4   QDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLA 63
           + +AI+L     GE + I  + T+ YG+     +  +  + + +      V  N+     
Sbjct: 5   KTEAIVLKNNLIGETDKIATLFTKSYGKLQAVAKGARRSKSRFVNAIRLFVVANYVIFEG 64

Query: 64  QNLGEF-RFEVLESHCAKLLSSSLFLYGLQSIVP--LFRFLPEREPCLELYDMLNIFLNC 120
           QN     ++E++E+H  K +   L  + + S +   + + L E +    LY  L   L  
Sbjct: 65  QNYYYIDQWELIEAH--KNIEKDLAKFSVASYIAETINKILEENQKSERLYLFLKHSLKA 122

Query: 121 HKIPSVIGKIFVQ-IELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVC 172
                +   IF+    L L+  +G+   L  CVV G  ++L + S   GGAVC
Sbjct: 123 VDELQIDPLIFISSYNLKLVSLLGYMPQLDNCVVCGKRENLKYFSNSCGGAVC 175


>gi|238920903|ref|YP_002934418.1| DNA repair protein RecO, [Edwardsiella ictaluri 93-146]
 gi|238870472|gb|ACR70183.1| DNA repair protein RecO, putative [Edwardsiella ictaluri 93-146]
          Length = 242

 Score = 40.4 bits (93), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 39/158 (24%), Positives = 65/158 (41%), Gaps = 11/158 (6%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNWRS 60
           WQ  A +L  R Y E +++L+  T  +GR     +  +S R  ++  LQ    + + W  
Sbjct: 4   WQR-AFVLHARPYSETSLMLDTFTEGHGRVRLLAKGARSRRSLLKGALQPFTPLLIRWGG 62

Query: 61  RLAQNLGEFR-FEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLE--LYDMLNIF 117
           R     GE +     E+    L  S + LY    +  L   + E+E C     +D L+  
Sbjct: 63  R-----GEVKTLRSAEAVSLALPLSGITLYSGLYVNELLARVLEQETCYNALFFDYLHCI 117

Query: 118 LNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTG 155
            +             + EL LL  +G+G+D   C  +G
Sbjct: 118 QHLAAHAGSPEPALRRFELALLAQLGYGVDFLHCAGSG 155


>gi|73541937|ref|YP_296457.1| DNA repair protein RecO [Ralstonia eutropha JMP134]
 gi|119361473|sp|Q46Z20|RECO_RALEJ RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|72119350|gb|AAZ61613.1| DNA replication and repair protein RecO [Ralstonia eutropha JMP134]
          Length = 291

 Score = 40.4 bits (93), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 41/164 (25%), Positives = 67/164 (40%), Gaps = 25/164 (15%)

Query: 4   QDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSH---RMQPILQAGNLVRVNWRS 60
           +    +L    Y E ++IL+V TR +GR L  V  G       ++P+LQ  + + ++W  
Sbjct: 59  EQPGFVLHAWPYRETSLILDVFTRDHGR-LSMVAKGAKRPHSALRPVLQHFHPISLSWSG 117

Query: 61  RLAQNLGEFRFEV-------LESHCAKLLSSSLFLYGLQSIVPLFRFLPERE--PCLELY 111
           R     GE +          +       L S+ +L  L     L RF P  +  P L  +
Sbjct: 118 R-----GEVKTLTRAEWVGGMPPLAGDALLSAFYLNEL-----LMRFCPREDGHPALFRH 167

Query: 112 DMLNIFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTG 155
            M  +    H      G +    E +LL+  GF +   +C+ TG
Sbjct: 168 YMATLTRLAHG--EAAGLVLRSFERVLLQETGFAVAFDQCLSTG 209


>gi|254521728|ref|ZP_05133783.1| DNA repair protein RecO [Stenotrophomonas sp. SKA14]
 gi|219719319|gb|EED37844.1| DNA repair protein RecO [Stenotrophomonas sp. SKA14]
          Length = 239

 Score = 40.4 bits (93), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 40/158 (25%), Positives = 69/158 (43%), Gaps = 14/158 (8%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M   D   +L  R+Y E ++++EV++ Q+GR +G +  G S     +L+A  L  + W  
Sbjct: 2   MIEDDTGFVLHARAYRETSLLVEVLSAQHGR-IGLLARGVSTAKGQVLRAA-LQPLQWIR 59

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLF-------RFLPEREPCLELYDM 113
             AQ  GE      +   A+ L ++  L G Q+++  F       R  P ++P  ELY  
Sbjct: 60  FSAQQRGEL----AQLRAAEALDAAPRLVG-QAMLAGFYLSELTLRLAPRQDPLPELYLA 114

Query: 114 LNIFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKC 151
                    + + +     + E  LL  +G G +L   
Sbjct: 115 YGEARARLAVGAGLAWTLRRFERELLSALGLGFELDSA 152


>gi|42559491|sp|Q8RB48|RECO_THETN RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
          Length = 247

 Score = 40.4 bits (93), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 43/180 (23%), Positives = 74/180 (41%), Gaps = 14/180 (7%)

Query: 2   YWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSR 61
           + + +AI+L      EK+ I  + TR YG+     +  +  + + +      +  N+   
Sbjct: 3   FLKTEAIVLKSNLISEKDKIATLFTRDYGKLQAVAKGARRSKSRFVNAVRPFIVANYVIF 62

Query: 62  LAQNLGEF-------RFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDML 114
             QN            FE +E    K   +S   Y  ++I    R L E++   +LY   
Sbjct: 63  EGQNYYYIDQWELVKNFENIEKDLKKFALAS---YISETIS---RVLEEKQKNTKLYFFT 116

Query: 115 NIFLNCHKIPSVIGKIFV-QIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCR 173
              L   +  +V   IF+    L L+  +G+   L  C V G  ++L + S   GGAVC+
Sbjct: 117 KHSLEAVESLNVETSIFLFSYTLKLISLLGYMPVLDSCAVCGKKENLSYFSSSCGGAVCK 176


>gi|85059763|ref|YP_455465.1| DNA repair protein RecO [Sodalis glossinidius str. 'morsitans']
 gi|119361486|sp|Q2NS15|RECO_SODGM RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|84780283|dbj|BAE75060.1| DNA repair protein RecO [Sodalis glossinidius str. 'morsitans']
          Length = 260

 Score = 40.4 bits (93), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 63/245 (25%), Positives = 95/245 (38%), Gaps = 26/245 (10%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNWRS 60
           WQ  A +L  R Y E +++L+  T Q GR     +  +S R  ++ +LQ    +   W  
Sbjct: 4   WQR-AFVLHARPYSETSLLLDFFTEQQGRVRVLAKGARSRRSALKGVLQPFTPLLARWSG 62

Query: 61  RLAQNLGEFR-FEVLESHCAKLLSSSLFLY-GLQSIVPLFRFLPEREPCLEL-YDMLNIF 117
           R     GE +     E     L  S L LY GL     L R L       +L YD L+  
Sbjct: 63  R-----GEVKTLRSAEPVSLGLPLSGLMLYSGLYINELLSRVLDHETDYSKLFYDYLHCL 117

Query: 118 LNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTG-VTQDLLWVSPKSGGAVCRSVG 176
                          + EL LL ++G+G+D   C  +G    D +    +       SV 
Sbjct: 118 QWLAGATGSPEPALRRFELALLSHLGYGVDFLHCAGSGEPVDDAMTYRYREEKGFTASV- 176

Query: 177 LPYAEKMLVLPSFLWKEEQTI------DADSLKSAFQLTDYFLNKYALQHNIIHCHLLRE 230
                 +L   SF  +E + +      D D+L++A + T   L  Y L    +  H L  
Sbjct: 177 ------LLDRYSFSGRELRALAEGEFPDIDTLRAAKRFTRMALKPY-LGGKPLKSHELFR 229

Query: 231 NFLGK 235
            FL +
Sbjct: 230 QFLDR 234


>gi|308069927|ref|YP_003871532.1| DNA repair protein RecO [Paenibacillus polymyxa E681]
 gi|305859206|gb|ADM70994.1| DNA repair protein recO (Recombination protein O) [Paenibacillus
           polymyxa E681]
          Length = 250

 Score = 40.0 bits (92), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 44/185 (23%), Positives = 74/185 (40%), Gaps = 19/185 (10%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR------MQPILQAGNLV 54
           M ++ + I++    YGE N I+ + T   G+    VR  +  +       QP    G  V
Sbjct: 1   MLYRVEGIVIRSMDYGEGNKIITLCTESGGKAGVLVRGAKKSKSRHAALTQP-FTYGEFV 59

Query: 55  RVNWRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDML 114
                     N GE    +++SH       +   Y   +   L R L + E     +  L
Sbjct: 60  FFRNTGLGTLNAGE----IIQSHHTLREDITKAAYASYACELLDRVLQDEETGAFWFKQL 115

Query: 115 NIFLNC---HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTG--VTQDLLWVSPKSGG 169
              L      K P ++  I+   E  +L+  G+   L  C+ +G     + ++VSP+ GG
Sbjct: 116 KACLEALESGKDPLIVMSIY---EFKILQAAGYAPQLDACISSGQQCADEDMFVSPRLGG 172

Query: 170 AVCRS 174
            +CRS
Sbjct: 173 VLCRS 177


>gi|20807456|ref|NP_622627.1| recombinational DNA repair protein [Thermoanaerobacter
           tengcongensis MB4]
 gi|20515981|gb|AAM24231.1| Recombinational DNA repair protein [Thermoanaerobacter
           tengcongensis MB4]
          Length = 257

 Score = 40.0 bits (92), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 43/180 (23%), Positives = 74/180 (41%), Gaps = 14/180 (7%)

Query: 2   YWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSR 61
           + + +AI+L      EK+ I  + TR YG+     +  +  + + +      +  N+   
Sbjct: 13  FLKTEAIVLKSNLISEKDKIATLFTRDYGKLQAVAKGARRSKSRFVNAVRPFIVANYVIF 72

Query: 62  LAQNLGEF-------RFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDML 114
             QN            FE +E    K   +S   Y  ++I    R L E++   +LY   
Sbjct: 73  EGQNYYYIDQWELVKNFENIEKDLKKFALAS---YISETIS---RVLEEKQKNTKLYFFT 126

Query: 115 NIFLNCHKIPSVIGKIFV-QIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCR 173
              L   +  +V   IF+    L L+  +G+   L  C V G  ++L + S   GGAVC+
Sbjct: 127 KHSLEAVESLNVETSIFLFSYTLKLISLLGYMPVLDSCAVCGKKENLSYFSSSCGGAVCK 186


>gi|317491020|ref|ZP_07949456.1| recombination protein O [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316920567|gb|EFV41890.1| recombination protein O [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 242

 Score = 40.0 bits (92), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 44/171 (25%), Positives = 71/171 (41%), Gaps = 21/171 (12%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNWRS 60
           WQ  A +L  R Y E +++L++ T  +GR     +  +S R  ++  LQ    + V W  
Sbjct: 4   WQR-AFVLHGRPYSETSLLLDLFTEGHGRVRLLAKGARSKRSSLKGALQPFTPLLVRWGG 62

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLF------RFLPEREPCLELY-DM 113
           +          EV     A+ +S  L L G+     L+      R L +      L+ D 
Sbjct: 63  K---------GEVKTLRNAEPVSLGLPLTGISLYSGLYVNELVSRVLEQETNYSSLFFDY 113

Query: 114 LNIFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTG--VTQDLLW 162
           LN   N             + EL LL N+G+G+D   C  +G  V+ D+ +
Sbjct: 114 LNCLQNLAATVGSPEHTLREFELALLGNLGYGIDFLHCAGSGEPVSDDMTY 164


>gi|319935429|ref|ZP_08009866.1| hypothetical protein HMPREF9488_00697 [Coprobacillus sp. 29_1]
 gi|319809645|gb|EFW06058.1| hypothetical protein HMPREF9488_00697 [Coprobacillus sp. 29_1]
          Length = 245

 Score = 40.0 bits (92), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 40/178 (22%), Positives = 83/178 (46%), Gaps = 18/178 (10%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNG-------QSHRMQPILQAGNLVRVNW 58
           + IIL    Y E ++IL + T++YG+ +G +  G        +   Q ++ +   + +N 
Sbjct: 11  EGIILKKTVYKENDMILHIYTKEYGK-IGIIARGIRKITSKNARACQEMMISE--MSINL 67

Query: 59  RSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFL 118
           +  L+  +     + L      L S  +  Y L+     +R+L +  P  + YD+L   L
Sbjct: 68  KKGLSSLMKATPVDYLRHIKENLDSEIVANYVLEY---FYRYLEDNNPNQDEYDILYHSL 124

Query: 119 NC--HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRS 174
               H    ++  +++   + +L + G  +D+  CVV G ++ +  +S + GG VC++
Sbjct: 125 KALDHGYSPLL--VYLLFNVFVLNHNGVSIDVEGCVVCGSSK-VTAISLRDGGFVCQN 179


>gi|283782940|ref|YP_003373694.1| DNA repair protein RecO [Gardnerella vaginalis 409-05]
 gi|298253428|ref|ZP_06977220.1| DNA repair protein RecO [Gardnerella vaginalis 5-1]
 gi|283442174|gb|ADB14640.1| DNA repair protein RecO [Gardnerella vaginalis 409-05]
 gi|297532823|gb|EFH71709.1| DNA repair protein RecO [Gardnerella vaginalis 5-1]
          Length = 248

 Score = 40.0 bits (92), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 57/255 (22%), Positives = 103/255 (40%), Gaps = 44/255 (17%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGF---VRNGQSH---RMQPIL-------Q 49
           ++D+A++L     GE + I+ ++T+++G+       VR  +S    R++P++       Q
Sbjct: 4   YRDEAVVLRTFPLGEADRIVVLLTKRHGKVRAVAKGVRRLKSRFGGRLEPLMRVDLLLAQ 63

Query: 50  AGNLVRVNWRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLE 109
             +L  V+    +A   GE         CA   S       L+ +  L       E   E
Sbjct: 64  GKSLDVVSQAVSIAAYAGEI--------CADYTSYEYANVMLEVVDLLVSNEYTDEYRRE 115

Query: 110 LYDMLNIFLNC---------HK-IPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQD 159
             D L  +            HK  P  IG  ++   L  L   G+   L  CVV G  +D
Sbjct: 116 YQDTLGQYRLLTAALLSLSKHKHSPDAIGVSYI---LRALSLAGWSPRLQACVVCGKNED 172

Query: 160 LLWVSPKSGGAVCRSVGLPYAE--------KMLVLPSFLWK--EEQTIDADSLKSAFQLT 209
           L + SP +GG +C S   P +         ++  L    W   +  ++D+ +++   Q  
Sbjct: 173 LCYFSPCAGGMMCASDHTPDSIVCANSTRLQLCALAQGNWSVLDGVSVDSSTMRCVQQWA 232

Query: 210 DYFLNKYALQHNIIH 224
           +Y+L +      ++H
Sbjct: 233 EYYLERPIRSMGLLH 247


>gi|46907688|ref|YP_014077.1| DNA repair protein RecO [Listeria monocytogenes serotype 4b str.
           F2365]
 gi|47093467|ref|ZP_00231230.1| recombination protein O [Listeria monocytogenes str. 4b H7858]
 gi|226224061|ref|YP_002758168.1| RecO protein [Listeria monocytogenes Clip81459]
 gi|254824481|ref|ZP_05229482.1| recombination protein O [Listeria monocytogenes FSL J1-194]
 gi|254852085|ref|ZP_05241433.1| recombination protein O [Listeria monocytogenes FSL R2-503]
 gi|254932645|ref|ZP_05266004.1| recombination protein O [Listeria monocytogenes HPB2262]
 gi|255521275|ref|ZP_05388512.1| DNA repair protein RecO [Listeria monocytogenes FSL J1-175]
 gi|300765603|ref|ZP_07075582.1| recombination protein O [Listeria monocytogenes FSL N1-017]
 gi|61215088|sp|Q71ZL0|RECO_LISMF RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|259563681|sp|C1KVA7|RECO_LISMC RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|46880957|gb|AAT04254.1| recombination protein O [Listeria monocytogenes serotype 4b str.
           F2365]
 gi|47018143|gb|EAL08913.1| recombination protein O [Listeria monocytogenes str. 4b H7858]
 gi|225876523|emb|CAS05232.1| Putative RecO protein [Listeria monocytogenes serotype 4b str. CLIP
           80459]
 gi|258605384|gb|EEW17992.1| recombination protein O [Listeria monocytogenes FSL R2-503]
 gi|293584204|gb|EFF96236.1| recombination protein O [Listeria monocytogenes HPB2262]
 gi|293593719|gb|EFG01480.1| recombination protein O [Listeria monocytogenes FSL J1-194]
 gi|300513704|gb|EFK40772.1| recombination protein O [Listeria monocytogenes FSL N1-017]
 gi|328465503|gb|EGF36732.1| DNA repair protein RecO [Listeria monocytogenes 1816]
 gi|332311901|gb|EGJ24996.1| DNA repair protein RecO [Listeria monocytogenes str. Scott A]
          Length = 255

 Score = 40.0 bits (92), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 42/174 (24%), Positives = 76/174 (43%), Gaps = 13/174 (7%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQN 65
           + I++   SY E + I+ + TR++G+ +G V  G       +     L    + +    N
Sbjct: 5   EGIVIRQTSYRESDKIVRMYTREFGK-IGVVARGAKKTKSRLAAVTQLFTNGYFTFFGSN 63

Query: 66  -LGEFR-FEVLESHCAKLLSSSLFLYGLQSIVP--LFRFLPEREPCLELYDMLNIFL--- 118
            LG  +  EV+E+  +  +   +F+    + V   L +   ER+P   LY++    L   
Sbjct: 64  GLGTLQQGEVIENFSS--IQQDIFMTAYATYVCELLDKATEERQPNPYLYELTFQILRDI 121

Query: 119 NCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVC 172
           N    P ++ +IF   E+ +L  +G    + KC + G T      S  S G +C
Sbjct: 122 NEGYDPQILTQIF---EMKMLPVLGLYPTMDKCAICGETTGHFDFSTSSNGIIC 172


>gi|306826213|ref|ZP_07459547.1| recombination protein O [Streptococcus sp. oral taxon 071 str.
           73H25AP]
 gi|304431489|gb|EFM34471.1| recombination protein O [Streptococcus sp. oral taxon 071 str.
           73H25AP]
          Length = 256

 Score = 40.0 bits (92), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 46/219 (21%), Positives = 87/219 (39%), Gaps = 40/219 (18%)

Query: 7   AIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQNL 66
            ++L  R++ E + ++++ T Q G+ + FV++    ++ P++Q   LV   +  R+  + 
Sbjct: 9   GLVLYNRNFREDDKLVKIFTEQAGKRMFFVKHAGQSKLAPVIQP--LVLARFLLRINDDG 66

Query: 67  GEFRFEVLESHCAKLLSSSLFLYGLQSIV---------------PLFRFLPER----EPC 107
             +  +  E      ++S LF+    + V               PLF FL +     E  
Sbjct: 67  LSYIEDYHEVMTFPKINSDLFVMAYATYVAALADASLQDNQQDAPLFAFLQKTLELMEAG 126

Query: 108 LELYDMLNIFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKS 167
           L+   + NIF                 E+ +L   G  L+  +CV           S K 
Sbjct: 127 LDYQVLTNIF-----------------EIQILTRFGISLNFNECVFCHRVGQAFDFSFKY 169

Query: 168 GGAVCRSVGLPYAEKMLVLPS--FLWKEEQTIDADSLKS 204
           G  +C         +  + P+  +L  + Q ID D+LK+
Sbjct: 170 GACLCPEHYHEDERRCHLNPNIPYLLNQFQAIDFDTLKT 208


>gi|81428489|ref|YP_395489.1| DNA repair protein O [Lactobacillus sakei subsp. sakei 23K]
 gi|90103522|sp|Q38XA1|RECO_LACSS RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|78610131|emb|CAI55180.1| DNA repair protein O [Lactobacillus sakei subsp. sakei 23K]
          Length = 272

 Score = 39.7 bits (91), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 42/178 (23%), Positives = 76/178 (42%), Gaps = 18/178 (10%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQ------PILQA--GNLVRVN 57
           + +++  ++Y EK+++++++T ++G+ + ++R     + +      P  QA  G  +R +
Sbjct: 10  NGLVMYRKNYKEKDMLVKILTDRFGKKMFYLRGANKPKFRLSAAILPFTQAEYGGDIRDD 69

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQS-IVPLFRF-LPEREPCLELYDMLN 115
             S L       +F+         +S  LFL    + I+ L     P+ EP    YD + 
Sbjct: 70  GLSFLNNVKSATQFQT--------ISQDLFLNAYATYILNLIDVGFPDSEPLGIWYDKVE 121

Query: 116 IFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCR 173
             LN          I   IE+ LL+  G    L  C V G T      S   GG +C+
Sbjct: 122 QALNLIDEGFDAAMITHIIEIQLLQVFGVQPQLQGCAVCGRTDLAFDYSESYGGLLCQ 179


>gi|332975859|gb|EGK12737.1| recombination protein O [Desmospora sp. 8437]
          Length = 250

 Score = 39.7 bits (91), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 46/195 (23%), Positives = 82/195 (42%), Gaps = 23/195 (11%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR------MQPILQAGNLVRV-NW 58
           + +++  R YGE + ++ + T+ +G++    R  +  +       QP      L    + 
Sbjct: 6   EGVVIRTRDYGESHKVVILFTKAHGKYAVMARGAKKPKSRLAAVTQPFTSGEYLCFTGSG 65

Query: 59  RSRLAQNLGEFRFEVLESHCAKLLSSSLFL--YGLQSIVPLFRFLPEREPCLELYDMLNI 116
            + L+Q       ++LES    LL S L    Y       L +   E+EP L +Y  L  
Sbjct: 66  MATLSQG------DILESR--HLLRSDLVRASYAAYWTELLDKLKEEKEPDLPVYIWLET 117

Query: 117 FLNCHK---IPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCR 173
            LN  +    P ++ +IF   EL +L++ G+   L  CV  G     +  S + GG +C 
Sbjct: 118 VLNLLEEGVDPEILSRIF---ELKVLESAGYRPRLQGCVQCGGADTPVKFSIRQGGFLCS 174

Query: 174 SVGLPYAEKMLVLPS 188
                  E + + P+
Sbjct: 175 GCSHRDPEALFLSPA 189


>gi|51597204|ref|YP_071395.1| DNA repair protein RecO [Yersinia pseudotuberculosis IP 32953]
 gi|108808448|ref|YP_652364.1| DNA repair protein RecO [Yersinia pestis Antiqua]
 gi|108811371|ref|YP_647138.1| DNA repair protein RecO [Yersinia pestis Nepal516]
 gi|145598835|ref|YP_001162911.1| DNA repair protein RecO [Yersinia pestis Pestoides F]
 gi|149365388|ref|ZP_01887423.1| DNA repair protein [Yersinia pestis CA88-4125]
 gi|153948747|ref|YP_001400119.1| DNA repair protein RecO [Yersinia pseudotuberculosis IP 31758]
 gi|161484839|ref|NP_668622.2| DNA repair protein RecO [Yersinia pestis KIM 10]
 gi|161511351|ref|NP_993845.2| DNA repair protein RecO [Yersinia pestis biovar Microtus str.
           91001]
 gi|162420369|ref|YP_001607937.1| DNA repair protein RecO [Yersinia pestis Angola]
 gi|165925301|ref|ZP_02221133.1| DNA repair protein RecO [Yersinia pestis biovar Orientalis str.
           F1991016]
 gi|165937188|ref|ZP_02225753.1| DNA repair protein RecO [Yersinia pestis biovar Orientalis str.
           IP275]
 gi|166008243|ref|ZP_02229141.1| DNA repair protein RecO [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166212406|ref|ZP_02238441.1| DNA repair protein RecO [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|167399560|ref|ZP_02305084.1| DNA repair protein RecO [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167421237|ref|ZP_02312990.1| DNA repair protein RecO [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167423802|ref|ZP_02315555.1| DNA repair protein RecO [Yersinia pestis biovar Mediaevalis str.
           K1973002]
 gi|167467392|ref|ZP_02332096.1| DNA repair protein RecO [Yersinia pestis FV-1]
 gi|170023437|ref|YP_001719942.1| DNA repair protein RecO [Yersinia pseudotuberculosis YPIII]
 gi|186896301|ref|YP_001873413.1| DNA repair protein RecO [Yersinia pseudotuberculosis PB1/+]
 gi|218929792|ref|YP_002347667.1| DNA repair protein RecO [Yersinia pestis CO92]
 gi|229838283|ref|ZP_04458442.1| gap repair protein [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|229895521|ref|ZP_04510692.1| gap repair protein [Yersinia pestis Pestoides A]
 gi|229898847|ref|ZP_04513992.1| gap repair protein [Yersinia pestis biovar Orientalis str. India
           195]
 gi|229901621|ref|ZP_04516743.1| gap repair protein [Yersinia pestis Nepal516]
 gi|270489810|ref|ZP_06206884.1| DNA repair protein RecO [Yersinia pestis KIM D27]
 gi|294504511|ref|YP_003568573.1| DNA repair protein RecO [Yersinia pestis Z176003]
 gi|20139503|sp|Q8ZD70|RECO_YERPE RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|61214871|sp|Q667V3|RECO_YERPS RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|119361499|sp|Q1C553|RECO_YERPA RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|119361500|sp|Q1CKE2|RECO_YERPN RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|166221917|sp|A4TKX6|RECO_YERPP RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|166918733|sp|A7FFU1|RECO_YERP3 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|238687296|sp|A9R404|RECO_YERPG RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|238688564|sp|B1JRC9|RECO_YERPY RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|238691450|sp|B2KA45|RECO_YERPB RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|51590486|emb|CAH22126.1| DNA repair protein [Yersinia pseudotuberculosis IP 32953]
 gi|108775019|gb|ABG17538.1| DNA replication and repair protein RecO [Yersinia pestis Nepal516]
 gi|108780361|gb|ABG14419.1| DNA replication and repair protein RecO [Yersinia pestis Antiqua]
 gi|115348403|emb|CAL21339.1| DNA repair protein [Yersinia pestis CO92]
 gi|145210531|gb|ABP39938.1| DNA replication and repair protein RecO [Yersinia pestis Pestoides
           F]
 gi|149291801|gb|EDM41875.1| DNA repair protein [Yersinia pestis CA88-4125]
 gi|152960242|gb|ABS47703.1| DNA repair protein RecO [Yersinia pseudotuberculosis IP 31758]
 gi|162353184|gb|ABX87132.1| DNA repair protein RecO [Yersinia pestis Angola]
 gi|165915051|gb|EDR33663.1| DNA repair protein RecO [Yersinia pestis biovar Orientalis str.
           IP275]
 gi|165922908|gb|EDR40059.1| DNA repair protein RecO [Yersinia pestis biovar Orientalis str.
           F1991016]
 gi|165992625|gb|EDR44926.1| DNA repair protein RecO [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166206337|gb|EDR50817.1| DNA repair protein RecO [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|166960726|gb|EDR56747.1| DNA repair protein RecO [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167052064|gb|EDR63472.1| DNA repair protein RecO [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167057972|gb|EDR67718.1| DNA repair protein RecO [Yersinia pestis biovar Mediaevalis str.
           K1973002]
 gi|169749971|gb|ACA67489.1| DNA repair protein RecO [Yersinia pseudotuberculosis YPIII]
 gi|186699327|gb|ACC89956.1| DNA repair protein RecO [Yersinia pseudotuberculosis PB1/+]
 gi|229681550|gb|EEO77644.1| gap repair protein [Yersinia pestis Nepal516]
 gi|229688395|gb|EEO80466.1| gap repair protein [Yersinia pestis biovar Orientalis str. India
           195]
 gi|229694649|gb|EEO84696.1| gap repair protein [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|229701327|gb|EEO89355.1| gap repair protein [Yersinia pestis Pestoides A]
 gi|262362497|gb|ACY59218.1| DNA repair protein RecO [Yersinia pestis D106004]
 gi|262366498|gb|ACY63055.1| DNA repair protein RecO [Yersinia pestis D182038]
 gi|270338314|gb|EFA49091.1| DNA repair protein RecO [Yersinia pestis KIM D27]
 gi|294354970|gb|ADE65311.1| DNA repair protein RecO [Yersinia pestis Z176003]
 gi|320016073|gb|ADV99644.1| gap repair protein [Yersinia pestis biovar Medievalis str. Harbin
           35]
          Length = 241

 Score = 39.7 bits (91), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 57/226 (25%), Positives = 91/226 (40%), Gaps = 25/226 (11%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNWRS 60
           WQ  A +L  R Y E +++L++ T   GR     +  +  R  ++  LQ    + V W  
Sbjct: 4   WQR-AFVLHGRPYSETSLMLDLFTEGEGRMRVLAKGARGRRSNLKGCLQPFTPLLVRWSG 62

Query: 61  RLAQNLGEFRFEVLES----HCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELY-DMLN 115
           R     GE +   L S      A  LS S+   GL     L R L  +     L+ D L+
Sbjct: 63  R-----GEVK--TLRSAEPVSLALPLSGSMLYSGLYVNELLSRVLEHQTSYSALFFDYLH 115

Query: 116 IFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTG--VTQDLLWVSPKSGGAVCR 173
                            Q EL +L N+G+G+D   C  +G  V+  + +   +  G +  
Sbjct: 116 CLQALAGSDGSPEHALRQFELAMLANLGYGVDFLHCAGSGQPVSDTMTYRYREEKGFIAS 175

Query: 174 SVGLPYA---EKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKY 216
            V   Y+    ++L L        +  DAD+L++A + T   L  Y
Sbjct: 176 LVVDHYSFTGRQLLAL-----ANREFPDADTLRAAKRFTRIALKPY 216


>gi|257893052|ref|ZP_05672705.1| recombination protein O [Enterococcus faecium 1,231,408]
 gi|260559559|ref|ZP_05831739.1| recombination protein O [Enterococcus faecium C68]
 gi|293559429|ref|ZP_06675968.1| DNA repair protein RecO [Enterococcus faecium E1162]
 gi|314939539|ref|ZP_07846767.1| DNA repair protein RecO [Enterococcus faecium TX0133a04]
 gi|314942706|ref|ZP_07849532.1| DNA repair protein RecO [Enterococcus faecium TX0133C]
 gi|314948956|ref|ZP_07852322.1| DNA repair protein RecO [Enterococcus faecium TX0082]
 gi|314953303|ref|ZP_07856231.1| DNA repair protein RecO [Enterococcus faecium TX0133A]
 gi|314993383|ref|ZP_07858748.1| DNA repair protein RecO [Enterococcus faecium TX0133B]
 gi|314995733|ref|ZP_07860822.1| DNA repair protein RecO [Enterococcus faecium TX0133a01]
 gi|257829431|gb|EEV56038.1| recombination protein O [Enterococcus faecium 1,231,408]
 gi|260074227|gb|EEW62549.1| recombination protein O [Enterococcus faecium C68]
 gi|291606643|gb|EFF36038.1| DNA repair protein RecO [Enterococcus faecium E1162]
 gi|313590005|gb|EFR68850.1| DNA repair protein RecO [Enterococcus faecium TX0133a01]
 gi|313592048|gb|EFR70893.1| DNA repair protein RecO [Enterococcus faecium TX0133B]
 gi|313594646|gb|EFR73491.1| DNA repair protein RecO [Enterococcus faecium TX0133A]
 gi|313598571|gb|EFR77416.1| DNA repair protein RecO [Enterococcus faecium TX0133C]
 gi|313641175|gb|EFS05755.1| DNA repair protein RecO [Enterococcus faecium TX0133a04]
 gi|313644615|gb|EFS09195.1| DNA repair protein RecO [Enterococcus faecium TX0082]
          Length = 270

 Score = 39.7 bits (91), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 47/192 (24%), Positives = 77/192 (40%), Gaps = 42/192 (21%)

Query: 4   QDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLA 63
           +   +IL  R+Y EK+ ++++ T   G+ + +++ G   + QP+  A  L+        A
Sbjct: 6   ESKGLILSSRNYKEKDKLVKIFTESSGKMMFYIK-GIHRQNQPLAPA--LLPFT----EA 58

Query: 64  QNLGEFRFE-------VLESHCAKLLSSSLFLYGL---------------QSIVPLFRFL 101
             +G FR E       V + H  + +   +FL G                Q    LF+F 
Sbjct: 59  VYIGNFRSEGLSFLSSVKDVHAFRNIQEDIFLSGYGTYLLNLVDAAIEDHQYDPHLFQFT 118

Query: 102 PEREPCLELYDMLNIFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLL 161
            +    ++  D   I  N          IF   E+ +L+  G     T CVV G T+   
Sbjct: 119 QQALQRMDQGDDAEIITN----------IF---EVQILQRFGIAPIWTHCVVCGETKGKF 165

Query: 162 WVSPKSGGAVCR 173
             S KSGG +C 
Sbjct: 166 DYSSKSGGVICE 177


>gi|86359369|ref|YP_471261.1| glutamyl-Q tRNA(Asp) synthetase [Rhizobium etli CFN 42]
 gi|86283471|gb|ABC92534.1| glutamyl-tRNA synthetase protein [Rhizobium etli CFN 42]
          Length = 293

 Score = 39.7 bits (91), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 33/111 (29%), Positives = 49/111 (44%), Gaps = 21/111 (18%)

Query: 96  PLFRFLPEREPCLELYDMLNIFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVV-- 153
           P+FRF P     L L   L+ FLNC    +  G++ ++IE          +D T+C    
Sbjct: 9   PVFRFAPSPNGPLHLGHALSAFLNCDMADAWNGRVLLRIE---------DIDQTRCTPEF 59

Query: 154 -TGVTQDLLWVSPKSGGAVCR-SVGLPY--------AEKMLVLPSFLWKEE 194
             G+ +DL W++      V R S   P          E+ LV P+FL + E
Sbjct: 60  EAGILRDLDWLAIDWESPVRRQSEHFPEYQAALHALIERGLVYPAFLTRGE 110


>gi|291618444|ref|YP_003521186.1| RecO [Pantoea ananatis LMG 20103]
 gi|291153474|gb|ADD78058.1| RecO [Pantoea ananatis LMG 20103]
 gi|327394840|dbj|BAK12262.1| DNA repair protein RecO [Pantoea ananatis AJ13355]
          Length = 245

 Score = 39.7 bits (91), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 58/227 (25%), Positives = 94/227 (41%), Gaps = 27/227 (11%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQ--PILQAGNLVRVNWRS 60
           WQ  A +L  R + E +++L++ +   GR     +  +S R Q    LQ    + V W  
Sbjct: 4   WQR-AFVLHSRPFSETSLLLDLFSESEGRVRVLAKGARSRRSQLKGTLQPFTPLLVRWSG 62

Query: 61  RLAQNLGEFR-FEVLESHCAKLLSSSLFLY-GLQSIVPLFRFLPEREPCLELY-DMLNIF 117
           R     GE +     E+    L  S + LY GL     L R L +  P  EL+ D L   
Sbjct: 63  R-----GEVKTLRNAEAVSLALPLSGITLYCGLYVNELLSRVLEQHIPFSELFFDYLQCI 117

Query: 118 LNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTG--VTQDLLWVSPKSGGAVCRSV 175
                          + EL LL ++G+G+D   C  +G  V++ + +   +  G +    
Sbjct: 118 QMLAAGEGSPEPALRRFELALLGHLGYGVDFLHCAGSGEPVSEAMTYSYREEKGFI---- 173

Query: 176 GLPYAEKMLVLPSFLWKEEQTI------DADSLKSAFQLTDYFLNKY 216
               A  +L   SF  +E Q +      DA++L++A + T   L  Y
Sbjct: 174 ----ASLVLNQRSFTGRELQALFTREFPDAETLRAAKRFTRMALKPY 216


>gi|261491681|ref|ZP_05988262.1| DNA recombination protein RecO [Mannheimia haemolytica serotype A2
           str. BOVINE]
 gi|261494444|ref|ZP_05990930.1| DNA recombination protein RecO [Mannheimia haemolytica serotype A2
           str. OVINE]
 gi|261309828|gb|EEY11045.1| DNA recombination protein RecO [Mannheimia haemolytica serotype A2
           str. OVINE]
 gi|261312634|gb|EEY13756.1| DNA recombination protein RecO [Mannheimia haemolytica serotype A2
           str. BOVINE]
          Length = 240

 Score = 39.7 bits (91), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 40/165 (24%), Positives = 68/165 (41%), Gaps = 18/165 (10%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNWRS 60
           WQ  A +L  R Y E ++++E  T  +GR     +  +  R  ++ +LQ    + V W  
Sbjct: 6   WQR-AFVLHRREYSESSLLVEFFTEHHGRITLLAKGARRARSPLKAVLQPFTPLLVRWSG 64

Query: 61  RLAQNLGEFRFEVLESHCAKL---LSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
           +     G+ +  + ++  A L   + ++    G      L R L  +    EL+     +
Sbjct: 65  K-----GDLK-TLTKAEPAALTLPMETAALYSGFYINEVLARVLENQTAYPELFQH---Y 115

Query: 118 LNCHK---IPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQD 159
           L C         I  I    E   LK +G+G+D T C  TG+  D
Sbjct: 116 LRCMTELATQHQIEPILRTFEFHTLKALGYGVDFTHCTATGLPID 160


>gi|254360746|ref|ZP_04976894.1| DNA recombination protein RecO [Mannheimia haemolytica PHL213]
 gi|153091316|gb|EDN73290.1| DNA recombination protein RecO [Mannheimia haemolytica PHL213]
          Length = 240

 Score = 39.7 bits (91), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 42/164 (25%), Positives = 66/164 (40%), Gaps = 16/164 (9%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNWRS 60
           WQ  A +L  R Y E ++++E  T  +GR     +  +  R  ++ +LQ    + + W  
Sbjct: 6   WQR-AFVLHRREYSENSLLVEFFTEHHGRITLLAKGARRARSPLKAVLQPFTPLLLRWSG 64

Query: 61  RLAQNLGEFR-FEVLESHCAKLLSSSLFLY-GLQSIVPLFRFLPEREPCLELYDMLNIFL 118
           +     G+ +     E     L   +L LY G      L R L  +    EL+     +L
Sbjct: 65  K-----GDLKTLTKAEPAALTLPMETLSLYSGFYINEVLARVLENQTAYPELFQH---YL 116

Query: 119 NC---HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQD 159
            C         I  I    E   LK +G+G+D T C  TG+  D
Sbjct: 117 RCITELATQKQIEPILRTFEFHTLKALGYGVDFTHCAATGLPVD 160


>gi|21958064|gb|AAM84873.1|AE013732_5 recO protein [Yersinia pestis KIM 10]
 gi|45437170|gb|AAS62722.1| DNA repair protein [Yersinia pestis biovar Microtus str. 91001]
          Length = 243

 Score = 39.3 bits (90), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 57/226 (25%), Positives = 91/226 (40%), Gaps = 25/226 (11%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNWRS 60
           WQ  A +L  R Y E +++L++ T   GR     +  +  R  ++  LQ    + V W  
Sbjct: 6   WQR-AFVLHGRPYSETSLMLDLFTEGEGRMRVLAKGARGRRSNLKGCLQPFTPLLVRWSG 64

Query: 61  RLAQNLGEFRFEVLES----HCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELY-DMLN 115
           R     GE +   L S      A  LS S+   GL     L R L  +     L+ D L+
Sbjct: 65  R-----GEVK--TLRSAEPVSLALPLSGSMLYSGLYVNELLSRVLEHQTSYSALFFDYLH 117

Query: 116 IFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTG--VTQDLLWVSPKSGGAVCR 173
                            Q EL +L N+G+G+D   C  +G  V+  + +   +  G +  
Sbjct: 118 CLQALAGSDGSPEHALRQFELAMLANLGYGVDFLHCAGSGQPVSDTMTYRYREEKGFIAS 177

Query: 174 SVGLPYA---EKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKY 216
            V   Y+    ++L L        +  DAD+L++A + T   L  Y
Sbjct: 178 LVVDHYSFTGRQLLAL-----ANREFPDADTLRAAKRFTRIALKPY 218


>gi|307287712|ref|ZP_07567755.1| DNA repair protein RecO [Enterococcus faecalis TX0109]
 gi|306501450|gb|EFM70753.1| DNA repair protein RecO [Enterococcus faecalis TX0109]
 gi|315164811|gb|EFU08828.1| DNA repair protein RecO [Enterococcus faecalis TX1302]
          Length = 262

 Score = 39.3 bits (90), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 45/180 (25%), Positives = 74/180 (41%), Gaps = 22/180 (12%)

Query: 7   AIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQNL 66
            IIL  + + EK+ ++++ T  YG+ + FV+   +HR    L    L         A  +
Sbjct: 8   GIILFTKDFKEKDKLVKIFTESYGKLMFFVKG--AHRKNNPLMPAILPFTE-----AVYI 60

Query: 67  GEFRFEVL-------ESHCAKLLSSSLFL--YGLQSIVPLFRFLPEREPCLELYDMLNI- 116
           G FR E L       E    + +   +F+  YG   +  +   + ++     L+   ++ 
Sbjct: 61  GNFREEGLSFLNSSKEVQPFRNIQQDIFINAYGTYILNLVDAAIEDQHYDPNLFQFTHMA 120

Query: 117 --FLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRS 174
              LN  K P +I  IF   E+ LL+  G   +   CV  G TQ     S K  G +C  
Sbjct: 121 LSALNEQKDPEIITNIF---EIQLLERFGVRPEWHHCVACGETQGKFDYSSKYSGVLCEK 177


>gi|313637816|gb|EFS03157.1| DNA repair protein RecO [Listeria seeligeri FSL S4-171]
          Length = 255

 Score = 39.3 bits (90), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 41/174 (23%), Positives = 78/174 (44%), Gaps = 13/174 (7%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQN 65
           + I++   SY E + I+ + TR++G+ +G V  G       +     L    + +    N
Sbjct: 5   EGIVIRQTSYRESDKIVRMYTREFGK-IGVVARGAKKTKSRLAAVTQLFTSGYFTFFGGN 63

Query: 66  -LGEFR-FEVLESHCAKLLSSSLFLYGLQSIVP--LFRFLPEREPCLELYDM-LNIFLNC 120
            LG  +  EV+E+  +  +   +F+    + V   L +   ER+P   LY++   I  + 
Sbjct: 64  GLGTLQQGEVIENFSS--IQQDIFMTAYATYVCELLDKATEERQPNPYLYELTFQILRDI 121

Query: 121 HK--IPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVC 172
            +   P ++ +IF   E+ +L  +G    + KC + G T      S +S G +C
Sbjct: 122 DEGYDPQILTQIF---EMKMLPVLGHYPTMDKCAICGETTGHFDFSTRSNGIIC 172


>gi|256617034|ref|ZP_05473880.1| recombination protein O [Enterococcus faecalis ATCC 4200]
 gi|256853770|ref|ZP_05559135.1| DNA repair protein recO [Enterococcus faecalis T8]
 gi|307277157|ref|ZP_07558261.1| DNA repair protein RecO [Enterococcus faecalis TX2134]
 gi|307290539|ref|ZP_07570451.1| DNA repair protein RecO [Enterococcus faecalis TX0411]
 gi|256596561|gb|EEU15737.1| recombination protein O [Enterococcus faecalis ATCC 4200]
 gi|256710713|gb|EEU25756.1| DNA repair protein recO [Enterococcus faecalis T8]
 gi|295113463|emb|CBL32100.1| DNA repair protein RecO [Enterococcus sp. 7L76]
 gi|306498394|gb|EFM67899.1| DNA repair protein RecO [Enterococcus faecalis TX0411]
 gi|306506087|gb|EFM75253.1| DNA repair protein RecO [Enterococcus faecalis TX2134]
 gi|315030212|gb|EFT42144.1| DNA repair protein RecO [Enterococcus faecalis TX4000]
          Length = 261

 Score = 39.3 bits (90), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 45/180 (25%), Positives = 77/180 (42%), Gaps = 22/180 (12%)

Query: 7   AIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQNL 66
            IIL  + + EK+ ++++ T  YG+ + FV+ G   +  P+L A  ++        A  +
Sbjct: 8   GIILFTKDFKEKDKLVKIFTESYGKLMFFVK-GAHRKNNPLLPA--ILPFT----EAVYI 60

Query: 67  GEFRFEVL-------ESHCAKLLSSSLFL--YGLQSIVPLFRFLPEREPCLELYDMLNI- 116
           G FR E L       E    + +   +F+  YG   +  +   + ++     L+   ++ 
Sbjct: 61  GNFREEGLSFLNSSKEVQPFRNIQQDIFINAYGTYILNLVDAAIEDQHYDPNLFQFTHMA 120

Query: 117 --FLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRS 174
              LN  K P +I  IF   E+ LL+  G   +   CV  G TQ     S K  G +C  
Sbjct: 121 LSALNEQKDPEIITNIF---EIQLLERFGVRPEWHHCVACGETQGKFDYSSKYSGVLCEK 177


>gi|29376904|ref|NP_816058.1| DNA repair protein RecO, putative [Enterococcus faecalis V583]
 gi|227553940|ref|ZP_03983987.1| recombination protein O [Enterococcus faecalis HH22]
 gi|255975190|ref|ZP_05425776.1| recombination protein O [Enterococcus faecalis T2]
 gi|256763102|ref|ZP_05503682.1| recombination protein O [Enterococcus faecalis T3]
 gi|256956686|ref|ZP_05560857.1| recombination protein O [Enterococcus faecalis DS5]
 gi|300861009|ref|ZP_07107096.1| DNA repair protein RecO [Enterococcus faecalis TUSoD Ef11]
 gi|307285809|ref|ZP_07565943.1| DNA repair protein RecO [Enterococcus faecalis TX0860]
 gi|42559464|sp|Q831U0|RECO_ENTFA RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|29344369|gb|AAO82128.1| DNA repair protein RecO, putative [Enterococcus faecalis V583]
 gi|227176926|gb|EEI57898.1| recombination protein O [Enterococcus faecalis HH22]
 gi|255968062|gb|EET98684.1| recombination protein O [Enterococcus faecalis T2]
 gi|256684353|gb|EEU24048.1| recombination protein O [Enterococcus faecalis T3]
 gi|256947182|gb|EEU63814.1| recombination protein O [Enterococcus faecalis DS5]
 gi|300850048|gb|EFK77798.1| DNA repair protein RecO [Enterococcus faecalis TUSoD Ef11]
 gi|306502570|gb|EFM71837.1| DNA repair protein RecO [Enterococcus faecalis TX0860]
 gi|315035614|gb|EFT47546.1| DNA repair protein RecO [Enterococcus faecalis TX0027]
 gi|315146684|gb|EFT90700.1| DNA repair protein RecO [Enterococcus faecalis TX4244]
 gi|315166397|gb|EFU10414.1| DNA repair protein RecO [Enterococcus faecalis TX1341]
 gi|315170293|gb|EFU14310.1| DNA repair protein RecO [Enterococcus faecalis TX1342]
 gi|315574359|gb|EFU86550.1| DNA repair protein RecO [Enterococcus faecalis TX0309B]
 gi|315580166|gb|EFU92357.1| DNA repair protein RecO [Enterococcus faecalis TX0309A]
 gi|327535694|gb|AEA94528.1| recombination protein O [Enterococcus faecalis OG1RF]
          Length = 262

 Score = 39.3 bits (90), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 45/180 (25%), Positives = 77/180 (42%), Gaps = 22/180 (12%)

Query: 7   AIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQNL 66
            IIL  + + EK+ ++++ T  YG+ + FV+ G   +  P+L A  ++        A  +
Sbjct: 8   GIILFTKDFKEKDKLVKIFTESYGKLMFFVK-GAHRKNNPLLPA--ILPFT----EAVYI 60

Query: 67  GEFRFEVL-------ESHCAKLLSSSLFL--YGLQSIVPLFRFLPEREPCLELYDMLNI- 116
           G FR E L       E    + +   +F+  YG   +  +   + ++     L+   ++ 
Sbjct: 61  GNFREEGLSFLNSSKEVQPFRNIQQDIFINAYGTYILNLVDAAIEDQHYDPNLFQFTHMA 120

Query: 117 --FLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRS 174
              LN  K P +I  IF   E+ LL+  G   +   CV  G TQ     S K  G +C  
Sbjct: 121 LSALNEQKDPEIITNIF---EIQLLERFGVRPEWHHCVACGETQGKFDYSSKYSGVLCEK 177


>gi|229545170|ref|ZP_04433895.1| recombination protein O [Enterococcus faecalis TX1322]
 gi|229549419|ref|ZP_04438144.1| recombination protein O [Enterococcus faecalis ATCC 29200]
 gi|255972123|ref|ZP_05422709.1| recombination protein O [Enterococcus faecalis T1]
 gi|256963576|ref|ZP_05567747.1| recombination protein O [Enterococcus faecalis HIP11704]
 gi|257079641|ref|ZP_05574002.1| recombination protein O [Enterococcus faecalis JH1]
 gi|257090599|ref|ZP_05584960.1| recombination protein recO [Enterococcus faecalis CH188]
 gi|257416647|ref|ZP_05593641.1| recombination protein O [Enterococcus faecalis AR01/DG]
 gi|257421949|ref|ZP_05598939.1| DNA repair protein recO [Enterococcus faecalis X98]
 gi|294780921|ref|ZP_06746275.1| DNA repair protein RecO [Enterococcus faecalis PC1.1]
 gi|307270834|ref|ZP_07552122.1| DNA repair protein RecO [Enterococcus faecalis TX4248]
 gi|307271515|ref|ZP_07552787.1| DNA repair protein RecO [Enterococcus faecalis TX0855]
 gi|312899838|ref|ZP_07759157.1| DNA repair protein RecO [Enterococcus faecalis TX0470]
 gi|312905131|ref|ZP_07764252.1| DNA repair protein RecO [Enterococcus faecalis TX0635]
 gi|312953488|ref|ZP_07772328.1| DNA repair protein RecO [Enterococcus faecalis TX0102]
 gi|229305656|gb|EEN71652.1| recombination protein O [Enterococcus faecalis ATCC 29200]
 gi|229309715|gb|EEN75702.1| recombination protein O [Enterococcus faecalis TX1322]
 gi|255963141|gb|EET95617.1| recombination protein O [Enterococcus faecalis T1]
 gi|256954072|gb|EEU70704.1| recombination protein O [Enterococcus faecalis HIP11704]
 gi|256987671|gb|EEU74973.1| recombination protein O [Enterococcus faecalis JH1]
 gi|256999411|gb|EEU85931.1| recombination protein recO [Enterococcus faecalis CH188]
 gi|257158475|gb|EEU88435.1| recombination protein O [Enterococcus faecalis ARO1/DG]
 gi|257163773|gb|EEU93733.1| DNA repair protein recO [Enterococcus faecalis X98]
 gi|294452047|gb|EFG20495.1| DNA repair protein RecO [Enterococcus faecalis PC1.1]
 gi|306511787|gb|EFM80785.1| DNA repair protein RecO [Enterococcus faecalis TX0855]
 gi|306512835|gb|EFM81479.1| DNA repair protein RecO [Enterococcus faecalis TX4248]
 gi|310628697|gb|EFQ11980.1| DNA repair protein RecO [Enterococcus faecalis TX0102]
 gi|310631521|gb|EFQ14804.1| DNA repair protein RecO [Enterococcus faecalis TX0635]
 gi|311293088|gb|EFQ71644.1| DNA repair protein RecO [Enterococcus faecalis TX0470]
 gi|315152155|gb|EFT96171.1| DNA repair protein RecO [Enterococcus faecalis TX0031]
 gi|315155342|gb|EFT99358.1| DNA repair protein RecO [Enterococcus faecalis TX0043]
 gi|315159082|gb|EFU03099.1| DNA repair protein RecO [Enterococcus faecalis TX0312]
 gi|315579041|gb|EFU91232.1| DNA repair protein RecO [Enterococcus faecalis TX0630]
 gi|323481398|gb|ADX80837.1| DNA repair protein RecO [Enterococcus faecalis 62]
 gi|329572236|gb|EGG53896.1| DNA repair protein RecO [Enterococcus faecalis TX1467]
          Length = 262

 Score = 39.3 bits (90), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 45/180 (25%), Positives = 77/180 (42%), Gaps = 22/180 (12%)

Query: 7   AIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQNL 66
            IIL  + + EK+ ++++ T  YG+ + FV+ G   +  P+L A  ++        A  +
Sbjct: 8   GIILFTKDFKEKDKLVKIFTESYGKLMFFVK-GAHRKNNPLLPA--ILPFT----EAVYI 60

Query: 67  GEFRFEVL-------ESHCAKLLSSSLFL--YGLQSIVPLFRFLPEREPCLELYDMLNI- 116
           G FR E L       E    + +   +F+  YG   +  +   + ++     L+   ++ 
Sbjct: 61  GNFREEGLSFLNSSKEVQPFRNIQQDIFINAYGTYILNLVDAAIEDQHYDPNLFQFTHMA 120

Query: 117 --FLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRS 174
              LN  K P +I  IF   E+ LL+  G   +   CV  G TQ     S K  G +C  
Sbjct: 121 LSALNEQKDPEIITNIF---EIQLLERFGVRPEWHHCVACGETQGKFDYSSKYSGVLCEK 177


>gi|315150152|gb|EFT94168.1| DNA repair protein RecO [Enterococcus faecalis TX0012]
          Length = 264

 Score = 39.3 bits (90), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 45/180 (25%), Positives = 74/180 (41%), Gaps = 22/180 (12%)

Query: 7   AIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQNL 66
            IIL  + + EK+ ++++ T  YG+ + FV+   +HR    L    L         A  +
Sbjct: 8   GIILFTKDFKEKDKLVKIFTESYGKLMFFVKG--AHRKNNPLMPAILPFTE-----AVYI 60

Query: 67  GEFRFEVL-------ESHCAKLLSSSLFL--YGLQSIVPLFRFLPEREPCLELYDMLNI- 116
           G FR E L       E    + +   +F+  YG   +  +   + ++     L+   ++ 
Sbjct: 61  GNFREEGLSFLNSSKEVQPFRNIQQDIFINAYGTYILNLVDAAIEDQHYDPNLFQFTHMA 120

Query: 117 --FLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRS 174
              LN  K P +I  IF   E+ LL+  G   +   CV  G TQ     S K  G +C  
Sbjct: 121 LSALNEQKDPEIITNIF---EIQLLERFGVRPEWHHCVACGETQGKFDYSSKYSGVLCEK 177


>gi|289434742|ref|YP_003464614.1| recombination protein O [Listeria seeligeri serovar 1/2b str.
           SLCC3954]
 gi|289170986|emb|CBH27528.1| recombination protein O [Listeria seeligeri serovar 1/2b str.
           SLCC3954]
          Length = 255

 Score = 39.3 bits (90), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 41/174 (23%), Positives = 78/174 (44%), Gaps = 13/174 (7%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQN 65
           + I++   SY E + I+ + TR++G+ +G V  G       +     L    + +    N
Sbjct: 5   EGIVIRQTSYRESDKIVRMYTREFGK-IGVVARGAKKTKSRLAAVTQLFTSGYFTFFGGN 63

Query: 66  -LGEFR-FEVLESHCAKLLSSSLFLYGLQSIVP--LFRFLPEREPCLELYDM-LNIFLNC 120
            LG  +  EV+E+  +  +   +F+    + V   L +   ER+P   LY++   I  + 
Sbjct: 64  GLGTLQQGEVIENFSS--IQQDIFMTAYATYVCELLDKATEERQPNPYLYELTFQILRDI 121

Query: 121 HK--IPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVC 172
            +   P ++ +IF   E+ +L  +G    + KC + G T      S +S G +C
Sbjct: 122 DEGYDPQILTQIF---EMKMLPVLGHYPTMDKCAICGETTGHFDFSTRSNGIIC 172


>gi|256961297|ref|ZP_05565468.1| recombination protein O [Enterococcus faecalis Merz96]
 gi|293383581|ref|ZP_06629491.1| DNA repair protein RecO [Enterococcus faecalis R712]
 gi|293387306|ref|ZP_06631862.1| DNA repair protein RecO [Enterococcus faecalis S613]
 gi|312906131|ref|ZP_07765143.1| DNA repair protein RecO [Enterococcus faecalis DAPTO 512]
 gi|312909477|ref|ZP_07768332.1| DNA repair protein RecO [Enterococcus faecalis DAPTO 516]
 gi|256951793|gb|EEU68425.1| recombination protein O [Enterococcus faecalis Merz96]
 gi|291079093|gb|EFE16457.1| DNA repair protein RecO [Enterococcus faecalis R712]
 gi|291083204|gb|EFE20167.1| DNA repair protein RecO [Enterococcus faecalis S613]
 gi|310627777|gb|EFQ11060.1| DNA repair protein RecO [Enterococcus faecalis DAPTO 512]
 gi|311290150|gb|EFQ68706.1| DNA repair protein RecO [Enterococcus faecalis DAPTO 516]
          Length = 264

 Score = 39.3 bits (90), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 45/180 (25%), Positives = 77/180 (42%), Gaps = 22/180 (12%)

Query: 7   AIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQNL 66
            IIL  + + EK+ ++++ T  YG+ + FV+ G   +  P+L A  ++        A  +
Sbjct: 8   GIILFTKDFKEKDKLVKIFTESYGKLMFFVK-GAHRKNNPLLPA--ILPFT----EAVYI 60

Query: 67  GEFRFEVL-------ESHCAKLLSSSLFL--YGLQSIVPLFRFLPEREPCLELYDMLNI- 116
           G FR E L       E    + +   +F+  YG   +  +   + ++     L+   ++ 
Sbjct: 61  GNFREEGLSFLNSSKEVQPFRNIQQDIFINAYGTYILNLVDAAIEDQHYDPNLFQFTHMA 120

Query: 117 --FLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRS 174
              LN  K P +I  IF   E+ LL+  G   +   CV  G TQ     S K  G +C  
Sbjct: 121 LSALNEQKDPEIITNIF---EIQLLERFGVRPEWHHCVACGETQGKFDYSSKYSGVLCEK 177


>gi|288555747|ref|YP_003427682.1| DNA repair protein RecO [Bacillus pseudofirmus OF4]
 gi|288546907|gb|ADC50790.1| DNA repair protein RecO [Bacillus pseudofirmus OF4]
          Length = 251

 Score = 39.3 bits (90), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 39/174 (22%), Positives = 80/174 (45%), Gaps = 11/174 (6%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQN 65
           +AI++    YGE N I+ + TR+ G+     R  +  + +    +   +   +  + +  
Sbjct: 5   EAIVIRTNDYGESNKIVTLFTRESGKVGVMARGAKKPKSRLAAISQLFIHGLYLFQKSNG 64

Query: 66  LGEF-RFEVLESHCAKLLSSSLFL--YGLQSIVPLFRFLPEREPCLELYDMLN---IFLN 119
           LG   + E++  H  K + + LFL  Y    +  + +   E++P   L+ +L    ++L+
Sbjct: 65  LGTLNQAEMI--HSYKEVRNDLFLASYATYVVELIDKLTEEKQPNEPLFHLLQQTLLYLD 122

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCR 173
               P V+ +IF   E+ +++  G   +L +C   G T+     S K  G +C+
Sbjct: 123 EGIDPEVLLRIF---EMKMMQVAGITPELDQCTNCGSTEVPSGFSIKEAGFLCK 173


>gi|260583652|ref|ZP_05851400.1| DNA repair protein RecO [Granulicatella elegans ATCC 700633]
 gi|260158278|gb|EEW93346.1| DNA repair protein RecO [Granulicatella elegans ATCC 700633]
          Length = 267

 Score = 39.3 bits (90), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 45/179 (25%), Positives = 77/179 (43%), Gaps = 24/179 (13%)

Query: 7   AIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNL--VRVNWRSRLAQ 64
            I+L  + Y E ++I+++ +R++G+ + FVRN Q  R    L A  L   R  +   + Q
Sbjct: 9   GIVLFRQEYKEHDMIVKIFSREFGKQMFFVRNLQ--RSSHPLSAATLPFTRAVFIGTIHQ 66

Query: 65  NLGEFRFEVLESHCAKLLSS-----SLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLN 119
           N   F  E LE    + +       ++  Y +Q +  +   + +R    ELYD+L    N
Sbjct: 67  NGFSFIRECLEVQNHRRIYEQIEVQAVMTYMMQLVDAV---MEDRIVNTELYDLLE---N 120

Query: 120 CHKI------PSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVC 172
           C +       P ++   F   EL +LK  G      +C     +     +S K  G +C
Sbjct: 121 CIRAVENDLDPFILMHYF---ELKMLKYFGVAFQWQQCCFCEESVGPFDISLKHHGLLC 176


>gi|257082013|ref|ZP_05576374.1| recombination protein O [Enterococcus faecalis E1Sol]
 gi|257084564|ref|ZP_05578925.1| recombination protein O [Enterococcus faecalis Fly1]
 gi|257087440|ref|ZP_05581801.1| recombination protein O [Enterococcus faecalis D6]
 gi|256990043|gb|EEU77345.1| recombination protein O [Enterococcus faecalis E1Sol]
 gi|256992594|gb|EEU79896.1| recombination protein O [Enterococcus faecalis Fly1]
 gi|256995470|gb|EEU82772.1| recombination protein O [Enterococcus faecalis D6]
 gi|315025404|gb|EFT37336.1| DNA repair protein RecO [Enterococcus faecalis TX2137]
 gi|315161674|gb|EFU05691.1| DNA repair protein RecO [Enterococcus faecalis TX0645]
 gi|315173672|gb|EFU17689.1| DNA repair protein RecO [Enterococcus faecalis TX1346]
          Length = 264

 Score = 39.3 bits (90), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 45/180 (25%), Positives = 77/180 (42%), Gaps = 22/180 (12%)

Query: 7   AIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQNL 66
            IIL  + + EK+ ++++ T  YG+ + FV+ G   +  P+L A  ++        A  +
Sbjct: 8   GIILFTKDFKEKDKLVKIFTESYGKLMFFVK-GAHRKNNPLLPA--ILPFT----EAVYI 60

Query: 67  GEFRFEVL-------ESHCAKLLSSSLFL--YGLQSIVPLFRFLPEREPCLELYDMLNI- 116
           G FR E L       E    + +   +F+  YG   +  +   + ++     L+   ++ 
Sbjct: 61  GNFREEGLSFLNSSKEVQPFRNIQQDIFINAYGTYILNLVDAAIEDQHYDPNLFQFTHMA 120

Query: 117 --FLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRS 174
              LN  K P +I  IF   E+ LL+  G   +   CV  G TQ     S K  G +C  
Sbjct: 121 LSALNEQKDPEIITNIF---EIQLLERFGVRPEWHHCVACGETQGKFDYSSKYSGVLCEK 177


>gi|259907679|ref|YP_002648035.1| DNA repair protein RecO [Erwinia pyrifoliae Ep1/96]
 gi|224963301|emb|CAX54786.1| DNA repair protein RecO [Erwinia pyrifoliae Ep1/96]
 gi|283477530|emb|CAY73446.1| DNA repair protein recO (Recombination protein O) [Erwinia
           pyrifoliae DSM 12163]
          Length = 245

 Score = 39.3 bits (90), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 57/235 (24%), Positives = 94/235 (40%), Gaps = 15/235 (6%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNWRS 60
           WQ  A +L  R + E +++L++ + Q+GR     +  +S R  ++  LQ    + V W  
Sbjct: 4   WQR-AFVLHGRPWSETSLLLDLFSEQHGRVRVLAKGARSKRSSLKGALQPFTPLLVRWSG 62

Query: 61  RLAQNLGEFR-FEVLESHCAKLLSSSLFLY-GLQSIVPLFRFLPEREPCLELY-DMLNIF 117
           R     GE +     E     L  S   LY GL     L R L       EL+ D L   
Sbjct: 63  R-----GEVKTLRAAEPVSLALPLSGNTLYCGLYVNELLSRVLQHETAFSELFFDYLQCI 117

Query: 118 LNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTG--VTQDLLWVSPKSGGAVCRSV 175
                 P+       + EL +L ++G+G+D   C  +G  V   + +   +  G +   V
Sbjct: 118 QTLAADPASPEPALRRFELSMLGHLGYGVDFLHCAGSGEEVADSMTYSYREEKGFIASLV 177

Query: 176 GLPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRE 230
               +     L +   +E    DAD+L++A + T   L  Y     +    L R+
Sbjct: 178 AGHRSFSGRQLRALSARE--FPDADTLRAAKRFTRIALKPYLGGKPLKSGELFRQ 230


>gi|310764813|gb|ADP09763.1| DNA repair protein RecO [Erwinia sp. Ejp617]
          Length = 245

 Score = 39.3 bits (90), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 55/221 (24%), Positives = 90/221 (40%), Gaps = 15/221 (6%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNWRS 60
           WQ  A +L  R + E +++L++ + Q+GR     +  +S R  ++  LQ    + V W  
Sbjct: 4   WQR-AFVLHGRPWSETSLLLDLFSEQHGRVRVLAKGARSKRSSLKGALQPFTPLLVRWSG 62

Query: 61  RLAQNLGEFR-FEVLESHCAKLLSSSLFLY-GLQSIVPLFRFLPEREPCLELY-DMLNIF 117
           R     GE +     E     L  S   LY GL     L R L       EL+ D L   
Sbjct: 63  R-----GEVKTLRAAEPVSLALPLSGNTLYCGLYVNELLSRVLQHETAFSELFFDYLQCI 117

Query: 118 LNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTG--VTQDLLWVSPKSGGAVCRSV 175
                 P+       + EL +L ++G+G+D   C  +G  V   + +   +  G +   V
Sbjct: 118 QTLAADPASPEPALRRFELSMLGHLGYGVDFLHCAGSGEEVADSMTYSYREEKGFIASLV 177

Query: 176 GLPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKY 216
               +     L +   +E    DAD+L++A + T   L  Y
Sbjct: 178 AGHRSFSGRQLRALSARE--FPDADTLRAAKRFTRIALKPY 216


>gi|190575412|ref|YP_001973257.1| DNA repair protein RecO [Stenotrophomonas maltophilia K279a]
 gi|229485574|sp|B2FPX7|RECO_STRMK RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|190013334|emb|CAQ46968.1| putative DNA repair protein RecO [Stenotrophomonas maltophilia
           K279a]
          Length = 239

 Score = 39.3 bits (90), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 40/158 (25%), Positives = 70/158 (44%), Gaps = 14/158 (8%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M   D   +L  R+Y E ++++EV++ Q+GR +G +  G S     +L+A  L  + W  
Sbjct: 2   MIEDDTGFVLHARAYRETSLLVEVLSAQHGR-VGLLARGVSTAKGQVLRAA-LQPLQWIR 59

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLF-------RFLPEREPCLELYDM 113
             AQ  G    E+ +   A+ L ++  L G Q+++  F       R  P ++P  ELY  
Sbjct: 60  FSAQQRG----ELAQLRGAEALDAAPRLVG-QAMLAGFYLSELTLRLAPRQDPLPELYLA 114

Query: 114 LNIFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKC 151
                    + + +     + E  LL  +G G +L   
Sbjct: 115 YGEARARLAVGAGLAWTLRRFERELLTALGLGFELDSA 152


>gi|294637609|ref|ZP_06715889.1| DNA repair protein RecO [Edwardsiella tarda ATCC 23685]
 gi|291089239|gb|EFE21800.1| DNA repair protein RecO [Edwardsiella tarda ATCC 23685]
          Length = 243

 Score = 39.3 bits (90), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 39/158 (24%), Positives = 63/158 (39%), Gaps = 11/158 (6%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQ--PILQAGNLVRVNWRS 60
           WQ  A +L  R Y E +++L+  T   GR     +  +S R Q    LQ    + + W  
Sbjct: 5   WQR-AFVLHARPYSETSLLLDTFTEGQGRVRLLAKGARSRRSQLKGALQPFTPLLIRWGG 63

Query: 61  RLAQNLGEFR-FEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLE--LYDMLNIF 117
           +     GE +     E+    L  S + LY    +  L   + E+E C     +D L+  
Sbjct: 64  K-----GEVKTLRSAEAVSLALPLSGITLYSGLYVNELLARVLEQETCYSALFFDYLHCI 118

Query: 118 LNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTG 155
                       +  + EL LL  +G+G+D   C  +G
Sbjct: 119 QQLAGHSGSPEPVLRRFELALLAQLGYGIDFLHCAGSG 156


>gi|257419863|ref|ZP_05596857.1| recombination protein recO [Enterococcus faecalis T11]
 gi|257161691|gb|EEU91651.1| recombination protein recO [Enterococcus faecalis T11]
          Length = 262

 Score = 39.3 bits (90), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 45/180 (25%), Positives = 77/180 (42%), Gaps = 22/180 (12%)

Query: 7   AIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQNL 66
            IIL  + + EK+ ++++ T  YG+ + FV+ G   +  P+L A  ++        A  +
Sbjct: 8   GIILFTKDFKEKDKLVKIFTEAYGKLMFFVK-GAHRKNNPLLPA--ILPFT----EAVYI 60

Query: 67  GEFRFEVL-------ESHCAKLLSSSLFL--YGLQSIVPLFRFLPEREPCLELYDMLNI- 116
           G FR E L       E    + +   +F+  YG   +  +   + ++     L+   ++ 
Sbjct: 61  GNFREEGLSFLNSSKEVQPFRNIQQDIFINAYGTYILNLVDAAIEDQHYDPNLFQFTHMA 120

Query: 117 --FLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRS 174
              LN  K P +I  IF   E+ LL+  G   +   CV  G TQ     S K  G +C  
Sbjct: 121 LSALNEQKDPEIITNIF---EIQLLERFGVRPEWHHCVACGETQGKFDYSSKYSGVLCEK 177


>gi|311114387|ref|YP_003985608.1| recombination protein O [Gardnerella vaginalis ATCC 14019]
 gi|310945881|gb|ADP38585.1| recombination protein O [Gardnerella vaginalis ATCC 14019]
          Length = 247

 Score = 39.3 bits (90), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 63/256 (24%), Positives = 108/256 (42%), Gaps = 41/256 (16%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGF---VRNGQSH---RMQPILQAGNLVRV 56
           + D+A++L     GE + I+ ++T+++G+       VR  +S    R++P +      RV
Sbjct: 7   YNDEAVVLKTFPLGEADRIVVMLTKKHGKIRAVAKGVRKIKSRFGARLEPFM------RV 60

Query: 57  NWRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVP------LFRFLPEREPCLEL 110
           N      +        VL S  A+ + +   LY   S++       +      ++ C++ 
Sbjct: 61  NALFATGRTFDVVSQAVLVSAYAESICADYDLYSRASMIAEIADDLVSSSAQYQDSCMQ- 119

Query: 111 YDMLNIFLNC-----HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSP 165
           Y++L   L+      H   S IG  +V   L  LK  G+   L +CVV     DL + S 
Sbjct: 120 YNLLVAALSALSRGLHSADS-IGFSYV---LRALKLAGWSPMLNECVVCATKDDLSYFSS 175

Query: 166 KSGGAVC---------RSVGLPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKY 216
            SGG +C         +  GL   + M+ L +  WK     D D L   ++  + +  +Y
Sbjct: 176 CSGGVMCSKDHDLQSIKCNGLARFQ-MISLINGDWKNIDGTDIDYL--TYRCVEQWC-EY 231

Query: 217 ALQHNIIHCHLLRENF 232
            L+  I   HLL  N 
Sbjct: 232 YLERPIKSMHLLENNM 247


>gi|270265298|ref|ZP_06193559.1| hypothetical protein SOD_m00300 [Serratia odorifera 4Rx13]
 gi|270040702|gb|EFA13805.1| hypothetical protein SOD_m00300 [Serratia odorifera 4Rx13]
          Length = 243

 Score = 39.3 bits (90), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 53/219 (24%), Positives = 89/219 (40%), Gaps = 14/219 (6%)

Query: 5   DDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNWRSRL 62
           + A +L  R Y E +++L++ T  +GR     +  +S R  ++  LQ    + V W  R 
Sbjct: 5   ERAFVLHGRPYSETSLMLDMFTEGHGRVRLLAKGARSRRSNLKGCLQPFTPLLVRWGGR- 63

Query: 63  AQNLGEFR-FEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLEL--YDMLNIFLN 119
               GE +     E+    L  S + LY    +  L   + E+E    +  +D L     
Sbjct: 64  ----GEVKTLRNAEAVSLGLPLSGMMLYSGLYVNELLSRVLEQEANYSVLFFDYLQCLQA 119

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTG--VTQDLLWVSPKSGGAVCRSVGL 177
                    +   Q EL LL ++G+GLD   C  +G  V   + +   +  G +   V  
Sbjct: 120 LAAEDISPEQALRQFELALLNHLGYGLDFLHCAGSGQPVDDGMTYRYREEKGFIASLVVD 179

Query: 178 PYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKY 216
            Y+     L +    E Q  DA +L++A + T   L  Y
Sbjct: 180 HYSFTGRELRAL--AERQFPDAQTLRAAKRFTRMALKPY 216


>gi|225848520|ref|YP_002728683.1| hypothetical protein SULAZ_0698 [Sulfurihydrogenibium azorense
          Az-Fu1]
 gi|225643278|gb|ACN98328.1| hypothetical protein SULAZ_0698 [Sulfurihydrogenibium azorense
          Az-Fu1]
          Length = 198

 Score = 38.9 bits (89), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 34/58 (58%), Gaps = 3/58 (5%)

Query: 3  WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
          ++D AI+L     GEK++ L V T++ GR   F++NGQ  +  P++   +L   NW S
Sbjct: 5  FKDQAIVLKRTFVGEKDLSLVVYTKKLGRESIFIQNGQLIKNLPVV---SLTEFNWFS 59


>gi|306828474|ref|ZP_07461669.1| recombination protein O [Streptococcus mitis ATCC 6249]
 gi|304429273|gb|EFM32358.1| recombination protein O [Streptococcus mitis ATCC 6249]
          Length = 256

 Score = 38.9 bits (89), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 45/219 (20%), Positives = 89/219 (40%), Gaps = 40/219 (18%)

Query: 7   AIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQNL 66
            ++L  R++ E + ++++ T Q G+ + FV++    ++ P++Q   LV   +  R+  + 
Sbjct: 9   GLVLYNRNFREDDKLVKIFTEQAGKRMFFVKHAGQSKLAPVIQP--LVLARFLLRINDDG 66

Query: 67  GEFRFEVLESHCAKLLSSSLFLYGLQSIV---------------PLFRFLPER----EPC 107
             +  +  E      ++S LF+    + V               PLF FL +     E  
Sbjct: 67  LSYIEDYHEVMTFPKINSDLFVMAYATYVAALADASLQDNQQDAPLFAFLRKTLELMEEG 126

Query: 108 LELYDMLNIFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKS 167
           L+   + NIF                 E+ +L   G GL+  +CV           S K 
Sbjct: 127 LDYQVLTNIF-----------------EIQILNRFGIGLNFNECVFCHRVGQAFDFSFKY 169

Query: 168 GGAVCRSVGLPYAEKMLVLPS--FLWKEEQTIDADSLKS 204
           G  +C        ++  + P+  +L  + Q ID ++L++
Sbjct: 170 GACLCPDHYHEDEKRCHLNPNIPYLLNQFQAIDFETLET 208


>gi|308234875|ref|ZP_07665612.1| DNA repair protein RecO [Gardnerella vaginalis ATCC 14018]
          Length = 244

 Score = 38.9 bits (89), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 63/256 (24%), Positives = 108/256 (42%), Gaps = 41/256 (16%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGF---VRNGQSH---RMQPILQAGNLVRV 56
           + D+A++L     GE + I+ ++T+++G+       VR  +S    R++P +      RV
Sbjct: 4   YNDEAVVLKTFPLGEADRIVVMLTKKHGKIRAVAKGVRKIKSRFGARLEPFM------RV 57

Query: 57  NWRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVP------LFRFLPEREPCLEL 110
           N      +        VL S  A+ + +   LY   S++       +      ++ C++ 
Sbjct: 58  NALFATGRTFDVVSQAVLVSAYAESICADYDLYSRASMIAEIADDLVSSSAQYQDSCMQ- 116

Query: 111 YDMLNIFLNC-----HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSP 165
           Y++L   L+      H   S IG  +V   L  LK  G+   L +CVV     DL + S 
Sbjct: 117 YNLLVAALSALSRGLHSADS-IGFSYV---LRALKLAGWSPMLNECVVCATKDDLSYFSS 172

Query: 166 KSGGAVC---------RSVGLPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKY 216
            SGG +C         +  GL   + M+ L +  WK     D D L   ++  + +  +Y
Sbjct: 173 CSGGVMCSKDHDLQSIKCNGLARFQ-MISLINGDWKNIDGTDIDYL--TYRCVEQWC-EY 228

Query: 217 ALQHNIIHCHLLRENF 232
            L+  I   HLL  N 
Sbjct: 229 YLERPIKSMHLLENNM 244


>gi|322834125|ref|YP_004214152.1| DNA repair protein RecO [Rahnella sp. Y9602]
 gi|321169326|gb|ADW75025.1| DNA repair protein RecO [Rahnella sp. Y9602]
          Length = 245

 Score = 38.9 bits (89), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 42/158 (26%), Positives = 63/158 (39%), Gaps = 11/158 (6%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNWRS 60
           WQ  A +L  R Y E +++L++ T   GR     +  +  R  ++  LQ    + V W  
Sbjct: 4   WQR-AFVLHGRPYSETSLMLDLFTEGQGRVRILAKGARGRRSNLKGCLQPFTPLLVRWSG 62

Query: 61  RLAQNLGEFR-FEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLE--LYDMLNIF 117
           R     GE +     E     L  S L LY    +  L   + E+E       +D LN  
Sbjct: 63  R-----GEVKTLRNAEPVSLALPLSGLMLYSGLYVNELVSRVLEQEANYSSLFFDYLNCL 117

Query: 118 LNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTG 155
            N             Q EL LL ++G+G+D   C  +G
Sbjct: 118 QNLASASGSPEYALRQFELSLLHHLGYGVDFLHCAGSG 155


>gi|188533140|ref|YP_001906937.1| DNA repair protein RecO [Erwinia tasmaniensis Et1/99]
 gi|238691986|sp|B2VI48|RECO_ERWT9 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|188028182|emb|CAO96040.1| DNA repair protein RecO [Erwinia tasmaniensis Et1/99]
          Length = 245

 Score = 38.9 bits (89), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 40/162 (24%), Positives = 67/162 (41%), Gaps = 19/162 (11%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNWRS 60
           WQ  A +L  R + E +++L++ + Q+GR     +  ++ R  ++  LQ    + V W  
Sbjct: 4   WQR-AFVLHGRPWSETSLLLDLFSEQHGRVRVLAKGARAKRSSLKGALQPFTPLLVRWSG 62

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLF------RFLPEREPCLELY-DM 113
           R          EV     A+ +S +L L G      L+      R L       EL+ D 
Sbjct: 63  R---------GEVKTLRSAEPVSLALPLSGTTLYCGLYVNELLSRVLQHETAFSELFFDY 113

Query: 114 LNIFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTG 155
           LN        P        + EL +L ++G+G+D   C  +G
Sbjct: 114 LNCIQTLAADPPSPEPALRRFELSMLGHLGYGVDFLHCAGSG 155


>gi|108760610|ref|YP_631289.1| DNA repair protein RecO [Myxococcus xanthus DK 1622]
 gi|119361467|sp|Q1D7T4|RECO_MYXXD RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|108464490|gb|ABF89675.1| DNA repair protein RecO [Myxococcus xanthus DK 1622]
          Length = 244

 Score = 38.9 bits (89), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 39/186 (20%), Positives = 70/186 (37%), Gaps = 3/186 (1%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQ--SHRMQPILQAGNLVRVNWRS 60
           + DDA++L    YGE + ++ ++TR++G+   F    +    R    L+    +RV+   
Sbjct: 4   YDDDALVLSSVDYGESDRLVTLLTREHGKLTAFAAGARKSKRRFAGALEPFMRLRVHIVE 63

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
                +     +++    A     SL    L ++        + EP  EL+ +L  +L  
Sbjct: 64  TRGSTVRLDGTDIVAGFYAAREDLSLIARALYAVELCRELTRDHEPQPELFALLESYLTR 123

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKC-VVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                      +  EL  L + G       C +  G   +        GGAVC   G+  
Sbjct: 124 LDAKEAGPTSLLAFELSALAHAGLMPRFDSCSLCGGAPGERPRFDQAHGGAVCEPCGVRA 183

Query: 180 AEKMLV 185
            E + V
Sbjct: 184 RESVAV 189


>gi|320548079|ref|ZP_08042359.1| recombination protein O [Streptococcus equinus ATCC 9812]
 gi|320447321|gb|EFW88084.1| recombination protein O [Streptococcus equinus ATCC 9812]
          Length = 251

 Score = 38.9 bits (89), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 43/182 (23%), Positives = 77/182 (42%), Gaps = 36/182 (19%)

Query: 7   AIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR----MQPILQAGNLVRVNWRSRL 62
            ++L  R+Y E + ++++ T   G+H+ FVR+    R    +QP+  A  +V++N     
Sbjct: 8   GLVLYNRNYREDDKLVKIFTETDGKHMFFVRHAGKSRFNSVIQPLTIAKFIVKIN----- 62

Query: 63  AQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLF--RFLPEREPCLELYDMLNIFLNC 120
             N   F  +  E    K +++ LF     S V       +P+     +L+  LN  L+ 
Sbjct: 63  -DNGLSFIEDYKEVASFKEINADLFKLSYASYVTSLADAAVPDNVADSQLFAFLNKTLSL 121

Query: 121 HKIP---SVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGL 177
            +      ++  IF   E+ +L+  G  L+L +C                  A C  VGL
Sbjct: 122 MEEGLDYEILTNIF---EIQILERFGISLNLHEC------------------AFCHRVGL 160

Query: 178 PY 179
           P+
Sbjct: 161 PF 162


>gi|157371902|ref|YP_001479891.1| DNA repair protein RecO [Serratia proteamaculans 568]
 gi|166918732|sp|A8GI23|RECO_SERP5 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|157323666|gb|ABV42763.1| DNA repair protein RecO [Serratia proteamaculans 568]
          Length = 243

 Score = 38.9 bits (89), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 40/160 (25%), Positives = 67/160 (41%), Gaps = 10/160 (6%)

Query: 5   DDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNWRSRL 62
           + A +L  R Y E +++L++ T  +GR     +  +S R  ++  LQ    + V W  R 
Sbjct: 5   ERAFVLHGRPYSETSLMLDMFTEGHGRVRLLAKGARSRRSNLKGCLQPFTPLLVRWGGR- 63

Query: 63  AQNLGEFR-FEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLEL--YDMLNIFLN 119
               GE +     E+    L  S + LY    +  L   + E+E    +  +D L     
Sbjct: 64  ----GEVKTLRSAEAVSLGLPLSGMMLYSGLYVNELLSRVLEQEANYSVLFFDYLQCLQA 119

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQD 159
                    +   Q EL LL ++G+GLD   C  +G+  D
Sbjct: 120 LAAEDVSPEQALRQFELALLNHLGYGLDFLHCAGSGLPVD 159


>gi|322436218|ref|YP_004218430.1| DNA repair protein RecO [Acidobacterium sp. MP5ACTX9]
 gi|321163945|gb|ADW69650.1| DNA repair protein RecO [Acidobacterium sp. MP5ACTX9]
          Length = 248

 Score = 38.5 bits (88), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 38/178 (21%), Positives = 80/178 (44%), Gaps = 19/178 (10%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQ--PILQAGNLVRVNWRSRLA 63
           +AI+L    + E ++++ + TR++G+  G  R+    R +    L+    V+  W  R  
Sbjct: 12  EAIVLRTWPFHEADLLVSLFTREFGKVKGIARHAMRSRRRFGGALEPMTHVKATWAERPK 71

Query: 64  QNLGEFRFEVLESHCAKLLSSSLF--LYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCH 121
           Q L   R +  E   + + +   F  L GL+ +  +   LP+      ++ +        
Sbjct: 72  QEL--VRLDAFEIMSSPMTAKIDFVRLAGLELVAEVLDELPDGAVEDAVFRLALAVTGAM 129

Query: 122 KIPSVIGKIFVQIE---LMLLKNIGFGLDLTKCVVTGVTQDL----LWVSPKSGGAVC 172
           +    +G++++ +    L + + +G+  +L +CVV G  +DL    +W S  + G  C
Sbjct: 130 E----VGRVWMPVTYFCLWMTRLMGWMPELGRCVVCG--EDLRGRTVWYSGVADGVTC 181


>gi|315640638|ref|ZP_07895744.1| recombination protein O [Enterococcus italicus DSM 15952]
 gi|315483666|gb|EFU74156.1| recombination protein O [Enterococcus italicus DSM 15952]
          Length = 257

 Score = 38.5 bits (88), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 38/176 (21%), Positives = 71/176 (40%), Gaps = 12/176 (6%)

Query: 4   QDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAG--NLVRVNWRSR 61
           +   +IL  +++ EK+ ++++ T   G+ + +VR   +HR    LQ          + S+
Sbjct: 5   ESKGLILFAKNHKEKDKLVKIFTESAGKQMFYVRG--AHRKNNPLQPAIMPFTEATYISQ 62

Query: 62  LAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLF--RFLPEREPCLELYDMLN---I 116
            ++    F       H  + L   +FL G  + +       + +R     LY  L     
Sbjct: 63  FSEQGLSFLHAAKHIHPFRHLQEDIFLAGYATYLLNLADAAIEDRVYDPHLYQFLKEALH 122

Query: 117 FLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVC 172
           F++  K   +I  IF   E+ +L+  G   +   C + G T      S K  G +C
Sbjct: 123 FIDEGKDAEIITNIF---EVQVLQRFGVQFEWQHCAICGETHGKFDFSSKYSGVLC 175


>gi|313633230|gb|EFS00100.1| DNA repair protein RecO [Listeria seeligeri FSL N1-067]
          Length = 255

 Score = 38.5 bits (88), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 41/174 (23%), Positives = 78/174 (44%), Gaps = 13/174 (7%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQN 65
           + I++   SY E + I+ + TR++G+ +G V  G       +     L    + +    N
Sbjct: 5   EGIVIRQTSYRESDKIVRMYTREFGK-IGVVARGAKKTKSRLAAVTQLFTSGYFTFFGGN 63

Query: 66  -LGEFR-FEVLESHCAKLLSSSLFLYGLQSIVP--LFRFLPEREPCLELYDM-LNIFLNC 120
            LG  +  EV+E+  +  +   +F+    + V   L +   ER+P   LY++   I  + 
Sbjct: 64  GLGTLQQGEVIENFPS--IQQDIFMTAYATYVCELLDKATEERQPNPYLYELTFQILRDI 121

Query: 121 HK--IPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVC 172
            +   P ++ +IF   E+ +L  +G    + KC + G T      S +S G +C
Sbjct: 122 DEGYDPQILTQIF---EMKMLPVLGHYPTMDKCAICGETTGHFDFSTRSNGIIC 172


>gi|157150562|ref|YP_001449353.1| DNA repair protein RecO [Streptococcus gordonii str. Challis
           substr. CH1]
 gi|189039774|sp|A8AU93|RECO_STRGC RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|157075356|gb|ABV10039.1| DNA repair protein RecO [Streptococcus gordonii str. Challis
           substr. CH1]
          Length = 260

 Score = 38.5 bits (88), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 35/171 (20%), Positives = 75/171 (43%), Gaps = 10/171 (5%)

Query: 7   AIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQNL 66
           A++L  R++ E + ++++ T Q G+ + FV++  + ++ P++Q   L   N   ++  + 
Sbjct: 9   ALVLYNRNFREDDKLVKIFTEQAGKRMFFVKHATNSKLSPVIQP--LTLANLLMKVNDDG 66

Query: 67  GEFRFEVLESHCAKLLSSSLFLYGLQSIVPLF--RFLPEREPCLELYDMLNIFLNCHK-- 122
             +  +  +      ++S LF+    + V       +P+ +P   L+  L   L   +  
Sbjct: 67  LSYIQDYQDVQPFTRINSDLFIMAYATYVAALADASIPDSQPDAALFAFLTKTLELMEEG 126

Query: 123 -IPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVC 172
               ++  IF   E+ +L   G  L+  +CV    T      S K  G +C
Sbjct: 127 LDHEILTNIF---EVQILSRFGVSLNFHECVFCHRTGLPFDFSFKFSGVLC 174


>gi|297242778|ref|ZP_06926716.1| DNA repair protein RecO [Gardnerella vaginalis AMD]
 gi|296888989|gb|EFH27723.1| DNA repair protein RecO [Gardnerella vaginalis AMD]
          Length = 248

 Score = 38.5 bits (88), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 56/249 (22%), Positives = 105/249 (42%), Gaps = 32/249 (12%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGF---VRNGQSH---RMQPIL-------Q 49
           ++D+A++L     GE + I+ ++T+++G+       VR  +S    R++P++       Q
Sbjct: 4   YRDEAVVLRTFPLGEADRIVVLLTKRHGKVRAVAKGVRRLKSRFGGRLEPLMRVDLLLAQ 63

Query: 50  AGNLVRVNWRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLE 109
             +L  V+    +A   GE   +      A ++   + L         +R   E +  L 
Sbjct: 64  GKSLDVVSQAVSIAAYAGEICADYTSYEYANVMLEVVDLLVSNEYTDEYRR--EYQDTLG 121

Query: 110 LYDMLNIFLNC---HK-IPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSP 165
            Y +L   L     HK  P  IG  ++   L  L   G+   L  CVV G  +DL + SP
Sbjct: 122 QYRLLTAALLSLSKHKHSPDAIGMSYI---LRALSLAGWSPRLQACVVCGKNEDLCYFSP 178

Query: 166 KSGGAVCRSVGLPYAE--------KMLVLPSFLWK--EEQTIDADSLKSAFQLTDYFLNK 215
             GG +C S   P +         ++  L    W   +  ++D+ +++   Q  +Y+L +
Sbjct: 179 CIGGMMCASDHTPDSIVCANSTRLQLCALAQGNWSVLDGVSVDSSTMRCVQQWAEYYLER 238

Query: 216 YALQHNIIH 224
                 ++H
Sbjct: 239 PIRSMGLLH 247


>gi|167037773|ref|YP_001665351.1| DNA repair protein RecO [Thermoanaerobacter pseudethanolicus ATCC
           33223]
 gi|256751967|ref|ZP_05492837.1| DNA repair protein RecO [Thermoanaerobacter ethanolicus CCSD1]
 gi|320116188|ref|YP_004186347.1| DNA repair protein RecO [Thermoanaerobacter brockii subsp. finnii
           Ako-1]
 gi|238687665|sp|B0KA52|RECO_THEP3 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|166856607|gb|ABY95015.1| DNA repair protein RecO [Thermoanaerobacter pseudethanolicus ATCC
           33223]
 gi|256749172|gb|EEU62206.1| DNA repair protein RecO [Thermoanaerobacter ethanolicus CCSD1]
 gi|319929279|gb|ADV79964.1| DNA repair protein RecO [Thermoanaerobacter brockii subsp. finnii
           Ako-1]
          Length = 248

 Score = 38.5 bits (88), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 39/173 (22%), Positives = 75/173 (43%), Gaps = 6/173 (3%)

Query: 4   QDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLA 63
           + +AI+L     GE + I  + T+ YG+     +  +  + + +      +  N+     
Sbjct: 5   KTEAIVLKNNLIGETDKIATLFTKSYGKLQAVAKGARRSKSRFVNAIRPFIVANYVIFEG 64

Query: 64  QNLGEF-RFEVLESHCAKLLSSSLFLYGLQSIVP--LFRFLPEREPCLELYDMLNIFLNC 120
           +N     ++E++E+H  + +   L  + + S +   + + L E +    LY  L   L  
Sbjct: 65  KNYYYIDQWELIEAH--RNIEKDLVKFSVASYIAETINKILEENQKSERLYLFLKHSLKA 122

Query: 121 HKIPSVIGKIFVQ-IELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVC 172
                +   IF+    L L+  +G+   L  CVV G  ++L + S   GGAVC
Sbjct: 123 VDELQIDPLIFISSYNLKLVSLLGYMPQLDNCVVCGKRENLKYFSNSCGGAVC 175


>gi|28199178|ref|NP_779492.1| DNA repair protein RecO [Xylella fastidiosa Temecula1]
 gi|182681909|ref|YP_001830069.1| DNA repair protein RecO [Xylella fastidiosa M23]
 gi|32129944|sp|Q87C04|RECO_XYLFT RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|238691045|sp|B2I606|RECO_XYLF2 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|28057284|gb|AAO29141.1| DNA repair protein RecO [Xylella fastidiosa Temecula1]
 gi|182632019|gb|ACB92795.1| DNA repair protein RecO [Xylella fastidiosa M23]
 gi|307578164|gb|ADN62133.1| DNA repair protein RecO [Xylella fastidiosa subsp. fastidiosa
           GB514]
          Length = 243

 Score = 38.5 bits (88), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 42/158 (26%), Positives = 68/158 (43%), Gaps = 11/158 (6%)

Query: 7   AIILGVRSYGEKNIILEVMTRQYGRHLGFVRNG----QSHRMQPILQAGNLVRVNWRSRL 62
           A +L VR + E ++++EV+T+ YGR LG +  G    +   ++  LQ    +R +   R 
Sbjct: 8   AFVLHVRPWRETSLLVEVLTQAYGR-LGLIARGVQGLKKQTLRAALQPLQWIRFSAIQR- 65

Query: 63  AQNLGEFR-FEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCH 121
              LG+ R  E L++  A  L     L        L R +P   P  ELY   +      
Sbjct: 66  -GELGQLRQAEALDT--APRLKGETMLASFYINELLLRLVPRHAPVNELYLAYSQTRERL 122

Query: 122 KIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQD 159
           +    +       EL +L+ +G G +L +C   G   D
Sbjct: 123 RTNDSLAWSLRLFELDILETLGVGFNL-ECDANGTPLD 159


>gi|262281673|ref|ZP_06059442.1| DNA repair protein recO [Streptococcus sp. 2_1_36FAA]
 gi|262262127|gb|EEY80824.1| DNA repair protein recO [Streptococcus sp. 2_1_36FAA]
          Length = 259

 Score = 38.5 bits (88), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 35/171 (20%), Positives = 75/171 (43%), Gaps = 10/171 (5%)

Query: 7   AIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQNL 66
           A++L  R++ E + ++++ T Q G+ + FV++  + ++ P++Q   L   N   ++  + 
Sbjct: 8   ALVLYNRNFREDDKLVKIFTEQAGKRMFFVKHATNSKLSPVIQP--LTLANLLMKVNDDG 65

Query: 67  GEFRFEVLESHCAKLLSSSLFLYGLQSIVPLF--RFLPEREPCLELYDMLNIFLNCHK-- 122
             +  +  +      ++S LF+    + V       +P+ +P   L+  L   L   +  
Sbjct: 66  LSYIQDYQDVQPFTRINSDLFIMAYATYVAALADASIPDSQPDAALFAFLTKTLELMEEG 125

Query: 123 -IPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVC 172
               ++  IF   E+ +L   G  L+  +CV    T      S K  G +C
Sbjct: 126 LDHEILTNIF---EVQILSRFGVSLNFHECVFCHRTGLPFDFSFKFSGVLC 173


>gi|326803487|ref|YP_004321305.1| DNA repair protein RecO [Aerococcus urinae ACS-120-V-Col10a]
 gi|326650240|gb|AEA00423.1| DNA repair protein RecO [Aerococcus urinae ACS-120-V-Col10a]
          Length = 255

 Score = 38.1 bits (87), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 43/176 (24%), Positives = 75/176 (42%), Gaps = 16/176 (9%)

Query: 7   AIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGN--LVRVNW----RS 60
            I+L  R Y EK++++++ T+ YG+ + FVRN   H+   +L+  +   VR  +      
Sbjct: 10  GIVLYQRPYKEKDLLVKIFTQPYGKRMFFVRN--IHKPNNVLKQPSFAFVRAEYIGTIND 67

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           R    L E +      H    L +  +   L  +V     +P+RE    L+  L   L+ 
Sbjct: 68  RGFSFLKEVKSMTFPKHTMSDLEAMAYASYLCHLVDA--SMPDREVDQVLFTQLEQALDK 125

Query: 121 HKI---PSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCR 173
            +    P++I  I   +E+ LL   G    L  C +    Q +   S    G +C+
Sbjct: 126 IETGFNPAIISNI---LEVQLLAKFGVMPQLHACQICQEDQGIFDFSVIFDGLLCQ 178


>gi|294626961|ref|ZP_06705552.1| DNA repair protein RecO [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 11122]
 gi|292598821|gb|EFF42967.1| DNA repair protein RecO [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 11122]
          Length = 240

 Score = 38.1 bits (87), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 42/146 (28%), Positives = 65/146 (44%), Gaps = 12/146 (8%)

Query: 9   ILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPI---LQAGNLVRVNWRSRLAQN 65
           +L VR++ E ++++EV+T Q+GR     R  Q  R Q +   LQ   L++ +   R    
Sbjct: 10  VLHVRAWRETSLLVEVLTEQHGRVGLLARGVQGPRKQALRAALQPLQLIQFSAVQR--GE 67

Query: 66  LGEFR-FEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLN--CHK 122
           L + R  E L++  A  L+    L G      L R  P  +P  ELY       +     
Sbjct: 68  LAQLRQAEALDT--APRLAGDTMLAGFYISELLLRLAPRNDPVPELYACYAQVRSHLASD 125

Query: 123 IPSVIGKIFVQIELMLLKNIGFGLDL 148
           +P   G    + E  +LK +GF  DL
Sbjct: 126 LPLAWG--LRRFERDVLKGLGFAFDL 149


>gi|227519873|ref|ZP_03949922.1| recombination protein O [Enterococcus faecalis TX0104]
 gi|227072667|gb|EEI10630.1| recombination protein O [Enterococcus faecalis TX0104]
 gi|315144806|gb|EFT88822.1| DNA repair protein RecO [Enterococcus faecalis TX2141]
          Length = 264

 Score = 38.1 bits (87), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 46/180 (25%), Positives = 78/180 (43%), Gaps = 22/180 (12%)

Query: 7   AIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQNL 66
            IIL  + + EK+ ++++ T  YG+ + FV+ G   +  P+L A  ++        A  +
Sbjct: 8   GIILFTKDFKEKDKLVKIFTESYGKLMFFVK-GAHRKNNPLLPA--ILPFT----EAVYI 60

Query: 67  GEFRFEVL-------ESHCAKLLSSSLFL--YGLQSIVPLFRFLPER--EPCL-ELYDML 114
           G FR E L       E    + +   +F+  YG   +  +   + ++  +P L +   M 
Sbjct: 61  GNFREEGLSFLNSSKEVQPFRNIQQDIFINAYGTYILNLVDAAIEDQHYDPNLFQFTHMA 120

Query: 115 NIFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRS 174
              LN  K P +I  IF   E+ LL+  G   +   CV  G TQ     S +  G +C  
Sbjct: 121 LSALNEQKDPEIITNIF---EIQLLERFGVRPEWHHCVACGETQGKFDYSSRYSGVLCEK 177


>gi|313618902|gb|EFR90766.1| DNA repair protein RecO [Listeria innocua FSL S4-378]
          Length = 255

 Score = 38.1 bits (87), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 40/174 (22%), Positives = 78/174 (44%), Gaps = 13/174 (7%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQN 65
           + I++   SY E + I+ + TR++G+ +G V  G       +     L    + +    N
Sbjct: 5   EGIVIRQTSYRESDKIVRMYTREFGK-IGVVARGAKKTKSRLAAVTQLFTNGYFTFFGGN 63

Query: 66  -LGEFR-FEVLESHCAKLLSSSLFLYGLQSIVP--LFRFLPEREPCLELYDM-LNIFLNC 120
            LG  +  EV+E+  +  +   +F+    + V   L +   ER+P   LY++   I  + 
Sbjct: 64  GLGTLQQGEVIENFSS--IQQDIFMTAYATYVCELLDKATEERQPNPYLYELTFQILRDI 121

Query: 121 HK--IPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVC 172
            +   P ++ +I+   E+ +L  +G    + KC + G T      S +S G +C
Sbjct: 122 DEGYDPQILTQIY---EMKMLPVLGLYPTMDKCAICGETTGHFDFSTRSNGIIC 172


>gi|16800565|ref|NP_470833.1| DNA repair protein RecO [Listeria innocua Clip11262]
 gi|20139533|sp|Q92BQ0|RECO_LISIN RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|16413970|emb|CAC96728.1| lin1497 [Listeria innocua Clip11262]
          Length = 255

 Score = 38.1 bits (87), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 40/174 (22%), Positives = 78/174 (44%), Gaps = 13/174 (7%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQN 65
           + I++   SY E + I+ + TR++G+ +G V  G       +     L    + +    N
Sbjct: 5   EGIVIRQTSYRESDKIVRMYTREFGK-IGVVARGAKKTKSRLAAVTQLFTNGYFTFFGGN 63

Query: 66  -LGEFR-FEVLESHCAKLLSSSLFLYGLQSIVP--LFRFLPEREPCLELYDM-LNIFLNC 120
            LG  +  EV+E+  +  +   +F+    + V   L +   ER+P   LY++   I  + 
Sbjct: 64  GLGTLQQGEVIENFSS--IQQDIFMTAYATYVCELLDKATEERQPNPYLYELTFQILRDI 121

Query: 121 HK--IPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVC 172
            +   P ++ +I+   E+ +L  +G    + KC + G T      S +S G +C
Sbjct: 122 DEGYDPQILTQIY---EMKMLPVLGLYPTMDKCAICGETTGHFDFSTRSNGIIC 172


>gi|284801847|ref|YP_003413712.1| DNA repair protein RecO [Listeria monocytogenes 08-5578]
 gi|284994989|ref|YP_003416757.1| DNA repair protein RecO [Listeria monocytogenes 08-5923]
 gi|284057409|gb|ADB68350.1| DNA repair protein RecO [Listeria monocytogenes 08-5578]
 gi|284060456|gb|ADB71395.1| DNA repair protein RecO [Listeria monocytogenes 08-5923]
          Length = 255

 Score = 38.1 bits (87), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 40/174 (22%), Positives = 77/174 (44%), Gaps = 13/174 (7%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQN 65
           + I++   SY E + I+ + TR++G+ +G V  G       +     L    + +    N
Sbjct: 5   EGIVIRQTSYRESDKIVRMYTREFGK-IGVVARGAKKTKSRLAAVTQLFTNGYFTFFGSN 63

Query: 66  -LGEFR-FEVLESHCAKLLSSSLFLYGLQSIVP--LFRFLPEREPCLELYDM-LNIFLNC 120
            LG  +  EV+E+  +  +   +F+    + V   L +   ER+P   LY++   I  + 
Sbjct: 64  GLGTLQQGEVIENFSS--IQQDIFMTAYATYVCELLDKATEERQPNPYLYELTFQILRDI 121

Query: 121 HK--IPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVC 172
            +   P ++ +I+   E+ +L  +G    + KC + G T      S  S G +C
Sbjct: 122 DEGYDPQILTQIY---EMKMLPVLGLYPTMDKCAICGETTGHFDFSTSSNGIIC 172


>gi|315282356|ref|ZP_07870784.1| DNA repair protein RecO [Listeria marthii FSL S4-120]
 gi|313613998|gb|EFR87714.1| DNA repair protein RecO [Listeria marthii FSL S4-120]
          Length = 255

 Score = 38.1 bits (87), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 40/174 (22%), Positives = 78/174 (44%), Gaps = 13/174 (7%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQN 65
           + I++   SY E + I+ + TR++G+ +G V  G       +     L    + +    N
Sbjct: 5   EGIVIRQTSYRESDKIVRMYTREFGK-IGVVARGAKKTKSRLAAVTQLFTNGYFTFFGGN 63

Query: 66  -LGEFR-FEVLESHCAKLLSSSLFLYGLQSIVP--LFRFLPEREPCLELYDM-LNIFLNC 120
            LG  +  EV+E+  +  +   +F+    + V   L +   ER+P   LY++   I  + 
Sbjct: 64  GLGTLQQGEVIENFSS--IQQDIFMTAYATYVCELLDKATEERQPNPYLYELTFQILRDI 121

Query: 121 HK--IPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVC 172
            +   P ++ +I+   E+ +L  +G    + KC + G T      S +S G +C
Sbjct: 122 DEGYDPQILTQIY---EMKMLPVLGLYPTMDKCAICGETTGHFDFSTRSNGIIC 172


>gi|261405618|ref|YP_003241859.1| DNA repair protein RecO [Paenibacillus sp. Y412MC10]
 gi|261282081|gb|ACX64052.1| DNA repair protein RecO [Paenibacillus sp. Y412MC10]
          Length = 251

 Score = 38.1 bits (87), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 45/185 (24%), Positives = 78/185 (42%), Gaps = 20/185 (10%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR-----MQPILQAGNLVR 55
           M ++ + I++    YGE N I+ + T++ G+    VR  +  +     +  +   G  V 
Sbjct: 1   MLYRAEGIVIRSMDYGEGNKIITLCTKESGKVGVLVRGAKKVKSRHAALTQLFTYGEYVF 60

Query: 56  VNWRSRLAQNLGEFRF-EVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDML 114
                R    LG     E++ESH           Y   +   L R L + E     +  L
Sbjct: 61  F----RNGTGLGNLNAGEIMESHHGLREDLVKAAYASYACELLDRVLQDEETGAFWFHQL 116

Query: 115 NIFLNC---HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVT---QDLLWVSPKSG 168
              L      K P +I  ++   E+ +L+  G+G +L  C+    +   +D+L VSP+ G
Sbjct: 117 KACLEALQEDKDPQIIINLY---EMKILQAAGYGPELDVCISCNQSRKDEDML-VSPRLG 172

Query: 169 GAVCR 173
           G +CR
Sbjct: 173 GVLCR 177


>gi|238796737|ref|ZP_04640243.1| DNA repair protein recO [Yersinia mollaretii ATCC 43969]
 gi|238719468|gb|EEQ11278.1| DNA repair protein recO [Yersinia mollaretii ATCC 43969]
          Length = 241

 Score = 38.1 bits (87), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 56/226 (24%), Positives = 93/226 (41%), Gaps = 25/226 (11%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNWRS 60
           WQ  A +L  R Y E +++L++ T   GR     +  +  R  ++  LQ    + V W  
Sbjct: 4   WQR-AFVLHGRPYSETSLMLDLFTEGEGRMRVLAKGARGRRSNLKGCLQPFTPLLVRWSG 62

Query: 61  RLAQNLGEFRFEVLES----HCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELY-DMLN 115
           R     GE +   L S      A  LS S+   GL     L R L  +     L+ D L+
Sbjct: 63  R-----GEVK--TLRSAEPVSLALPLSGSMLYSGLYVNELLSRVLEHQTNYSALFFDYLH 115

Query: 116 IFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTG--VTQDLLWVSPKSGGAVCR 173
              +             Q EL +L ++G+G+D   C  +G  V++ + +   +  G +  
Sbjct: 116 CLQSLAGSDGTPEYALRQFELAILAHLGYGVDFLHCSGSGQPVSETMTYRYREEKGFIAS 175

Query: 174 SVGLPYA---EKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKY 216
            V   Y+    ++L L        +  DAD+L++A + T   L  Y
Sbjct: 176 LVIDHYSFTGRQLLAL-----AHREFPDADTLRAAKRFTRIALKPY 216


>gi|116872891|ref|YP_849672.1| DNA repair protein RecO [Listeria welshimeri serovar 6b str.
           SLCC5334]
 gi|123461072|sp|A0AIR1|RECO_LISW6 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|116741769|emb|CAK20893.1| recombination protein O [Listeria welshimeri serovar 6b str.
           SLCC5334]
          Length = 255

 Score = 37.7 bits (86), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 40/174 (22%), Positives = 78/174 (44%), Gaps = 13/174 (7%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQN 65
           + I++   SY E + I+ + TR++G+ +G V  G       +     L    + +    N
Sbjct: 5   EGIVIRQTSYRESDKIVRMYTREFGK-IGVVARGAKKTKSRLAAVTQLFTNGYFTFFGGN 63

Query: 66  -LGEFR-FEVLESHCAKLLSSSLFLYGLQSIVP--LFRFLPEREPCLELYDM-LNIFLNC 120
            LG  +  EV+E+  +  +   +F+    + V   L +   ER+P   LY++   I  + 
Sbjct: 64  GLGTLQQGEVIENFSS--IQQDIFMTAYATYVCELLDKATEERQPNPYLYELTFQILRDI 121

Query: 121 HK--IPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVC 172
            +   P ++ +I+   E+ +L  +G    + KC + G T      S +S G +C
Sbjct: 122 DEGYDPQILTQIY---EMKMLPVLGLYPTMDKCAICGETTGHFDFSTRSNGIIC 172


>gi|47095411|ref|ZP_00233021.1| recombination protein O [Listeria monocytogenes str. 1/2a F6854]
 gi|254898374|ref|ZP_05258298.1| DNA repair protein RecO [Listeria monocytogenes J0161]
 gi|254912134|ref|ZP_05262146.1| recombination protein O [Listeria monocytogenes J2818]
 gi|254936462|ref|ZP_05268159.1| recombination protein O [Listeria monocytogenes F6900]
 gi|47016232|gb|EAL07155.1| recombination protein O [Listeria monocytogenes str. 1/2a F6854]
 gi|258609055|gb|EEW21663.1| recombination protein O [Listeria monocytogenes F6900]
 gi|293590106|gb|EFF98440.1| recombination protein O [Listeria monocytogenes J2818]
          Length = 255

 Score = 37.7 bits (86), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 40/174 (22%), Positives = 77/174 (44%), Gaps = 13/174 (7%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQN 65
           + I++   SY E + I+ + TR++G+ +G V  G       +     L    + +    N
Sbjct: 5   EGIVIRQTSYRESDKIVRMYTREFGK-IGVVARGAKKTKSRLAAVTQLFTNGYFTFFGGN 63

Query: 66  -LGEFR-FEVLESHCAKLLSSSLFLYGLQSIVP--LFRFLPEREPCLELYDM-LNIFLNC 120
            LG  +  EV+E+  +  +   +F+    + V   L +   ER+P   LY++   I  + 
Sbjct: 64  GLGTLQQGEVIETFSS--IQQDIFMTAYATYVCELLDKATEERQPNPYLYELTFQILRDI 121

Query: 121 HK--IPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVC 172
            +   P ++ +I+   E+ +L  +G    + KC + G T      S  S G +C
Sbjct: 122 DEGYDPQILTQIY---EMKMLPMLGLYPTMDKCAICGETTGHFDFSTSSNGIIC 172


>gi|329924075|ref|ZP_08279338.1| DNA repair protein RecO [Paenibacillus sp. HGF5]
 gi|328940914|gb|EGG37222.1| DNA repair protein RecO [Paenibacillus sp. HGF5]
          Length = 251

 Score = 37.7 bits (86), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 45/185 (24%), Positives = 78/185 (42%), Gaps = 20/185 (10%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR-----MQPILQAGNLVR 55
           M ++ + I++    YGE N I+ + T++ G+    VR  +  +     +  +   G  V 
Sbjct: 1   MLYRAEGIVIRSMDYGEGNKIITLCTKESGKVGVLVRGAKKVKSRHAALTQLFTYGEYVF 60

Query: 56  VNWRSRLAQNLGEFRF-EVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDML 114
                R    LG     E++ESH           Y   +   L R L + E     +  L
Sbjct: 61  F----RNGTGLGNLNAGEIMESHHGLREDLVKAAYASYACELLDRVLQDEETGAFWFHQL 116

Query: 115 NIFLNC---HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVT---QDLLWVSPKSG 168
              L      K P +I  ++   E+ +L+  G+G +L  C+    +   +D+L VSP+ G
Sbjct: 117 KACLEALQEDKDPQIIINLY---EMKILQAAGYGPELDVCISCNQSRKDEDML-VSPRLG 172

Query: 169 GAVCR 173
           G +CR
Sbjct: 173 GVLCR 177


>gi|194366745|ref|YP_002029355.1| DNA repair protein RecO [Stenotrophomonas maltophilia R551-3]
 gi|238693485|sp|B4SRK8|RECO_STRM5 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|194349549|gb|ACF52672.1| DNA repair protein RecO [Stenotrophomonas maltophilia R551-3]
          Length = 239

 Score = 37.7 bits (86), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 36/154 (23%), Positives = 64/154 (41%), Gaps = 14/154 (9%)

Query: 5   DDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNW------ 58
           D   +L  R+Y E ++++EV++ Q+GR +G +  G S     +L+A  L  + W      
Sbjct: 6   DTGFVLHARAYRETSLLVEVLSAQHGR-IGVLARGVSTAKGQVLRAA-LQPLQWIRFSAL 63

Query: 59  -RSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
            R  LAQ  G    +       + + +  +L  L       R  P ++P  ELY      
Sbjct: 64  QRGELAQLRGAEALDAAPRLVGQAMLAGFYLSELT-----LRLAPRQDPLPELYLAYGEA 118

Query: 118 LNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKC 151
                + + +     + E  LL ++G G +L   
Sbjct: 119 RARLGVGAGLAWTLRRFERELLTSLGLGFELDSA 152


>gi|160933321|ref|ZP_02080709.1| hypothetical protein CLOLEP_02166 [Clostridium leptum DSM 753]
 gi|156867198|gb|EDO60570.1| hypothetical protein CLOLEP_02166 [Clostridium leptum DSM 753]
          Length = 254

 Score = 37.7 bits (86), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 44/186 (23%), Positives = 81/186 (43%), Gaps = 21/186 (11%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M    D +I+  +S GE + ++ V+TR+ G    FVR  ++ +     ++ +  ++   S
Sbjct: 1   MQINTDGLIIREQSIGESDRLVTVLTREQGILRAFVRGAKAMKS----RSASSTQLLCYS 56

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLF-----RFLPEREPCLELYDMLN 115
           RL+   G  ++ + E+   ++  S    +   S+   F        PE+   +E  D L 
Sbjct: 57  RLSIYEGREKYIIDEAEPIEVFFSLRTDFEKLSLAQYFCELALALAPEK---MEAGDFLR 113

Query: 116 IFLNC------HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQ-DLLWVSPKSG 168
           + LN        K+P+   +I   +E+ +L   GF  DL  C   G  + D ++   K G
Sbjct: 114 LVLNALYFLGKGKLPA--AQIKAIVEMRMLSLAGFMPDLVCCAQCGAYEADQMYFMVKQG 171

Query: 169 GAVCRS 174
              C S
Sbjct: 172 SLYCGS 177


>gi|300717985|ref|YP_003742788.1| DNA repair protein [Erwinia billingiae Eb661]
 gi|299063821|emb|CAX60941.1| DNA repair protein [Erwinia billingiae Eb661]
          Length = 244

 Score = 37.7 bits (86), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 54/240 (22%), Positives = 91/240 (37%), Gaps = 25/240 (10%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNWRS 60
           WQ  A +L  R Y E +++L++ +  YGR     +  +  R  ++  LQ    + V W  
Sbjct: 4   WQR-AFVLHGRPYSETSLLLDLFSENYGRIRVLAKGARGKRSSLKGALQPFTPLLVRWGG 62

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLF------RFLPEREPCLEL-YDM 113
                    R EV     A+ +S +L L GL     L+      R L +     EL +D 
Sbjct: 63  ---------RGEVKTLRGAEPISLALPLSGLTLYCGLYVNELLSRVLEQETAFTELFFDY 113

Query: 114 LNIFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTG--VTQDLLWVSPKSGGAV 171
           L        +         + EL +L ++G+G+D   C  +G  V   + +      G +
Sbjct: 114 LYCLQALAAVTGSPEPALRRFELAMLGHLGYGVDFMHCAGSGEEVADGMTYTYRAEKGFI 173

Query: 172 CRSVGLPYAEKMLVLPSFLWKEEQTI-DADSLKSAFQLTDYFLNKYALQHNIIHCHLLRE 230
              V                 EE++  D D+L++A + T   L  Y     +    L R+
Sbjct: 174 ASLV---MGNNTFTGRQLRALEERSFPDIDTLRAAKRFTRIALKPYLGGKPLKSQELFRQ 230


>gi|89100472|ref|ZP_01173334.1| DNA repair protein RecO [Bacillus sp. NRRL B-14911]
 gi|89084815|gb|EAR63954.1| DNA repair protein RecO [Bacillus sp. NRRL B-14911]
          Length = 253

 Score = 37.7 bits (86), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 47/184 (25%), Positives = 86/184 (46%), Gaps = 23/184 (12%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQ-------SHRMQPILQAGNL 53
           M+ + + I+L   +YGE N I+ + TR++G+ +G +  G        S   QP      L
Sbjct: 1   MFEKCEGIVLRTVNYGESNKIVTLYTREWGK-VGVMARGAKKPNSRLSAVTQPFTYGYFL 59

Query: 54  VRVNWRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQS-IVPLF-RFLPEREPCLELY 111
           V+ +    L Q     + E++ S   + +   +FL    S IV L  + + E++P    +
Sbjct: 60  VQRSSGLGLMQ-----QGEMVSS--MRSIREDIFLTAYASYIVDLTDKTVEEKKPNPFHF 112

Query: 112 DMLNI---FLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSG 168
           ++L+    ++N    P ++  I+   E+ +L ++G    L KC V G T      S + G
Sbjct: 113 ELLHQTLNYMNEGYDPEIMVNIY---EMKMLNSLGLYPVLDKCSVCGSTDGHFSFSIREG 169

Query: 169 GAVC 172
           G +C
Sbjct: 170 GLIC 173


>gi|308180765|ref|YP_003924893.1| DNA repair protein RecO [Lactobacillus plantarum subsp. plantarum
           ST-III]
 gi|308046256|gb|ADN98799.1| DNA repair protein RecO [Lactobacillus plantarum subsp. plantarum
           ST-III]
          Length = 258

 Score = 37.7 bits (86), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 36/182 (19%), Positives = 81/182 (44%), Gaps = 26/182 (14%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQN 65
           + I+L  R Y E++++++ +T +YG+ + F+R     R +    A  L+       + + 
Sbjct: 6   NGILLFRRDYRERDMLIKFLTAEYGKKMFFIRGA---RRRGFKMAAELLPFT----MGEY 58

Query: 66  LGEFRFEVLE-----------SHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDML 114
           +G+ R + L             H ++ ++ + +   + +++ +    P+ +P    Y  L
Sbjct: 59  VGDLRDQGLSYINSVKSVQYLEHISQDIALNAYATYVMNLMDV--AFPDNQPVGRWYQQL 116

Query: 115 NIFL---NCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAV 171
              L   +    P+++  +   +E+ LL+  G   +L  C V G +   L  S   GG +
Sbjct: 117 TSALQLIDQDVAPALVANV---VEIQLLQPFGVAPELRWCTVCGRSDLPLDYSESYGGLL 173

Query: 172 CR 173
           C+
Sbjct: 174 CQ 175


>gi|238750384|ref|ZP_04611885.1| DNA repair protein recO [Yersinia rohdei ATCC 43380]
 gi|238711315|gb|EEQ03532.1| DNA repair protein recO [Yersinia rohdei ATCC 43380]
          Length = 241

 Score = 37.7 bits (86), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 54/226 (23%), Positives = 92/226 (40%), Gaps = 25/226 (11%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNWRS 60
           WQ  A +L  R Y E +++L++ T   GR     +  +  R  ++  LQ    + V W  
Sbjct: 4   WQR-AFVLHGRPYSETSLMLDLFTEGEGRMRVLAKGARGRRSNLKGCLQPFTPLLVRW-- 60

Query: 61  RLAQNLGEFRFEVLES----HCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELY-DMLN 115
                +G    + L S      A  LS S+   GL     L R L ++     L+ D L+
Sbjct: 61  -----VGRGEIKTLRSAEPVSLALPLSGSMLYSGLYVNELLSRVLEQQTNYSALFFDYLH 115

Query: 116 IFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTG--VTQDLLWVSPKSGGAVCR 173
              +             Q EL +L ++G+G+D   C  +G  V+  + +   +  G +  
Sbjct: 116 CLQSLAGSDGSPEYALRQFELAILAHLGYGVDFLHCAGSGQPVSDSMTYRYREEKGFIAS 175

Query: 174 SVGLPYA---EKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKY 216
            V   Y+    ++L L        +  DAD+L++A + T   L  Y
Sbjct: 176 LVVDHYSFTGRQLLAL-----ANREFPDADTLRAAKRFTRIALKPY 216


>gi|257898047|ref|ZP_05677700.1| recombination protein O [Enterococcus faecium Com15]
 gi|257835959|gb|EEV61033.1| recombination protein O [Enterococcus faecium Com15]
          Length = 270

 Score = 37.7 bits (86), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 46/189 (24%), Positives = 75/189 (39%), Gaps = 42/189 (22%)

Query: 7   AIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQNL 66
            +IL  R+Y EK+ ++++ T   G+ + +++ G   + QP+  A  L+        A  +
Sbjct: 9   GLILSSRNYKEKDKLVKIFTESSGKMMFYIK-GIHRQNQPLAPA--LLPFTE----AVYI 61

Query: 67  GEFRFE-------VLESHCAKLLSSSLFLYGL---------------QSIVPLFRFLPER 104
           G FR E       V + H  + +   +FL G                Q    LF+F  + 
Sbjct: 62  GNFRSEGLSFLSSVKDVHAFRHIQEDIFLSGYGTYLLNLVDAAIEDHQYDPHLFQFTQQA 121

Query: 105 EPCLELYDMLNIFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVS 164
              ++  D   I  N          IF   E+ +L+  G     T CVV G T+     S
Sbjct: 122 LQRMDQGDDAEIITN----------IF---EVQILQRFGIAPIWTHCVVCGETKGKFDYS 168

Query: 165 PKSGGAVCR 173
            K GG +C 
Sbjct: 169 SKYGGVICE 177


>gi|238753922|ref|ZP_04615282.1| DNA repair protein recO [Yersinia ruckeri ATCC 29473]
 gi|238707910|gb|EEQ00268.1| DNA repair protein recO [Yersinia ruckeri ATCC 29473]
          Length = 243

 Score = 37.7 bits (86), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 57/232 (24%), Positives = 95/232 (40%), Gaps = 37/232 (15%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNWRS 60
           WQ  A +L  R Y E +++L++ T   GR     +  +S R  ++  LQ    + V W  
Sbjct: 4   WQR-AFVLHSRPYSETSLMLDLFTEGEGRMRVLAKGARSRRSNLKGCLQPFTPLLVRWAG 62

Query: 61  RLAQNLGEFRFEVLES----HCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNI 116
           R     GE +   L S      A  LS ++   GL     L R L   E       +   
Sbjct: 63  R-----GEVK--TLRSAEPVSLALPLSGTMLYSGLYVNELLSRVL---EHGTNYSALFFD 112

Query: 117 FLNC-HKIPSVIGK---IFVQIELMLLKNIGFGLDLTKCVVTG--VTQDLLWVSPKSGGA 170
           +L+C   + +  G    +  Q EL +L ++G+G+D   C  +G  V   + +   +  G 
Sbjct: 113 YLHCLQALAATDGSPECVLRQFELAMLASLGYGVDFLHCAGSGQPVADSMTYRYREEKGF 172

Query: 171 VCRSVGLPYAEKMLVLPSFLWKEEQTI------DADSLKSAFQLTDYFLNKY 216
           +   V   Y        SF  ++ Q +      D+D+L++A + T   L  Y
Sbjct: 173 IASLVVDHY--------SFTGRQLQALANREFPDSDTLRAAKRFTRMALRPY 216


>gi|293556345|ref|ZP_06674926.1| DNA repair protein RecO [Enterococcus faecium E1039]
 gi|291601412|gb|EFF31683.1| DNA repair protein RecO [Enterococcus faecium E1039]
          Length = 270

 Score = 37.7 bits (86), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 45/189 (23%), Positives = 72/189 (38%), Gaps = 42/189 (22%)

Query: 7   AIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQNL 66
            +IL  R+Y EK+ ++++ T   G+ + +++  + HR    L    L         A  +
Sbjct: 9   GLILSSRNYKEKDKLVKIFTESSGKMMFYIK--EIHRQNQPLAPALLPFTE-----AVYI 61

Query: 67  GEFRFE-------VLESHCAKLLSSSLFLYGL---------------QSIVPLFRFLPER 104
           G FR E       V + H  + +   +FL G                Q    LF+F  + 
Sbjct: 62  GNFRSEGLSFLSSVKDVHAFRNIQEDIFLSGYGTYLLNLVDAAIEDHQYDPHLFQFTQQA 121

Query: 105 EPCLELYDMLNIFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVS 164
              ++  D   I  N          IF   E+ +L+  G     T CVV G T+     S
Sbjct: 122 LQRMDQGDDAEIITN----------IF---EVQILQRFGIAPIWTHCVVCGETKGKFDYS 168

Query: 165 PKSGGAVCR 173
            K GG +C 
Sbjct: 169 SKYGGVICE 177


>gi|28378609|ref|NP_785501.1| DNA repair protein RecO [Lactobacillus plantarum WCFS1]
 gi|254556824|ref|YP_003063241.1| DNA repair protein RecO [Lactobacillus plantarum JDM1]
 gi|38258515|sp|Q88VS1|RECO_LACPL RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|28271445|emb|CAD64350.1| DNA repair protein RecO [Lactobacillus plantarum WCFS1]
 gi|254045751|gb|ACT62544.1| DNA repair protein RecO [Lactobacillus plantarum JDM1]
          Length = 258

 Score = 37.4 bits (85), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 36/182 (19%), Positives = 81/182 (44%), Gaps = 26/182 (14%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQN 65
           + I+L  R Y E++++++ +T +YG+ + F+R     R +    A  L+       + + 
Sbjct: 6   NGILLFRRDYRERDMLIKFLTAEYGKKMFFIRGA---RRRGFKMAAELLPFT----MGEY 58

Query: 66  LGEFRFEVLE-----------SHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDML 114
           +G+ R + L             H ++ ++ + +   + +++ +    P+ +P    Y  L
Sbjct: 59  VGDLRDQGLSYINSVKSVQYLEHISQDIALNAYATYVMNLMDV--AFPDNQPVGRWYQQL 116

Query: 115 NIFL---NCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAV 171
              L   +    P+++  +   +E+ LL+  G   +L  C V G +   L  S   GG +
Sbjct: 117 TSALQLIDQDVAPALVANV---VEIQLLQPFGVAPELRWCTVCGRSDLPLDYSESYGGLL 173

Query: 172 CR 173
           C+
Sbjct: 174 CQ 175


>gi|300768137|ref|ZP_07078042.1| recombination protein O [Lactobacillus plantarum subsp. plantarum
           ATCC 14917]
 gi|300494201|gb|EFK29364.1| recombination protein O [Lactobacillus plantarum subsp. plantarum
           ATCC 14917]
          Length = 262

 Score = 37.4 bits (85), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 36/182 (19%), Positives = 81/182 (44%), Gaps = 26/182 (14%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQN 65
           + I+L  R Y E++++++ +T +YG+ + F+R     R +    A  L+       + + 
Sbjct: 10  NGILLFRRDYRERDMLIKFLTAEYGKKMFFIRGA---RRRGFKMAAELLPFT----MGEY 62

Query: 66  LGEFRFEVLE-----------SHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDML 114
           +G+ R + L             H ++ ++ + +   + +++ +    P+ +P    Y  L
Sbjct: 63  VGDLRDQGLSYINSVKSVQYLEHISQDIALNAYATYVMNLMDV--AFPDNQPVGRWYQQL 120

Query: 115 NIFL---NCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAV 171
              L   +    P+++  +   +E+ LL+  G   +L  C V G +   L  S   GG +
Sbjct: 121 TSALQLIDQDVAPALVANV---VEIQLLQPFGVAPELRWCTVCGRSDLPLDYSESYGGLL 177

Query: 172 CR 173
           C+
Sbjct: 178 CQ 179


>gi|257886867|ref|ZP_05666520.1| recombination protein O [Enterococcus faecium 1,141,733]
 gi|293568653|ref|ZP_06679968.1| DNA repair protein RecO [Enterococcus faecium E1071]
 gi|293571623|ref|ZP_06682644.1| DNA repair protein RecO [Enterococcus faecium E980]
 gi|257822921|gb|EEV49853.1| recombination protein O [Enterococcus faecium 1,141,733]
 gi|291588613|gb|EFF20446.1| DNA repair protein RecO [Enterococcus faecium E1071]
 gi|291608293|gb|EFF37594.1| DNA repair protein RecO [Enterococcus faecium E980]
          Length = 272

 Score = 37.4 bits (85), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 46/189 (24%), Positives = 75/189 (39%), Gaps = 42/189 (22%)

Query: 7   AIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQNL 66
            +IL  R+Y EK+ ++++ T   G+ + +++ G   + QP+  A  L+        A  +
Sbjct: 9   GLILSSRNYKEKDKLVKIFTESSGKMMFYIK-GIHRQNQPLAPA--LLPFT----EAVYI 61

Query: 67  GEFRFE-------VLESHCAKLLSSSLFLYGL---------------QSIVPLFRFLPER 104
           G FR E       V + H  + +   +FL G                Q    LF+F  + 
Sbjct: 62  GNFRSEGLSFLSSVKDVHAFRHIQEDIFLSGYGTYLLNLVDAAIEDHQYDPHLFQFTQQA 121

Query: 105 EPCLELYDMLNIFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVS 164
              ++  D   I  N          IF   E+ +L+  G     T CVV G T+     S
Sbjct: 122 LQRMDQGDDAEIITN----------IF---EVQILQRFGIAPIWTHCVVCGETKGKFDYS 168

Query: 165 PKSGGAVCR 173
            K GG +C 
Sbjct: 169 SKYGGVICE 177


>gi|315645985|ref|ZP_07899106.1| DNA repair protein RecO [Paenibacillus vortex V453]
 gi|315278746|gb|EFU42060.1| DNA repair protein RecO [Paenibacillus vortex V453]
          Length = 262

 Score = 37.4 bits (85), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 49/202 (24%), Positives = 82/202 (40%), Gaps = 20/202 (9%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR-----MQPILQAGNLVR 55
           M ++ + I++    YGE N I+ + T++ G+    VR  +  +     +  +   G  V 
Sbjct: 12  MLYRAEGIVIRSMDYGEGNKIITLCTKESGKVGVLVRGAKKVKSRHAALTQLFTYGEYVF 71

Query: 56  VNWRSRLAQNLGEFRF-EVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDML 114
                R    LG     E++ESH           Y   +   L R L + E     +  L
Sbjct: 72  F----RNGTGLGNLNAGEIMESHHRLREDLVKAAYASYACELLDRVLQDEETGAFWFHQL 127

Query: 115 NIFLNC---HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVT---QDLLWVSPKSG 168
              +      K P +I  ++   E+ +L+  G+G +L  C+    T   +D+L VSP+ G
Sbjct: 128 KACMEALQEDKDPQIIINLY---EMKILQAAGYGPELDVCISCNQTRKDEDML-VSPRLG 183

Query: 169 GAVCRSVGLPYAEKMLVLPSFL 190
           G +CR         M V P  L
Sbjct: 184 GVLCRYCKHLDPPAMSVTPRTL 205


>gi|290579547|ref|YP_003483939.1| putative DNA repair protein [Streptococcus mutans NN2025]
 gi|254996446|dbj|BAH87047.1| putative DNA repair protein [Streptococcus mutans NN2025]
          Length = 251

 Score = 37.4 bits (85), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 47/213 (22%), Positives = 90/213 (42%), Gaps = 28/213 (13%)

Query: 7   AIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM----QPILQAGNLVRVNWR--S 60
            ++L  R + E + ++++ T   G+H+ FVR+  + ++    QP++ A  ++++N    S
Sbjct: 8   GLVLYNRQFREDDKLVKIFTETSGKHMFFVRHATNSKLSSVIQPLILANFILKINNHGLS 67

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIV-------PLFRFLPEREPCLELYDM 113
            +    G   F+ + +   KL  ++  +    + +       PLF FL +    LEL D 
Sbjct: 68  YIEDYKGVSLFKEINADIYKLAYATYLVSLADAAISDAVYDAPLFAFLIK---TLELMDE 124

Query: 114 LNIFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVC- 172
              +        ++  IF   E+ +L   G  L+   CV           S +  G +C 
Sbjct: 125 GLDY-------EILTNIF---EIQILDRFGVQLNFHDCVFCHRVGLAFDFSHRYSGLLCP 174

Query: 173 -RSVGLPYAEKMLVLPSFLWKEEQTIDADSLKS 204
                 PY   +     +L  + QT+  DSLK+
Sbjct: 175 EHYEKDPYRSHLDPNVPYLLNQFQTLHFDSLKT 207


>gi|257464704|ref|ZP_05629075.1| DNA repair protein RecO [Actinobacillus minor 202]
 gi|257450364|gb|EEV24407.1| DNA repair protein RecO [Actinobacillus minor 202]
          Length = 241

 Score = 37.4 bits (85), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 39/165 (23%), Positives = 73/165 (44%), Gaps = 17/165 (10%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNWRS 60
           WQ    +L  R Y E ++++++ T  YGR     +  +  R  ++ +LQ    + + W  
Sbjct: 6   WQR-GFVLHKREYSETSLLVDLFTENYGRITLLAKGARRPRSPLKALLQPFTPLLLRWSG 64

Query: 61  RLAQNLGEFR-FEVLESHCAKLLSSSLFLY-GLQSIVPLFRFLPEREPCLELYDMLNIFL 118
           +     G+ +    +E+    L  ++  LY G      L R L  +    EL+   + +L
Sbjct: 65  K-----GDLKVLTKVEAAALTLPMNTKALYSGFYINEVLVRVLENQTAYQELF---HHYL 116

Query: 119 NCHKIPSV----IGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQD 159
            C    ++    +  I    E  +LK +G+G+D T C+ TG+  D
Sbjct: 117 QCVTHLALRSEELEPILRTFEFHVLKALGYGVDFTHCMATGLDVD 161


>gi|257882781|ref|ZP_05662434.1| recombination protein O [Enterococcus faecium 1,231,502]
 gi|257884089|ref|ZP_05663742.1| recombination protein O [Enterococcus faecium 1,231,501]
 gi|294622999|ref|ZP_06701888.1| DNA repair protein RecO [Enterococcus faecium U0317]
 gi|257818439|gb|EEV45767.1| recombination protein O [Enterococcus faecium 1,231,502]
 gi|257819927|gb|EEV47075.1| recombination protein O [Enterococcus faecium 1,231,501]
 gi|291597555|gb|EFF28717.1| DNA repair protein RecO [Enterococcus faecium U0317]
          Length = 270

 Score = 37.4 bits (85), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 46/189 (24%), Positives = 75/189 (39%), Gaps = 42/189 (22%)

Query: 7   AIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQNL 66
            +IL  R+Y EK+ ++++ T   G+ + +++ G   + QP+  A  L+        A  +
Sbjct: 9   GLILSSRNYKEKDKLVKIFTESSGKMMFYIK-GIHRQNQPLAPA--LLPFTE----AVYI 61

Query: 67  GEFRFE-------VLESHCAKLLSSSLFLYGL---------------QSIVPLFRFLPER 104
           G FR E       V + H  + +   +FL G                Q    LF+F  + 
Sbjct: 62  GNFRSEGLSFLSSVKDVHAFRNIQEDIFLSGYGTYLLNLVDAAIEDHQYDPHLFQFTQQA 121

Query: 105 EPCLELYDMLNIFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVS 164
              ++  D   I  N          IF   E+ +L+  G     T CVV G T+     S
Sbjct: 122 LQRMDQGDDAEIITN----------IF---EVQILQRFGIAPIWTHCVVCGETKGKFDYS 168

Query: 165 PKSGGAVCR 173
            K GG +C 
Sbjct: 169 SKYGGVICE 177


>gi|332205069|gb|EGJ19132.1| DNA repair protein RecO [Streptococcus pneumoniae GA47368]
          Length = 256

 Score = 37.4 bits (85), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 44/219 (20%), Positives = 87/219 (39%), Gaps = 40/219 (18%)

Query: 7   AIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQNL 66
            ++L  R++ E + ++++ T Q G+ + FV++    ++ P++Q   LV   +  R+  + 
Sbjct: 9   GLVLYNRNFREDDKLIKIFTEQVGKRMFFVKHAAQSKLAPVIQP--LVLARFLLRINDDG 66

Query: 67  GEFRFEVLESHCAKLLSSSLFLYGLQSIV---------------PLFRFLPER----EPC 107
             +  +  E      ++S LF+    + V               PLF FL +     E  
Sbjct: 67  LSYIEDYHEVMTFPKINSDLFVMAYATYVAALADASLQDNQQDAPLFAFLQKTLELMEAG 126

Query: 108 LELYDMLNIFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKS 167
           L+   + NIF                 E+ +L   G  L+  +CV           S K 
Sbjct: 127 LDYQVLTNIF-----------------EIQILTRFGISLNFNECVFCHRVGQAFDFSFKY 169

Query: 168 GGAVCRSVGLPYAEKMLVLPS--FLWKEEQTIDADSLKS 204
           G  +C         +  + P+  +L  + Q ID ++L++
Sbjct: 170 GACLCPEHYHEDKRRCHLNPNIPYLLNQFQAIDFETLET 208


>gi|238788222|ref|ZP_04632017.1| DNA repair protein recO [Yersinia frederiksenii ATCC 33641]
 gi|238723809|gb|EEQ15454.1| DNA repair protein recO [Yersinia frederiksenii ATCC 33641]
          Length = 241

 Score = 37.4 bits (85), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 56/226 (24%), Positives = 92/226 (40%), Gaps = 25/226 (11%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNWRS 60
           WQ  A +L  R Y E +++L++ T   GR     +  +  R  ++  LQ    + V W  
Sbjct: 4   WQR-AFVLHGRPYSETSLMLDLFTEGEGRMRVLAKGARGRRSNLKGCLQPFTPLLVRWTG 62

Query: 61  RLAQNLGEFRFEVLES----HCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELY-DMLN 115
           R     GE +   L S      A  LS S+   GL     L R L  +     L+ D L+
Sbjct: 63  R-----GEVK--TLRSAEPVSLALPLSGSMLYSGLYVNELLSRVLEHQTNYSALFFDYLH 115

Query: 116 IFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTG--VTQDLLWVSPKSGGAVCR 173
              +             Q EL +L ++G+G+D   C  +G  V+  + +   +  G +  
Sbjct: 116 CLQSLAGSDGSPEYALRQFELAILAHLGYGVDFLHCAGSGQPVSDSMTYRYREEKGFIAS 175

Query: 174 SVGLPYA---EKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKY 216
            V   Y+    ++L L        +  DAD+L++A + T   L  Y
Sbjct: 176 LVVDHYSFTGRQLLAL-----ANREFPDADTLRAAKRFTRIALKPY 216


>gi|328474972|gb|EGF45766.1| DNA repair protein RecO [Listeria monocytogenes 220]
          Length = 254

 Score = 37.4 bits (85), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 42/174 (24%), Positives = 78/174 (44%), Gaps = 14/174 (8%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQN 65
           + I++   SY E + I+ + TR++G+ +G V  G   + + +     L    + +    N
Sbjct: 5   EGIVIRQTSYRESDKIVRMYTREFGK-IGVVARGAKTKSR-LAAVTQLFTNGYFTFFGSN 62

Query: 66  -LGEFR-FEVLESHCAKLLSSSLFLYGLQSIVP--LFRFLPEREPCLELYDMLNIFL--- 118
            LG  +  EV+E+  +  +   +F+    + V   L +   ER+P   LY++    L   
Sbjct: 63  GLGTLQQGEVIENFSS--IQQDIFMTAYATYVCELLDKATEERQPNPYLYELTFQILRDI 120

Query: 119 NCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVC 172
           N    P ++ +IF   E+ +L  +G    + KC + G T      S  S G +C
Sbjct: 121 NEGYDPQILTQIF---EMKMLPVLGLYPTMDKCAICGETTGHFDFSTSSNGIIC 171


>gi|69247286|ref|ZP_00604287.1| Recombination protein O, RecO [Enterococcus faecium DO]
 gi|257879931|ref|ZP_05659584.1| recombination protein O [Enterococcus faecium 1,230,933]
 gi|258616602|ref|ZP_05714372.1| DNA repair protein RecO, putative [Enterococcus faecium DO]
 gi|261208623|ref|ZP_05923060.1| recombination protein O [Enterococcus faecium TC 6]
 gi|289566738|ref|ZP_06447152.1| DNA repair protein RecO [Enterococcus faecium D344SRF]
 gi|294616319|ref|ZP_06696112.1| DNA repair protein RecO [Enterococcus faecium E1636]
 gi|68194908|gb|EAN09378.1| Recombination protein O, RecO [Enterococcus faecium DO]
 gi|257814159|gb|EEV42917.1| recombination protein O [Enterococcus faecium 1,230,933]
 gi|260077125|gb|EEW64845.1| recombination protein O [Enterococcus faecium TC 6]
 gi|289161459|gb|EFD09345.1| DNA repair protein RecO [Enterococcus faecium D344SRF]
 gi|291590833|gb|EFF22549.1| DNA repair protein RecO [Enterococcus faecium E1636]
          Length = 270

 Score = 37.4 bits (85), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 42/188 (22%), Positives = 72/188 (38%), Gaps = 34/188 (18%)

Query: 4   QDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLA 63
           +   +IL  R+Y EK+ ++++ T   G+ + +++ G   + QP+  A  L+       + 
Sbjct: 6   ESKGLILSSRNYKEKDKLVKIFTESSGKMMFYIK-GIHRQNQPLAPA--LLPFTEAVYIG 62

Query: 64  QNLGE---FRFEVLESHCAKLLSSSLFLYGL---------------QSIVPLFRFLPERE 105
             L E   F   V + H  + +   +FL G                Q    LF+F  +  
Sbjct: 63  NFLSEGLSFLSSVKDVHAFRNIQEDIFLSGYGTYLLNLVDAAIEDHQYDPHLFQFTQQAL 122

Query: 106 PCLELYDMLNIFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSP 165
             ++  D   I  N               E+ +L+  G     T CVV G T+     S 
Sbjct: 123 QRMDQGDDAEIITNI-------------FEVQILQRFGIAPIWTHCVVCGETKGKFDYSS 169

Query: 166 KSGGAVCR 173
           K GG +C 
Sbjct: 170 KYGGVICE 177


>gi|240949698|ref|ZP_04754033.1| DNA repair protein RecO [Actinobacillus minor NM305]
 gi|240295956|gb|EER46632.1| DNA repair protein RecO [Actinobacillus minor NM305]
          Length = 241

 Score = 37.4 bits (85), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 39/165 (23%), Positives = 73/165 (44%), Gaps = 17/165 (10%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNWRS 60
           WQ    +L  R Y E ++++++ T  YGR     +  +  R  ++ +LQ    + + W  
Sbjct: 6   WQR-GFVLHKREYSETSLLVDLFTENYGRITLLAKGARRPRSPLKALLQPFTPLLLRWSG 64

Query: 61  RLAQNLGEFR-FEVLESHCAKLLSSSLFLY-GLQSIVPLFRFLPEREPCLELYDMLNIFL 118
           +     G+ +    +E+    L  ++  LY G      L R L  +    EL+   + +L
Sbjct: 65  K-----GDLKVLTKVEAAALTLPMNTKALYSGFYINEVLVRVLENQTAYQELF---HHYL 116

Query: 119 NCHKIPSV----IGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQD 159
            C    ++    +  I    E  +LK +G+G+D T C+ TG+  D
Sbjct: 117 QCVTHLALRSEELEPILRTFEFHVLKALGYGVDFTHCMATGLEVD 161


>gi|257890446|ref|ZP_05670099.1| recombination protein O [Enterococcus faecium 1,231,410]
 gi|294618703|ref|ZP_06698236.1| DNA repair protein RecO [Enterococcus faecium E1679]
 gi|257826806|gb|EEV53432.1| recombination protein O [Enterococcus faecium 1,231,410]
 gi|291595046|gb|EFF26390.1| DNA repair protein RecO [Enterococcus faecium E1679]
          Length = 270

 Score = 37.4 bits (85), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 44/192 (22%), Positives = 74/192 (38%), Gaps = 42/192 (21%)

Query: 4   QDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLA 63
           +   +IL  R+Y EK+ ++++ T   G+ + +++ G   + QP+  A  L+        A
Sbjct: 6   ESKGLILSSRNYKEKDKLVKIFTESSGKMMFYIK-GIHRQNQPLAPA--LLPFT----EA 58

Query: 64  QNLGEFRFE-------VLESHCAKLLSSSLFLYGL---------------QSIVPLFRFL 101
             +G FR E       V + H  + +   +FL G                Q    LF+F 
Sbjct: 59  VYIGNFRSEGLSFLSSVKDVHAFRNIQEDIFLSGYGTYLLNLVDAAIEDHQYDPHLFQFT 118

Query: 102 PEREPCLELYDMLNIFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLL 161
            +    ++  D   I  N               E+ +L+  G     T CVV G T+   
Sbjct: 119 QQALQRMDQGDDAEIITNI-------------FEVQILQRFGIAPIWTHCVVCGETKGKF 165

Query: 162 WVSPKSGGAVCR 173
             S K GG +C 
Sbjct: 166 DYSSKYGGVICE 177


>gi|297617860|ref|YP_003703019.1| DNA repair protein RecO [Syntrophothermus lipocalidus DSM 12680]
 gi|297145697|gb|ADI02454.1| DNA repair protein RecO [Syntrophothermus lipocalidus DSM 12680]
          Length = 250

 Score = 37.4 bits (85), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 47/203 (23%), Positives = 87/203 (42%), Gaps = 25/203 (12%)

Query: 2   YWQDDAIILGVRSYGEKNIILEVMTRQYGR----HLGFVRNGQSHR--MQPI------LQ 49
           Y+  +AI+L  + + E + I+    R+ G+      G  +   S R  +QP       L 
Sbjct: 4   YYITEAIVLKNQDFIETDKIVTFFARREGKLRAVAKGIKKPNSSLRGAVQPFCFSCLHLS 63

Query: 50  AGNLVRVNWRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLE 109
            G  + +  + R+ +  G  R +++++        SL+L  L     L + L E +P  E
Sbjct: 64  RGRELDLITQGRIIEFFGYVRDDMVKT------LHSLYLMEL-----LDKSLAEADPHPE 112

Query: 110 LYDMLNIFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGG 169
           ++D     L C +            EL L + +G+ L L KC++ G  + ++ +S K GG
Sbjct: 113 VFDATLTVLRCLEDGPFSPLAVRWFELKLARELGYALGLQKCILCGRGKAVV-LSIKDGG 171

Query: 170 AVCRSVGLPYAEKML-VLPSFLW 191
            +C        + ++  L   LW
Sbjct: 172 VLCDRCNRASTDNLIFALDGELW 194


>gi|238784189|ref|ZP_04628202.1| DNA repair protein recO [Yersinia bercovieri ATCC 43970]
 gi|238714898|gb|EEQ06897.1| DNA repair protein recO [Yersinia bercovieri ATCC 43970]
          Length = 241

 Score = 37.0 bits (84), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 56/226 (24%), Positives = 91/226 (40%), Gaps = 25/226 (11%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNWRS 60
           WQ  A +L  R Y E +++L++ T   GR     +  +  R  ++  LQ    + V W  
Sbjct: 4   WQR-AFVLHGRPYSETSLMLDLFTEGEGRMRVLAKGARGRRSNLKGCLQPFTPLLVRWTG 62

Query: 61  RLAQNLGEFRFEVLES----HCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELY-DMLN 115
           R     GE +   L S      A  LS S+   GL     L R L  +     L+ D L+
Sbjct: 63  R-----GEVK--TLRSAEPVSLALPLSGSMLYSGLYVNELLSRVLEHQTNYSALFFDYLH 115

Query: 116 IFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTG--VTQDLLWVSPKSGGAVCR 173
              +             Q EL +L ++G+G+D   C  +G  V   + +   +  G +  
Sbjct: 116 CLQSLAGSDGTPEYALRQFELAILAHLGYGVDFLHCAGSGQPVADTMTYRYREEKGFIAS 175

Query: 174 SVGLPYA---EKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKY 216
            V   Y+    ++L L        +  DAD+L++A + T   L  Y
Sbjct: 176 LVIDHYSFTGRQLLAL-----ANREFPDADTLRAAKRFTRIALKPY 216


>gi|194017652|ref|ZP_03056262.1| DNA repair protein RecO [Bacillus pumilus ATCC 7061]
 gi|194010552|gb|EDW20124.1| DNA repair protein RecO [Bacillus pumilus ATCC 7061]
          Length = 256

 Score = 37.0 bits (84), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 43/184 (23%), Positives = 82/184 (44%), Gaps = 19/184 (10%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQ-------SHRMQPILQAGNL 53
           M  + + I+L    YGE N I+ ++TR++G+ +G +  G        S   QP L    L
Sbjct: 1   MLIKSEGIVLRTTDYGETNKIVTLLTREHGK-IGVMARGAKKSNSRLSAISQPFLYGTFL 59

Query: 54  VRVNWRSRLAQNLGEF-RFEVLESHCAKLLSSSLFLYGLQSIVP--LFRFLPEREPCLEL 110
           ++       +  LG   + E++ES   + +   LFL    + +   L +   E++P   L
Sbjct: 60  IQS------STGLGTLQQGEMIES--MRTIREDLFLTAYAAYMTELLDKGTEEKKPNPYL 111

Query: 111 YDMLNIFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGA 170
           +++L   L      +    I   +E+ +L  +G   +L +CV  G  +     S +  G 
Sbjct: 112 FELLLQSLRHLNEGTDADVILFIVEVKMLSVMGMKPELDQCVHCGQKEGQFHFSIRDNGF 171

Query: 171 VCRS 174
           +C++
Sbjct: 172 ICQN 175


>gi|189425855|ref|YP_001953032.1| DNA repair protein RecO [Geobacter lovleyi SZ]
 gi|189422114|gb|ACD96512.1| DNA repair protein RecO [Geobacter lovleyi SZ]
          Length = 209

 Score = 37.0 bits (84), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 48/171 (28%), Positives = 76/171 (44%), Gaps = 28/171 (16%)

Query: 4   QDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLA 63
           Q  AIIL   +YGE + I+ + T ++GR  GF ++ ++ R +     G L   N   RLA
Sbjct: 5   QCQAIILSTLNYGESDRIVSLFTLEHGRLRGFAKSARASRKR---FGGQLEPAN---RLA 58

Query: 64  QNL-----GEFRFEVLE-SHC-----AKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYD 112
             L     G  R E +E S+C      +L S +L LY  + +  L    PE  P   L+ 
Sbjct: 59  VTLSLREDGLSRIERVEQSNCYPELRERLESLALALYACELVEAL---TPEGHPLPRLFR 115

Query: 113 MLNIFLN--CHKIPSVIGKIFVQIELMLLKNIGFGLD------LTKCVVTG 155
           +L+        +  S   + F ++ L+ +      LD      L+ C+ TG
Sbjct: 116 LLSTLFEHLAGQSGSPTDRRFFEMNLLNILGYRPALDTAALQPLSDCLKTG 166


>gi|330686117|gb|EGG97738.1| DNA repair protein RecO [Staphylococcus epidermidis VCU121]
          Length = 252

 Score = 37.0 bits (84), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 54/216 (25%), Positives = 88/216 (40%), Gaps = 39/216 (18%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQA-------GNL 53
           M  +   II+    YGE + I+ ++  +YG  +  +   ++ +++  LQA       G  
Sbjct: 1   MLMKQKGIIIKSVEYGESDKIITILN-EYGSKVPLMAR-RAKKIKSGLQAHTQMFVYGLF 58

Query: 54  VRVNWRSRLAQNL-------GEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREP 106
           +   WR     N         E + ++ ES  A L + ++            R + E E 
Sbjct: 59  IYNKWRGMGTLNCVDVINQHYELQLDLYESSFATLCAETID-----------RSMEENEI 107

Query: 107 CLELYDMLNIFLNCHKIPSVIGKIFVQIELML--LKNIGFGLDLTKCVVTGVTQD--LLW 162
               YD+LN  L   KI S      + I ++L  +   GF     KCV++G T    L+ 
Sbjct: 108 SKYNYDLLNFVLT--KISSGQSAQLMSIIVLLKCMNKFGFSALFNKCVISGNTDQSKLVG 165

Query: 163 VSPKSGGAVCRSV------GLPYAEKMLVLPSFLWK 192
            S K  GA+ +SV       L  + K L L   L+K
Sbjct: 166 YSFKFDGAISQSVAYQDPHALQLSNKTLYLLDVLYK 201


>gi|157693027|ref|YP_001487489.1| DNA repair protein RecO [Bacillus pumilus SAFR-032]
 gi|166918728|sp|A8FFB2|RECO_BACP2 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|157681785|gb|ABV62929.1| DNA repair protein RecO [Bacillus pumilus SAFR-032]
          Length = 256

 Score = 37.0 bits (84), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 43/184 (23%), Positives = 82/184 (44%), Gaps = 19/184 (10%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQ-------SHRMQPILQAGNL 53
           M  + + I+L    YGE N I+ ++TR++G+ +G +  G        S   QP L    L
Sbjct: 1   MLIKSEGIVLRTTDYGETNKIVTLLTREHGK-IGVMARGAKKSNSRLSAISQPFLYGTFL 59

Query: 54  VRVNWRSRLAQNLGEF-RFEVLESHCAKLLSSSLFLYGLQSIVP--LFRFLPEREPCLEL 110
           ++       +  LG   + E++ES   + +   LFL    + +   L +   E++P   L
Sbjct: 60  IQS------STGLGTLQQGEMIES--MRTIREDLFLTAYAAYMTELLDKGTEEKKPNPYL 111

Query: 111 YDMLNIFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGA 170
           +++L   L      +    I   +E+ +L  +G   +L +CV  G  +     S +  G 
Sbjct: 112 FELLLQSLRHLNEGTDADIILFIVEVKMLSVMGMKPELDQCVHCGQKEGQFHFSIRDNGF 171

Query: 171 VCRS 174
           +C++
Sbjct: 172 ICQN 175


>gi|227551967|ref|ZP_03982016.1| recombination protein RecO [Enterococcus faecium TX1330]
 gi|257895441|ref|ZP_05675094.1| recombination protein O [Enterococcus faecium Com12]
 gi|293378308|ref|ZP_06624477.1| DNA repair protein RecO [Enterococcus faecium PC4.1]
 gi|227178872|gb|EEI59844.1| recombination protein RecO [Enterococcus faecium TX1330]
 gi|257832006|gb|EEV58427.1| recombination protein O [Enterococcus faecium Com12]
 gi|292643172|gb|EFF61313.1| DNA repair protein RecO [Enterococcus faecium PC4.1]
          Length = 272

 Score = 36.6 bits (83), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 46/189 (24%), Positives = 75/189 (39%), Gaps = 42/189 (22%)

Query: 7   AIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQNL 66
            +IL  R+Y EK+ ++++ T   G+ + +++ G   + QP+  A  L+        A  +
Sbjct: 9   GLILSSRNYKEKDKLVKIFTESSGKMMFYIK-GIHRQNQPLAPA--LLPFT----EAVYI 61

Query: 67  GEFRFE-------VLESHCAKLLSSSLFLYGL---------------QSIVPLFRFLPER 104
           G FR E       V + H  + +   +FL G                Q    LF+F  + 
Sbjct: 62  GNFRSEGLSFLSSVKDVHAFRHIQEDIFLSGYGTYLLNLVDAAIEDHQYDPHLFQFTQQA 121

Query: 105 EPCLELYDMLNIFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVS 164
              ++  D   I  N          IF   E+ +L+  G     T CVV G T+     S
Sbjct: 122 LQRMDQGDDAEIITN----------IF---EVQILQRFGITPIWTHCVVCGETKGKFDYS 168

Query: 165 PKSGGAVCR 173
            K GG +C 
Sbjct: 169 SKYGGVICE 177


>gi|322391156|ref|ZP_08064628.1| recombination protein O [Streptococcus peroris ATCC 700780]
 gi|321145909|gb|EFX41298.1| recombination protein O [Streptococcus peroris ATCC 700780]
          Length = 256

 Score = 36.6 bits (83), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 44/219 (20%), Positives = 88/219 (40%), Gaps = 40/219 (18%)

Query: 7   AIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQNL 66
            ++L  R++ E + ++++ T Q G+ + FV++    ++ P++Q   LV   +  ++  + 
Sbjct: 9   GLVLYNRNFREDDKLVKIFTEQAGKRMFFVKHAGQTKLAPVIQP--LVLARFLMKVNDDG 66

Query: 67  GEFRFEVLESHCAKLLSSSLFLYGLQSIV---------------PLFRFLPE----REPC 107
             +  +  E      ++S LF+    + V               PLF FL +     E  
Sbjct: 67  LSYIEDYREVMTFPKINSDLFVMAYATYVAALADASLQDNHEDAPLFAFLQKVLELMEEG 126

Query: 108 LELYDMLNIFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKS 167
           L+   + NIF                 E+ LL   G  L+  +C            S K 
Sbjct: 127 LDYQVLTNIF-----------------EIQLLTRFGISLNFNECTFCHRVGQAFDFSFKY 169

Query: 168 GGAVCRSVGLPYAEKMLVLPS--FLWKEEQTIDADSLKS 204
           GG +C        ++  + P+  +L  + Q ID ++L++
Sbjct: 170 GGCLCPDHYHEDEKRCHLNPNIPYLLNQFQAIDFETLET 208


>gi|168483659|ref|ZP_02708611.1| DNA repair protein RecO [Streptococcus pneumoniae CDC1873-00]
 gi|172043032|gb|EDT51078.1| DNA repair protein RecO [Streptococcus pneumoniae CDC1873-00]
          Length = 256

 Score = 36.6 bits (83), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 44/219 (20%), Positives = 87/219 (39%), Gaps = 40/219 (18%)

Query: 7   AIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQNL 66
            ++L  R++ E + ++++ T Q G+ + FV++    ++ P++Q   LV   +  R+  + 
Sbjct: 9   GLVLYNRNFREDDKLIKIFTEQVGKRMFFVKHAGQSKLAPVIQP--LVLARFLLRINDDG 66

Query: 67  GEFRFEVLESHCAKLLSSSLFLYGLQSIV---------------PLFRFLPER----EPC 107
             +  +  E      ++S LF+    + V               PLF FL +     E  
Sbjct: 67  LSYIEDYHEVMTFPKINSDLFVMAYATYVAALADASLQDNQQDAPLFAFLQKTLELMEAG 126

Query: 108 LELYDMLNIFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKS 167
           L+   + NIF                 E+ +L   G  L+  +CV           S K 
Sbjct: 127 LDYQVLTNIF-----------------EIQILTRFGISLNFNECVFCHRVGQAFDFSFKY 169

Query: 168 GGAVCRSVGLPYAEKMLVLPS--FLWKEEQTIDADSLKS 204
           G  +C         +  + P+  +L  + Q ID ++L++
Sbjct: 170 GACLCPEHYHEDKRRCHLNPNIPYLLNQFQAIDFETLET 208


>gi|116626995|ref|YP_819614.1| DNA repair protein RecO [Streptococcus thermophilus LMD-9]
 gi|122268400|sp|Q03N04|RECO_STRTD RecName: Full=DNA repair protein recO; AltName:
          Full=Recombination protein O
 gi|116100272|gb|ABJ65418.1| DNA replication and repair protein RecO [Streptococcus
          thermophilus LMD-9]
          Length = 257

 Score = 36.6 bits (83), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 30/48 (62%)

Query: 7  AIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLV 54
           +IL  R+Y E + ++++ T+Q G+ + FVR G S ++  ++Q  N+ 
Sbjct: 8  GVILFNRNYRENDKLVKIFTKQAGKRMFFVRGGGSGKLSAVIQPLNIA 55


>gi|197285741|ref|YP_002151613.1| DNA repair protein [Proteus mirabilis HI4320]
 gi|238693200|sp|B4F045|RECO_PROMH RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|194683228|emb|CAR43909.1| DNA repair protein [Proteus mirabilis HI4320]
          Length = 246

 Score = 36.6 bits (83), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 57/225 (25%), Positives = 88/225 (39%), Gaps = 23/225 (10%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPI---LQAGNLVRVNWR 59
           WQ  A ++  R Y E +++L+  T   GR +  +  G   R  P+   LQ    + + W 
Sbjct: 4   WQR-AFVIHARPYSETSLLLDFFTENEGR-VRILSKGARGRRSPLKGALQPFTPLLIRWS 61

Query: 60  SRLAQNLGEFRF--EVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELY----DM 113
            R     GE +   +      A  L+ ++   GL     L R L        L+      
Sbjct: 62  GR-----GEIKTLRDAEPISLALPLTGTVLYSGLYLNELLSRVLENGTSYSTLFFEYLSC 116

Query: 114 LNIFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTG--VTQDLLWVSPKSGGAV 171
           L I       P    + F   EL LL  +G+GLD   C  +G  V+  + +   +  G +
Sbjct: 117 LQILAASETTPEAALRRF---ELALLTQLGYGLDFLHCAGSGEPVSDTMTYRYREEKGFI 173

Query: 172 CRSVGLPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKY 216
              V   Y+   L L S   +E  T  A +LK+A + T   L  Y
Sbjct: 174 ASLVVDHYSFTGLELKSLAKREFPT--AGTLKAAKRFTRMALKPY 216


>gi|227356255|ref|ZP_03840644.1| recombination protein O [Proteus mirabilis ATCC 29906]
 gi|227163719|gb|EEI48635.1| recombination protein O [Proteus mirabilis ATCC 29906]
          Length = 246

 Score = 36.6 bits (83), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 57/225 (25%), Positives = 88/225 (39%), Gaps = 23/225 (10%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPI---LQAGNLVRVNWR 59
           WQ  A ++  R Y E +++L+  T   GR +  +  G   R  P+   LQ    + + W 
Sbjct: 4   WQR-AFVIHARPYSETSLLLDFFTENEGR-VRILSKGARGRRSPLKGALQPFTPLLIRWS 61

Query: 60  SRLAQNLGEFRF--EVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELY----DM 113
            R     GE +   +      A  L+ ++   GL     L R L        L+      
Sbjct: 62  GR-----GEIKTLRDAEPISLALPLTGTVLYSGLYLNELLSRVLENGTSYSALFFEYLSC 116

Query: 114 LNIFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTG--VTQDLLWVSPKSGGAV 171
           L I       P    + F   EL LL  +G+GLD   C  +G  V+  + +   +  G +
Sbjct: 117 LQILAASETTPEAALRRF---ELALLTQLGYGLDFLHCAGSGEPVSDTMTYRYREEKGFI 173

Query: 172 CRSVGLPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKY 216
              V   Y+   L L S   +E  T  A +LK+A + T   L  Y
Sbjct: 174 ASLVVDHYSFTGLELKSLAKREFPT--AGTLKAAKRFTRMALKPY 216


>gi|15838839|ref|NP_299527.1| DNA repair protein RecO [Xylella fastidiosa 9a5c]
 gi|17865569|sp|Q9PB96|RECO_XYLFA RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|9107402|gb|AAF85047.1|AE004037_8 DNA repair protein RecO [Xylella fastidiosa 9a5c]
          Length = 243

 Score = 36.6 bits (83), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 41/158 (25%), Positives = 67/158 (42%), Gaps = 11/158 (6%)

Query: 7   AIILGVRSYGEKNIILEVMTRQYGRHLGFVRNG----QSHRMQPILQAGNLVRVNWRSRL 62
           A +L VR + E ++++EV+T+ YGR LG +  G    +   ++  LQ    +R +   R 
Sbjct: 8   AFVLHVRPWRETSLLVEVLTQAYGR-LGLIARGVQGLKKQTLRAALQPLQWIRFSAIQR- 65

Query: 63  AQNLGEFR-FEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCH 121
              LG+ R  E L++  A  L     L        L R +P   P  ELY   +      
Sbjct: 66  -GELGQLRQAEALDT--APRLKGEAMLASFYINELLLRLVPRHAPVNELYLAYSQTRERL 122

Query: 122 KIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQD 159
           +    +       E  +L+ +G G +L +C   G   D
Sbjct: 123 RTSDSLAWSLRLFEREILETLGVGFNL-ECDANGTPLD 159


>gi|167767682|ref|ZP_02439735.1| hypothetical protein CLOSS21_02217 [Clostridium sp. SS2/1]
 gi|317499139|ref|ZP_07957416.1| DNA repair protein RecO [Lachnospiraceae bacterium 5_1_63FAA]
 gi|167710699|gb|EDS21278.1| hypothetical protein CLOSS21_02217 [Clostridium sp. SS2/1]
 gi|291560816|emb|CBL39616.1| DNA replication and repair protein RecO [butyrate-producing
           bacterium SSC/2]
 gi|316893552|gb|EFV15757.1| DNA repair protein RecO [Lachnospiraceae bacterium 5_1_63FAA]
          Length = 240

 Score = 36.6 bits (83), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 22/38 (57%)

Query: 135 ELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVC 172
           E+ +L   G G++ ++CV  G  +DL+W   +  G VC
Sbjct: 139 EIKILALYGIGIEASRCVKCGSREDLIWFDARESGVVC 176


>gi|238762799|ref|ZP_04623768.1| DNA repair protein recO [Yersinia kristensenii ATCC 33638]
 gi|238699104|gb|EEP91852.1| DNA repair protein recO [Yersinia kristensenii ATCC 33638]
          Length = 241

 Score = 36.6 bits (83), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 55/226 (24%), Positives = 92/226 (40%), Gaps = 25/226 (11%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNWRS 60
           WQ  A +L  R Y E +++L++ T   GR     +  +  R  ++  LQ    + V W  
Sbjct: 4   WQR-AFVLHGRPYSETSLMLDLFTEGEGRMRVLAKGARGRRSNLKGCLQPFTPLLVRWTG 62

Query: 61  RLAQNLGEFRFEVLES----HCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELY-DMLN 115
           R     GE +   L S      A  L+ S+   GL     L R L  +     L+ D L+
Sbjct: 63  R-----GEVK--TLRSAEPVSLALPLTGSMLYSGLYVNELLARVLEHQTNYSALFFDYLH 115

Query: 116 IFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTG--VTQDLLWVSPKSGGAVCR 173
              +             Q EL +L ++G+G+D   C  +G  V+  + +   +  G +  
Sbjct: 116 CLQSLAGSDGSPEYALRQFELAILAHLGYGVDFLHCAGSGQPVSDSMTYRYREEKGFIAS 175

Query: 174 SVGLPYA---EKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKY 216
            V   Y+    ++L L        +  DAD+L++A + T   L  Y
Sbjct: 176 LVVDHYSFTGRQLLAL-----ANREFPDADTLRAAKRFTRIALKPY 216


>gi|310822251|ref|YP_003954609.1| DNA repair protein RecO [Stigmatella aurantiaca DW4/3-1]
 gi|309395323|gb|ADO72782.1| DNA repair protein RecO [Stigmatella aurantiaca DW4/3-1]
          Length = 244

 Score = 36.6 bits (83), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 37/176 (21%), Positives = 66/176 (37%), Gaps = 3/176 (1%)

Query: 5   DDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQ--SHRMQPILQAGNLVRVNWRSRL 62
           D+A++L    YGE + ++ ++TRQ+G+   F    +    R    L+    +RV+     
Sbjct: 6   DEALVLSTVDYGEADRMVTLLTRQHGKLTAFAAGARKSKRRFAGALEPFMYLRVHLVETR 65

Query: 63  AQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHK 122
              +     ++L  + A      L    L ++        + EP  EL+ +L  +L    
Sbjct: 66  GSTVRLDSTDILAGYYAARQELPLIARALYAVEMCRELTRDHEPHPELFALLEEYLVRLN 125

Query: 123 IPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQ-DLLWVSPKSGGAVCRSVGL 177
                    +  EL  L + G       C + G    +        GGAVC   G+
Sbjct: 126 AKEAGPTSLLAFELSALAHAGLMPRFDACALCGGEPGERPRFDQAHGGAVCEPCGV 181


>gi|90021694|ref|YP_527521.1| hypothetical protein Sde_2049 [Saccharophagus degradans 2-40]
 gi|89951294|gb|ABD81309.1| cell surface receptor IPT/TIG [Saccharophagus degradans 2-40]
          Length = 14609

 Score = 36.6 bits (83), Expect = 3.3,   Method: Composition-based stats.
 Identities = 24/91 (26%), Positives = 43/91 (47%), Gaps = 4/91 (4%)

Query: 1     MYWQDDAIILG----VRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRV 56
             +YW+DD II G    +R+Y +    + V +  +G + G     +   ++ +L AG+   +
Sbjct: 13917 VYWRDDGIISGGESVMRNYLDSGRCIVVDSEDFGYYWGGALPNEYFGLEEMLYAGSFGTI 13976

Query: 57    NWRSRLAQNLGEFRFEVLESHCAKLLSSSLF 87
             N    L   +GE   E  E   + + SSS +
Sbjct: 13977 NTAGSLEDEIGELEPENSEDSISPVPSSSQY 14007


>gi|113868515|ref|YP_727004.1| DNA repair protein RecO [Ralstonia eutropha H16]
 gi|113527291|emb|CAJ93636.1| combinational DNA repair protein (RecF pathway) [Ralstonia eutropha
           H16]
          Length = 297

 Score = 36.2 bits (82), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 40/164 (24%), Positives = 66/164 (40%), Gaps = 25/164 (15%)

Query: 4   QDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSH---RMQPILQAGNLVRVNWRS 60
           +    +L    Y E ++IL++ TR YGR +  V  G       ++ +LQ  + V V+W  
Sbjct: 65  EQPGFVLHAWPYRETSLILDLFTRDYGR-ISMVAKGAKRPHSALRAVLQHFHPVSVSWSG 123

Query: 61  RLAQNLGEFRFEV-------LESHCAKLLSSSLFLYGLQSIVPLFRFLPERE--PCLELY 111
           R     GE +          +       L S+ +L  L     L RF P  +  P L  +
Sbjct: 124 R-----GEVKTLTKAEWVGGMPPLAGDALLSAFYLNEL-----LMRFCPREDAHPALFRH 173

Query: 112 DMLNIFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTG 155
            +  +    H      G +    E +LL+  GF +   +C+ TG
Sbjct: 174 YLTTLTRLAHG--EQAGLVLRSFERVLLQETGFAVAFDQCLSTG 215


>gi|71274464|ref|ZP_00650752.1| Recombination protein O, RecO [Xylella fastidiosa Dixon]
 gi|71901685|ref|ZP_00683761.1| Recombination protein O, RecO [Xylella fastidiosa Ann-1]
 gi|170730566|ref|YP_001775999.1| DNA repair protein RecO [Xylella fastidiosa M12]
 gi|238687924|sp|B0U3E0|RECO_XYLFM RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|71164196|gb|EAO13910.1| Recombination protein O, RecO [Xylella fastidiosa Dixon]
 gi|71728555|gb|EAO30710.1| Recombination protein O, RecO [Xylella fastidiosa Ann-1]
 gi|167965359|gb|ACA12369.1| DNA repair protein RecO [Xylella fastidiosa M12]
          Length = 243

 Score = 36.2 bits (82), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 41/158 (25%), Positives = 67/158 (42%), Gaps = 11/158 (6%)

Query: 7   AIILGVRSYGEKNIILEVMTRQYGRHLGFVRNG----QSHRMQPILQAGNLVRVNWRSRL 62
           A +L VR + E ++++EV+T+ YGR LG +  G    +   ++  LQ    +R +   R 
Sbjct: 8   AFVLHVRPWRETSLLVEVLTQAYGR-LGLIARGVQGLKKQTLRAALQPLQWIRFSAIQR- 65

Query: 63  AQNLGEFR-FEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCH 121
              LG+ R  E L++  A  L     L        L R +P   P  ELY   +      
Sbjct: 66  -GELGQLRQAEALDT--APRLKGETMLASFYINELLLRLVPRHAPVNELYLAYSQTRERL 122

Query: 122 KIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQD 159
           +    +       E  +L+ +G G +L +C   G   D
Sbjct: 123 RTNDSLAWSLRLFERDILETLGVGFNL-ECDANGTPLD 159


>gi|219870404|ref|YP_002474779.1| DNA repair protein RecO [Haemophilus parasuis SH0165]
 gi|254764635|sp|B8F3C9|RECO_HAEPS RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|219690608|gb|ACL31831.1| recombinational DNA repair protein (RecF pathway) [Haemophilus
           parasuis SH0165]
          Length = 239

 Score = 36.2 bits (82), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 39/162 (24%), Positives = 63/162 (38%), Gaps = 11/162 (6%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNWRS 60
           WQ    +L  R Y E +++++  T  +GR     +  +  R  ++ +LQ    + + W  
Sbjct: 5   WQR-GFVLHRREYSESSLLVDFFTENHGRITLLAKGVRRPRSPLKSVLQPFTPLLLKWTG 63

Query: 61  RLAQNLGEFR-FEVLESHCAKLLSSSLFLY-GLQSIVPLFRFLPEREPCLELYD-MLNIF 117
           +     G+ +     E     L   +L LY G      L R L       EL+   L+  
Sbjct: 64  K-----GDLKTLTKAEPASLTLPMQTLALYSGFYVNEVLARVLENHTAYPELFQHYLHCM 118

Query: 118 LNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQD 159
                 P+ I  I    E   LK +G+G+D   C  TG   D
Sbjct: 119 TKLASQPNEIEPILRTFEFQTLKALGYGVDFCHCAATGKPVD 160


>gi|209695941|ref|YP_002263871.1| DNA repair protein RecO [Aliivibrio salmonicida LFI1238]
 gi|238058640|sp|B6EKM7|RECO_ALISL RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|208009894|emb|CAQ80207.1| DNA repair protein RecO (recombination protein O) [Aliivibrio
           salmonicida LFI1238]
          Length = 238

 Score = 36.2 bits (82), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 41/158 (25%), Positives = 70/158 (44%), Gaps = 23/158 (14%)

Query: 9   ILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNWRSRLAQNL 66
           +L  R Y E ++IL+V + +YGR     +  +S R  ++ +LQA   + + W  +     
Sbjct: 10  VLHRRPYSESSLILDVFSEEYGRLSIISKGARSKRSNLKGVLQAFTPLLMKWSGK----- 64

Query: 67  GEFRFEVLESHCAKLLSSSLFLYGLQSIVPLF------RFLPEREPCLELY-DMLNIF-- 117
           G  R        A+ +S ++ L G+     L+      R + +  P   L+ D L     
Sbjct: 65  GSMR----TLRQAETISLAIPLTGINLYSALYINELVVRVIEQETPYPALFLDYLTALTE 120

Query: 118 LNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTG 155
           L   K P    + F   EL LL ++G+G+D   C  +G
Sbjct: 121 LAQTKNPEPALRRF---ELALLSSLGYGVDFLHCAGSG 155


>gi|52081074|ref|YP_079865.1| DNA repair protein RecO [Bacillus licheniformis ATCC 14580]
 gi|52786454|ref|YP_092283.1| DNA repair protein RecO [Bacillus licheniformis ATCC 14580]
 gi|319644967|ref|ZP_07999200.1| DNA repair protein recO [Bacillus sp. BT1B_CT2]
 gi|81609046|sp|Q65H74|RECO_BACLD RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|52004285|gb|AAU24227.1| RecO [Bacillus licheniformis ATCC 14580]
 gi|52348956|gb|AAU41590.1| RecO [Bacillus licheniformis ATCC 14580]
 gi|317392776|gb|EFV73570.1| DNA repair protein recO [Bacillus sp. BT1B_CT2]
          Length = 256

 Score = 36.2 bits (82), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 43/181 (23%), Positives = 83/181 (45%), Gaps = 17/181 (9%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQ---SHRMQPILQAGNLVRVN 57
           M  + + I+L    YGE N I+ ++TR++G+ +G +  G    + R+  I Q    +  +
Sbjct: 1   MLTKCEGIVLRTNDYGETNKIITLLTREHGK-IGVLARGAKKPNSRLSAISQP--FLYAS 57

Query: 58  WRSRLAQNLGEF-RFEVLESHCAKLLSSSLFLYGLQSIVP--LFRFLPEREPCLELYDML 114
           +  R +  LG   + E++ES   + +   LFL    + +   + +   E++P   L+++L
Sbjct: 58  FLFRKSSGLGTLEQGEMIES--MRNIREDLFLTAYAAYIAELIDKGTEEKKPNPFLFELL 115

Query: 115 ---NIFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAV 171
                 LN    P +I  +   IE+ +L  +G   +L +CV           S +  G +
Sbjct: 116 LQSMRRLNDGTDPDIIANL---IEVKMLSVMGLYPELDECVHCKSKDGTFHFSIRDNGFI 172

Query: 172 C 172
           C
Sbjct: 173 C 173


>gi|169351080|ref|ZP_02868018.1| hypothetical protein CLOSPI_01859 [Clostridium spiroforme DSM 1552]
 gi|169292142|gb|EDS74275.1| hypothetical protein CLOSPI_01859 [Clostridium spiroforme DSM 1552]
          Length = 250

 Score = 36.2 bits (82), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 37/184 (20%), Positives = 79/184 (42%), Gaps = 31/184 (16%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQN 65
           + ++L  + Y E ++++ + T+ YG+     R  +  + +           N  +    +
Sbjct: 12  EGLVLKNKPYKESDMLVWIYTKTYGKMALIARGVKKMKSK-----------NAPACQTIS 60

Query: 66  LGEFRFEVLESHCAKLLSSSLF-------------LYGLQSIVPLFRFLPEREPCLELYD 112
           LGE+ F +     + L+  S+               Y    I  +++++ + +P  E Y+
Sbjct: 61  LGEYLF-IPRKGLSTLIKGSVIDYFVHIKEDIELEAYASYFIEYVYKYILDNDPDEECYN 119

Query: 113 MLNI---FLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGG 169
            L +   +LN    P ++  +F      +LK  G  L++ +C V G +  +  +S  SGG
Sbjct: 120 NLLLALKYLNSGYDPRLVYLLF---NAYILKATGCALEVEQCSVCGDSSHIAGISISSGG 176

Query: 170 AVCR 173
            VC+
Sbjct: 177 FVCK 180


>gi|293364584|ref|ZP_06611305.1| recombination protein O [Streptococcus oralis ATCC 35037]
 gi|307702836|ref|ZP_07639784.1| DNA repair protein RecO [Streptococcus oralis ATCC 35037]
 gi|291316842|gb|EFE57274.1| recombination protein O [Streptococcus oralis ATCC 35037]
 gi|307623516|gb|EFO02505.1| DNA repair protein RecO [Streptococcus oralis ATCC 35037]
          Length = 256

 Score = 35.8 bits (81), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 45/215 (20%), Positives = 89/215 (41%), Gaps = 32/215 (14%)

Query: 7   AIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQNL 66
            ++L  R++ E + ++++ T Q G+ + FV++    ++ P++Q   LV   +  R+  + 
Sbjct: 9   GLVLYNRNFREDDKLVKIFTEQAGKRMFFVKHAGQSKLAPVIQP--LVLARFLLRINDDG 66

Query: 67  GEFRFEVLESHCAKLLSSSLFLYGLQSIV---------------PLFRFLPEREPCLELY 111
             +  +  E      ++S LF+    + V               PLF FL      LEL 
Sbjct: 67  LSYIEDYHEVMTFPKINSDLFVMAYATYVAALADASLQDNQQDAPLFAFL---RKTLELM 123

Query: 112 DMLNIFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAV 171
           +    +        V+  IF   E+ +L   G  L+  +CV           S K G  +
Sbjct: 124 EAGIDY-------QVLTNIF---EIQILTRFGISLNFNECVFCHRVGQAFDFSFKYGACL 173

Query: 172 CRSVGLPYAEKMLVLPS--FLWKEEQTIDADSLKS 204
           C        ++  + P+  +L  + Q ID ++L++
Sbjct: 174 CPDHYHEDEKRCHLNPNIPYLLNQFQAIDFETLET 208


>gi|123441365|ref|YP_001005352.1| DNA repair protein RecO [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|166221916|sp|A1JKK5|RECO_YERE8 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|122088326|emb|CAL11117.1| DNA repair protein [Yersinia enterocolitica subsp. enterocolitica
           8081]
          Length = 241

 Score = 35.8 bits (81), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 55/226 (24%), Positives = 92/226 (40%), Gaps = 25/226 (11%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNWRS 60
           WQ  A +L  R Y E +++L++ T   GR     +  +  R  ++  LQ    + V W  
Sbjct: 4   WQR-AFVLHGRPYSETSLMLDLFTEGEGRMRVLAKGARGRRSNLKGCLQPFTPLLVRWTG 62

Query: 61  RLAQNLGEFRFEVLES----HCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELY-DMLN 115
           R     GE +   L S      A  L+ S+   GL     L R L  +     L+ D L+
Sbjct: 63  R-----GEVK--TLRSAEPVSLALPLTGSMLYSGLYVNELLSRVLEHQTNYSALFFDYLH 115

Query: 116 IFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTG--VTQDLLWVSPKSGGAVCR 173
              +             Q EL +L ++G+G+D   C  +G  V+  + +   +  G +  
Sbjct: 116 CLQSLAGSDGSPEYALRQFELAILAHLGYGVDFLHCAGSGQPVSDTMTYRYREEKGFIAS 175

Query: 174 SVGLPYA---EKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKY 216
            V   Y+    ++L L        +  DAD+L++A + T   L  Y
Sbjct: 176 LVVDHYSFTGRQLLAL-----ANREFPDADTLRAAKRFTRIALKPY 216


>gi|163802960|ref|ZP_02196847.1| DNA repair protein RecO [Vibrio sp. AND4]
 gi|159173250|gb|EDP58078.1| DNA repair protein RecO [Vibrio sp. AND4]
          Length = 243

 Score = 35.8 bits (81), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 54/226 (23%), Positives = 95/226 (42%), Gaps = 35/226 (15%)

Query: 8   IILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNWRSRLAQN 65
            +L  R Y E ++IL+V + +YGR     +  +S R  ++  LQ    + + W       
Sbjct: 13  FVLHRRPYSESSLILDVFSEEYGRVTLMAKGARSKRSNLKGALQPFTPLLLKWS------ 66

Query: 66  LGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLF------RFLPEREPCLELY-DMLNIFL 118
            G+   + L    A+ +S  L L+G+     ++      R L    P   L+ D L+   
Sbjct: 67  -GKSSMKTLRQ--AEAISLGLPLFGINLYSAMYVNELVGRVLMAEVPMPALFHDYLHALT 123

Query: 119 ----NCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTG--VTQDLLWVSPKSGG--A 170
               N +  P++      + EL LL ++G+G+D   C  TG  V  ++ +   +  G  A
Sbjct: 124 ELAQNDNPEPAL-----RRFELALLSSLGYGVDFLHCAGTGEPVDPEMTYRYREQKGFIA 178

Query: 171 VCRSVGLPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKY 216
             R   L +    L+  S    E + +  + LK+A + T   L  Y
Sbjct: 179 SVRRDNLTFLGNELIAIS----ERRFVTKEQLKAAKRFTRVALKPY 220


>gi|331265463|ref|YP_004325093.1| DNA repair protein RecO [Streptococcus oralis Uo5]
 gi|326682135|emb|CBY99751.1| DNA repair protein RecO [Streptococcus oralis Uo5]
          Length = 256

 Score = 35.8 bits (81), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 44/215 (20%), Positives = 90/215 (41%), Gaps = 32/215 (14%)

Query: 7   AIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQNL 66
            ++L  R++ E + ++++ T Q G+ + F+++    ++ P++Q   LV   +  R+  + 
Sbjct: 9   GLVLYNRNFREDDKLVKIFTEQAGKRMFFIKHAGQSKLAPVIQP--LVLARFLLRINDDG 66

Query: 67  GEFRFEVLESHCAKLLSSSLFLYGLQSIV---------------PLFRFLPEREPCLELY 111
             +  +  E      ++S LF+    + V               PLF FL   +  LEL 
Sbjct: 67  LSYIEDYHEVMTFPKINSDLFVMAYATYVAALADASLQDNQQDSPLFAFL---KKTLELM 123

Query: 112 DMLNIFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAV 171
           +    +        V+  IF   E+ +L   G  L+  +CV           S K G  +
Sbjct: 124 EAGIDY-------QVLTNIF---EIQILTRFGISLNFNECVFCHRVGQAFDFSFKYGACL 173

Query: 172 CRSVGLPYAEKMLVLPS--FLWKEEQTIDADSLKS 204
           C        ++  + P+  +L  + Q ID ++L++
Sbjct: 174 CPDHYHEDEKRCHLNPNIPYLLNQFQAIDFETLET 208


>gi|212710661|ref|ZP_03318789.1| hypothetical protein PROVALCAL_01727 [Providencia alcalifaciens DSM
           30120]
 gi|212686742|gb|EEB46270.1| hypothetical protein PROVALCAL_01727 [Providencia alcalifaciens DSM
           30120]
          Length = 241

 Score = 35.8 bits (81), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 53/238 (22%), Positives = 92/238 (38%), Gaps = 21/238 (8%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR------MQPILQAGNLVRV 56
           WQ  A +L  R Y E +++++  T   G+     +  + +R      +QP      L+R 
Sbjct: 4   WQR-AFVLHSRPYSETSLLIDFFTEGEGKIRLLAKGARRNRSPLRGCLQPFTPL--LIRW 60

Query: 57  NWRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNI 116
           + +  +   +      +       +L S L+L  L + V  F   P      +  + L +
Sbjct: 61  SGKGEIKTLINADPVSLALPLSGTVLYSGLYLNELTARVIEFG-TPYSSLFFDYLNCLQV 119

Query: 117 FLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTG--VTQDLLWVSPKSGGAVCRS 174
                + P        Q EL LL  +G+G+D   C  +G  VT  + +   +  G +   
Sbjct: 120 LAGSERTPE---SALRQFELALLSYLGYGVDFLHCAGSGEPVTDAMTYRYREEKGFIGSL 176

Query: 175 V--GLPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRE 230
           V   L +  K L        E +  DAD+LK+A + T   L  Y     +    L R+
Sbjct: 177 VIDQLTFTGKQLK----ALAEREFPDADTLKAAKRFTRIALKPYLGGKPLKSRELFRQ 230


>gi|225182108|ref|ZP_03735536.1| DNA repair protein RecO [Dethiobacter alkaliphilus AHT 1]
 gi|225167195|gb|EEG76018.1| DNA repair protein RecO [Dethiobacter alkaliphilus AHT 1]
          Length = 247

 Score = 35.8 bits (81), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 38/171 (22%), Positives = 70/171 (40%), Gaps = 1/171 (0%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRL 62
            +  AI+L  R Y E + ++ ++TR  G+     R  +  + +       L   ++  R 
Sbjct: 4   MRSPAIVLRGRDYREADRLVTLLTRDAGKVTVVARGTKKTKSKFSALVEPLTLGHFLLRR 63

Query: 63  AQNLGEF-RFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCH 121
            ++L    + E+++ + +      LF Y         R LPE EP + ++ +L   L   
Sbjct: 64  GKSLDTLIQGEIIKPYNSLRKDLLLFTYAQYFCEVCERSLPENEPAVPVFTLLLTALETL 123

Query: 122 KIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVC 172
           +  +   ++    EL LL  +GF   L  C   G        +P  GG +C
Sbjct: 124 ETEADSARVARCFELNLLDELGFRPVLDACCTCGTATGPFLFTPGHGGLLC 174


>gi|167854944|ref|ZP_02477719.1| DNA repair protein RecO [Haemophilus parasuis 29755]
 gi|167853901|gb|EDS25140.1| DNA repair protein RecO [Haemophilus parasuis 29755]
          Length = 239

 Score = 35.8 bits (81), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 39/162 (24%), Positives = 62/162 (38%), Gaps = 11/162 (6%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNWRS 60
           WQ    +L  R Y E +++++  T  +GR     +  +  R  ++ +LQ    + + W  
Sbjct: 5   WQR-GFVLHRREYSESSLLVDFFTENHGRITLLAKGVRRPRSPLKSVLQPFTPLLLKWTG 63

Query: 61  RLAQNLGEFR-FEVLESHCAKLLSSSLFLY-GLQSIVPLFRFLPEREPCLELYD-MLNIF 117
           +     G+ +     E     L   +L LY G      L R L       EL+   L   
Sbjct: 64  K-----GDLKTLTKAEPASLTLPMQTLALYSGFYVNEVLARVLENHTAYPELFQHYLQCM 118

Query: 118 LNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQD 159
                 P+ I  I    E   LK +G+G+D   C  TG   D
Sbjct: 119 TKLASQPNEIEPILRTFEFQTLKALGYGVDFCHCAATGKPVD 160


>gi|284006741|emb|CBA71998.1| DNA repair protein [Arsenophonus nasoniae]
          Length = 237

 Score = 35.8 bits (81), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 55/227 (24%), Positives = 92/227 (40%), Gaps = 27/227 (11%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNWRS 60
           WQ  A +L  R Y E +++L+  T   GR     +  +S R  ++  LQ    + + W  
Sbjct: 4   WQR-AFVLHTRPYSETSLLLDFFTENEGRIRLLAKGARSRRSNLKGCLQPFTPLLIRWGG 62

Query: 61  RLAQNLGEFR-------FEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDM 113
           +     GE +         +       +L S L++  L + V L + +P +    E    
Sbjct: 63  K-----GEMKTLRSAEPISLALPFTGTVLYSGLYVNELLARV-LAQNIPYQSLFFEYLTC 116

Query: 114 LNIFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTG--VTQDLLWVSPKSGGAV 171
           L I       P    + F   EL LL ++G+G+D   C  +G  V   + +   +  G +
Sbjct: 117 LQILAGSESTPEHALRRF---ELSLLSHLGYGVDFLHCSGSGEPVINGMTYRYREEKGFI 173

Query: 172 CRSV--GLPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKY 216
              V   L +  K   L +F  +E    D D+LK+A + T   L  Y
Sbjct: 174 ASLVIDHLSFTGKQ--LKAFACREFP--DVDTLKAAKRFTRIALKPY 216


>gi|21242080|ref|NP_641662.1| DNA repair protein RecO [Xanthomonas axonopodis pv. citri str. 306]
 gi|42559487|sp|Q8PMU8|RECO_XANAC RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|21107487|gb|AAM36198.1| DNA repair protein [Xanthomonas axonopodis pv. citri str. 306]
          Length = 240

 Score = 35.8 bits (81), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 41/146 (28%), Positives = 64/146 (43%), Gaps = 12/146 (8%)

Query: 9   ILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPI---LQAGNLVRVNWRSRLAQN 65
           +L VR++ E ++++EV+T Q+GR     R  Q  R Q +   LQ   L++ +   R    
Sbjct: 10  VLHVRAWRETSLLVEVLTEQHGRVGLLARGVQGPRKQALRAALQPLQLIQFSAVQR--GE 67

Query: 66  LGEFR-FEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLN--CHK 122
           L + R  E L++  A  L+    L G      L R  P  +P  ELY             
Sbjct: 68  LAQLRQAEALDT--APRLAGDTMLAGFYIGELLLRLAPRHDPVPELYACYAQARRHLASD 125

Query: 123 IPSVIGKIFVQIELMLLKNIGFGLDL 148
           +P   G    + E  +L+ +GF  DL
Sbjct: 126 LPLAWG--LRRFERDVLEGLGFAFDL 149


>gi|260551501|ref|ZP_05825685.1| DNA repair protein RecO [Acinetobacter sp. RUH2624]
 gi|260405495|gb|EEW98988.1| DNA repair protein RecO [Acinetobacter sp. RUH2624]
          Length = 237

 Score = 35.4 bits (80), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 37/145 (25%), Positives = 64/145 (44%), Gaps = 19/145 (13%)

Query: 13  RSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPI-LQAGNLVRVNWRSRLAQNLGEFRF 71
           R Y EK+ I+ + T++YGR  G +R     + QPI LQA     +   ++L         
Sbjct: 15  RKYREKSHIVHLFTQEYGRVDGILRQTPPPQYQPIRLQATGKSELKNFTKL--------- 65

Query: 72  EVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYD------MLNIFLNCHKIPS 125
           E+L         +    + L  IV   R  P  EP  + ++      +    L+ H+ P 
Sbjct: 66  EILNQPVFFFGDAFFAGFYLNEIV--LRLCPLEEPMPQTFEQYQLTLLQLQQLSSHENPD 123

Query: 126 V-IGKIFVQIELMLLKNIGFGLDLT 149
           + + +I  Q E +LL  +G+ +D +
Sbjct: 124 LFLRQILRQFEHILLPELGYAIDFS 148


>gi|294664537|ref|ZP_06729882.1| DNA repair protein RecO [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 10535]
 gi|292605699|gb|EFF49005.1| DNA repair protein RecO [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 10535]
          Length = 240

 Score = 35.4 bits (80), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 40/146 (27%), Positives = 65/146 (44%), Gaps = 12/146 (8%)

Query: 9   ILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPI---LQAGNLVRVNWRSRLAQN 65
           +L VR++ E ++++EV+T Q+GR     R  Q  R Q +   LQ   L++ +   R    
Sbjct: 10  VLHVRAWRETSLLVEVLTEQHGRVGLLARGVQGPRKQALRAALQPLQLIQFSAVQR--GE 67

Query: 66  LGEFR-FEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLN--CHK 122
           L + R  + L++  A  L+    L G      L R  P  +P  ELY       +     
Sbjct: 68  LAQLRQADALDT--APRLAGDTMLAGFYISELLLRLAPRNDPVPELYACYAQVRSHLASD 125

Query: 123 IPSVIGKIFVQIELMLLKNIGFGLDL 148
           +P   G    + E  +L+ +GF  DL
Sbjct: 126 LPLAWG--LRRFERDVLEGLGFAFDL 149


>gi|238897757|ref|YP_002923436.1| gap repair protein, part of RecFOR complex [Candidatus Hamiltonella
           defensa 5AT (Acyrthosiphon pisum)]
 gi|259563680|sp|C4K3Z5|RECO_HAMD5 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|229465514|gb|ACQ67288.1| gap repair protein, part of RecFOR complex [Candidatus Hamiltonella
           defensa 5AT (Acyrthosiphon pisum)]
          Length = 234

 Score = 35.4 bits (80), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 39/160 (24%), Positives = 65/160 (40%), Gaps = 13/160 (8%)

Query: 2   YWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR------MQPILQAGNLVR 55
           +W   + IL  RSY E ++IL+++T   GR     +     R      +QP      L+R
Sbjct: 4   HWHR-SFILHRRSYSETSLILDLLTENEGRISLIAKGALRPRSALKGYLQPFTPL--LLR 60

Query: 56  VNWRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLN 115
            + +S +    G     +        L S L++  L S +     LP  +     +D L+
Sbjct: 61  WSGKSAIKTLCGAEPISIAVPLTGIFLYSGLYVNELLSRL----LLPNIDYRALFFDYLD 116

Query: 116 IFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTG 155
                        +   + EL LL ++G+G+D   CV TG
Sbjct: 117 CLEALASAQDTSERALRRFELALLTHLGYGVDFLHCVETG 156


>gi|78046935|ref|YP_363110.1| DNA repair protein RecO [Xanthomonas campestris pv. vesicatoria
           str. 85-10]
 gi|325926992|ref|ZP_08188267.1| DNA replication and repair protein RecO [Xanthomonas perforans
           91-118]
 gi|90103527|sp|Q3BVV3|RECO_XANC5 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|78035365|emb|CAJ23010.1| putative DNA repair protein [Xanthomonas campestris pv. vesicatoria
           str. 85-10]
 gi|325542651|gb|EGD14118.1| DNA replication and repair protein RecO [Xanthomonas perforans
           91-118]
          Length = 240

 Score = 35.0 bits (79), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 42/147 (28%), Positives = 64/147 (43%), Gaps = 14/147 (9%)

Query: 9   ILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPI---LQAGNLVRVNWRSRLAQN 65
           +L VR++ E ++++EV+T Q+GR     R  Q  R Q +   LQ   L++ +   R    
Sbjct: 10  VLHVRAWRETSLLVEVLTEQHGRVGLLARGVQGPRKQALRAALQPLQLIQFSAVQR--GE 67

Query: 66  LGEFR-FEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLEL---YDMLNIFLNCH 121
           L + R  E L++  A  L     L G      L R  P  +P  EL   Y     +L   
Sbjct: 68  LAQLRQAEALDT--APRLVGDTMLAGFYISELLLRLAPRNDPVPELYACYAQARTYL-AS 124

Query: 122 KIPSVIGKIFVQIELMLLKNIGFGLDL 148
            +P   G    + E  +L  +GF  DL
Sbjct: 125 DLPLAWG--LRRFERDVLDGLGFAFDL 149


>gi|239501069|ref|ZP_04660379.1| DNA repair protein RecO [Acinetobacter baumannii AB900]
          Length = 237

 Score = 35.0 bits (79), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 38/143 (26%), Positives = 64/143 (44%), Gaps = 15/143 (10%)

Query: 13  RSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPI-LQAGNLVRVNWRSRLAQNLGEFRF 71
           R Y EK+ I+ + T++YGR  G +R     + QPI LQA     +   ++L         
Sbjct: 15  RKYREKSHIVHLFTQEYGRVDGILRQTPPPQYQPIRLQATGKSELKNFTKL--------- 65

Query: 72  EVLESHCAKLLSSSLFLYGLQSIV----PLFRFLPEREPCLELYDMLNIFLNCHKIPSV- 126
           E+L         +    + L  IV    PL   +P+     +L  +    L+ H+ P + 
Sbjct: 66  EILNQPVFFFGDAFFAGFYLNEIVLRLCPLEEAMPQTFEQYQLTLLQLQQLSSHENPDLF 125

Query: 127 IGKIFVQIELMLLKNIGFGLDLT 149
           + +I  Q E +LL  +G+ LD +
Sbjct: 126 LRQILRQFEHILLAELGYALDFS 148


>gi|95929740|ref|ZP_01312481.1| DNA repair protein RecO [Desulfuromonas acetoxidans DSM 684]
 gi|95134036|gb|EAT15694.1| DNA repair protein RecO [Desulfuromonas acetoxidans DSM 684]
          Length = 251

 Score = 35.0 bits (79), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 60/119 (50%), Gaps = 9/119 (7%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQ--PILQAGNLVRVNWRSRLA 63
           +AI+L    YGE + I+ ++TR +G    F RN +S R +    L   + +R+ W++R  
Sbjct: 7   EAIVLRCTDYGEADRIVTLLTRDHGICGAFARNARSSRRRFGGALHPFSRLRITWQTRRR 66

Query: 64  QNLGEF-RFEVLESH---CAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFL 118
             L +    E+L+        L   +L  YG + I+ L+   PE +   E+YD+L  FL
Sbjct: 67  GGLPQLAEVELLDGAHGLMTNLDGMALAAYGCELIMALW---PEEQAIPEVYDLLRSFL 122


>gi|319787578|ref|YP_004147053.1| DNA repair protein RecO [Pseudoxanthomonas suwonensis 11-1]
 gi|317466090|gb|ADV27822.1| DNA repair protein RecO [Pseudoxanthomonas suwonensis 11-1]
          Length = 244

 Score = 35.0 bits (79), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 36/148 (24%), Positives = 67/148 (45%), Gaps = 12/148 (8%)

Query: 7   AIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAG--NLVRVNWRSRLAQ 64
           A +L  R + E ++++EV++  +GR LG V  G     + +L+A    L  + + + LA 
Sbjct: 8   AFVLHARPWRETSLLVEVLSEGHGR-LGLVARGVGSPKRQVLRAALQPLQHIRFDAVLAG 66

Query: 65  NLGEFR-FEVLESH---CAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
            L + R  E L+S    C ++  ++ +L  L     + R  P ++P  +L+D        
Sbjct: 67  ELAQLRGAEALDSAPRLCGQVQLAAFYLNEL-----VLRLAPRQDPLPDLFDAYARTRAA 121

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDL 148
                 +     + E  LL  +G G +L
Sbjct: 122 LVEGGSLAWTLRRFERDLLGALGVGFEL 149


>gi|114567078|ref|YP_754232.1| DNA repair protein [Syntrophomonas wolfei subsp. wolfei str.
           Goettingen]
 gi|119361496|sp|Q0AWP3|RECO_SYNWW RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|114338013|gb|ABI68861.1| DNA replication and repair protein RecO [Syntrophomonas wolfei
           subsp. wolfei str. Goettingen]
          Length = 250

 Score = 35.0 bits (79), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 43/90 (47%), Gaps = 8/90 (8%)

Query: 135 ELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCR------SVGLPYAEKMLVLPS 188
           E+ LL N+G+   L  CV+ G   DL   S   GG +CR      S  +  +++ L L S
Sbjct: 136 EMNLLVNLGYSPLLDHCVLCGKKDDLKVFSLPDGGMLCRDCSYQASGAVSLSKETLALIS 195

Query: 189 FLWKEE-QTIDADSLKSAFQLT-DYFLNKY 216
            L +    T++   + +  Q   +YFL KY
Sbjct: 196 LLGRSRLATVERVRVSNKAQKELEYFLEKY 225


>gi|28899344|ref|NP_798949.1| DNA repair protein RecO [Vibrio parahaemolyticus RIMD 2210633]
 gi|260365943|ref|ZP_05778433.1| DNA repair protein RecO [Vibrio parahaemolyticus K5030]
 gi|260878965|ref|ZP_05891320.1| DNA repair protein RecO [Vibrio parahaemolyticus AN-5034]
 gi|260898318|ref|ZP_05906814.1| DNA repair protein RecO [Vibrio parahaemolyticus Peru-466]
 gi|260899639|ref|ZP_05908034.1| DNA repair protein RecO [Vibrio parahaemolyticus AQ4037]
 gi|31340321|sp|Q87LP1|RECO_VIBPA RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|28807580|dbj|BAC60833.1| DNA repair protein RecO [Vibrio parahaemolyticus RIMD 2210633]
 gi|308085237|gb|EFO34932.1| DNA repair protein RecO [Vibrio parahaemolyticus Peru-466]
 gi|308090490|gb|EFO40185.1| DNA repair protein RecO [Vibrio parahaemolyticus AN-5034]
 gi|308110552|gb|EFO48092.1| DNA repair protein RecO [Vibrio parahaemolyticus AQ4037]
 gi|308113207|gb|EFO50747.1| DNA repair protein RecO [Vibrio parahaemolyticus K5030]
 gi|328474123|gb|EGF44928.1| DNA repair protein RecO [Vibrio parahaemolyticus 10329]
          Length = 243

 Score = 35.0 bits (79), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 52/224 (23%), Positives = 90/224 (40%), Gaps = 33/224 (14%)

Query: 9   ILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNWRSRLAQNL 66
           +L  R Y E ++IL+V + +YGR     +  +S R  ++  LQ    + + W        
Sbjct: 14  VLHRRPYSESSLILDVFSEEYGRITLMAKGARSKRSNLKGALQPFTPLLLKWS------- 66

Query: 67  GEFRFEVLESHCAKLLSSSLFLYGLQSIVPLF------RFLPEREPCLELY----DMLNI 116
           G+   + L    A+ +S  L L+G+     ++      R L    P   L+      L  
Sbjct: 67  GKGSMKTLRQ--AEPISLGLPLFGINLYSAMYVNELVGRVLMAEVPMPALFHDYLHALTE 124

Query: 117 FLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTG--VTQDLLWVSPKSGG--AVC 172
              C      + +     EL LL ++G+G+D   C  TG  V  ++ +   +  G  A  
Sbjct: 125 LAQCENPEPALRR----FELALLSSMGYGVDFLHCAGTGEPVDPEMTYRYREQKGFIASV 180

Query: 173 RSVGLPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKY 216
           R   L +    L+  S    E + +  + LK+A + T   L  Y
Sbjct: 181 RRDNLTFLGNELIAIS----ERRFVTKEQLKAAKRFTRIALKPY 220


>gi|119476419|ref|ZP_01616770.1| DNA repair protein RecO [marine gamma proteobacterium HTCC2143]
 gi|119450283|gb|EAW31518.1| DNA repair protein RecO [marine gamma proteobacterium HTCC2143]
          Length = 239

 Score = 35.0 bits (79), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 39/162 (24%), Positives = 66/162 (40%), Gaps = 26/162 (16%)

Query: 7   AIILGVRSYGEKNIILEVMTRQYGRHLGFV------------RNGQSHRMQPILQAGNLV 54
           A IL  R++ + ++I++ ++  YGR  G V            R G S    P+L      
Sbjct: 8   AYILHTRNFRDSSLIVDFLSADYGRVSGVVKGVRATSKSAKQRRGLSQPFVPLL------ 61

Query: 55  RVNWRSRLAQNLGEFRFEV-LESHCAKL-LSSSLFLYGLQSIVPLFRFLPEREPCLELYD 112
            ++W  +      + +  + +E   A L L       GL     L R L + +    +Y 
Sbjct: 62  -ISWSGK-----SDLKTIIQMEPRGAPLQLQGKRLFSGLYVNELLSRLLQQDDQHTAIYT 115

Query: 113 MLNIFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVT 154
           +      C    S I  +  Q EL L++ +G+GLD T+   T
Sbjct: 116 LYEWIAKCLVGDSEIDIVLRQFELQLMEYLGYGLDFTQEAET 157


Searching..................................................done


Results from round 2




>gi|239831498|ref|ZP_04679827.1| DNA repair protein RecO [Ochrobactrum intermedium LMG 3301]
 gi|239823765|gb|EEQ95333.1| DNA repair protein RecO [Ochrobactrum intermedium LMG 3301]
          Length = 245

 Score =  347 bits (890), Expect = 1e-93,   Method: Composition-based stats.
 Identities = 106/241 (43%), Positives = 152/241 (63%), Gaps = 1/241 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D+ IILG R +GE + I+EVMTR++GRH+G VR G+S RMQP+LQ GN V V W +
Sbjct: 3   MEWRDEGIILGTRRHGETSAIVEVMTREHGRHMGMVRGGRSRRMQPLLQPGNHVDVTWWA 62

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL +++G F  E LE   A+L+ + + LYG+Q      R LPER+P   LY+ L + +  
Sbjct: 63  RLDEHMGSFTIEPLEFAAARLIETPVALYGIQLAASHLRLLPERDPHRGLYETLRLIIEH 122

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P   G++ ++ E+M+L+ +GFGLDL +C  TGV +DL++VSPKSG AVCR VG P+A
Sbjct: 123 FDDPLASGELVLRFEVMMLEELGFGLDLKECAATGVKEDLIYVSPKSGRAVCREVGAPWA 182

Query: 181 EKMLVLPSFLWKEE-QTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLEL 239
           +K+L+LP F+     +    D +  AF +T YFL ++  +   I     R  FL  L   
Sbjct: 183 DKLLLLPGFVNNTAVRAASYDDIDHAFTMTGYFLMRHVWEPRAITPPDARGGFLNALGRA 242

Query: 240 I 240
           I
Sbjct: 243 I 243


>gi|153009952|ref|YP_001371167.1| DNA repair protein RecO [Ochrobactrum anthropi ATCC 49188]
 gi|151561840|gb|ABS15338.1| DNA repair protein RecO [Ochrobactrum anthropi ATCC 49188]
          Length = 243

 Score =  346 bits (889), Expect = 1e-93,   Method: Composition-based stats.
 Identities = 105/241 (43%), Positives = 151/241 (62%), Gaps = 1/241 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D+ IILG R +GE + I+EVMTR++GRH+G VR G+S RMQP+LQ GN V V W +
Sbjct: 1   MEWRDEGIILGTRRHGETSAIVEVMTREHGRHMGMVRGGRSRRMQPLLQPGNHVDVTWWA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL +++G F  E LE   A+L+ + + LYG+Q      R LPER+P   LY+ L + +  
Sbjct: 61  RLDEHMGSFTIEPLEFAAARLIETPVALYGIQLAASHLRLLPERDPHRGLYETLRLIIEH 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P   G++ ++ E+M+L+ +GFGLDL KC  TGV +DL++VSPKSG AVCR  G P+A
Sbjct: 121 FDDPLASGELVLRFEVMMLEELGFGLDLKKCAATGVKEDLIYVSPKSGRAVCRDAGAPWA 180

Query: 181 EKMLVLPSFLWKEE-QTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLEL 239
           +K+L+LP F+     +    D +  AF +T YFL ++  +   +     R  FL  L   
Sbjct: 181 DKLLLLPGFVNNTAVRASSYDDIDHAFTMTGYFLMRHVWEPRAVTPPDARGGFLNALGRA 240

Query: 240 I 240
           I
Sbjct: 241 I 241


>gi|86357032|ref|YP_468924.1| DNA repair protein RecO [Rhizobium etli CFN 42]
 gi|119361475|sp|Q2KAD9|RECO_RHIEC RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|86281134|gb|ABC90197.1| DNA repair protein [Rhizobium etli CFN 42]
          Length = 256

 Score =  345 bits (887), Expect = 2e-93,   Method: Composition-based stats.
 Identities = 113/241 (46%), Positives = 161/241 (66%), Gaps = 1/241 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M WQD AIILGV+ +GE ++I EVMTR  GRHLG VR+G+S  M+P+LQ GN V V WR+
Sbjct: 1   MQWQDQAIILGVKRHGETSVIAEVMTRGRGRHLGLVRSGRSRAMRPVLQPGNAVEVVWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LGEFR E +    A+L+ ++  +YG+Q++  L R LPER+P   L+D L + L+ 
Sbjct: 61  RLDEHLGEFRVEPVTLRAARLMDTATAVYGVQAMGALLRLLPERDPHPHLFDALEVILDH 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P+  G++FV+ EL +L ++GFGLDL +C  TG   DL +VSPKSG AV RS G P+A
Sbjct: 121 LHNPADAGELFVRFELAVLNDLGFGLDLAECAATGARSDLAYVSPKSGRAVSRSAGAPWA 180

Query: 181 EKMLVLPSFL-WKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLEL 239
           +KML+LP FL  +     D DSL +AF+LT +FL+++  +   I     R+ F+   L+ 
Sbjct: 181 DKMLLLPPFLGVEGNHAADVDSLAAAFRLTGFFLHRHVYEPRGIEAVAARDGFVQAALKA 240

Query: 240 I 240
           +
Sbjct: 241 L 241


>gi|218461899|ref|ZP_03501990.1| DNA repair protein RecO [Rhizobium etli Kim 5]
          Length = 256

 Score =  345 bits (885), Expect = 4e-93,   Method: Composition-based stats.
 Identities = 113/241 (46%), Positives = 161/241 (66%), Gaps = 1/241 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M WQD AIILGV+ +GE ++I+EVMTR  GRHLG VR+G+S  MQP+LQ GN V V WR+
Sbjct: 1   MQWQDHAIILGVKRHGETSVIVEVMTRDRGRHLGLVRSGRSRAMQPVLQPGNAVEVIWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LGEFR E +    A+L+ ++  +YG+Q++  L R LPER+P   L+D L + L+ 
Sbjct: 61  RLDEHLGEFRVEPVTLRAARLMETATAVYGVQAMGALLRLLPERDPHPHLFDALEVILDH 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P+  G++FV+ EL +L ++GFGLDL +C  TG   DL +VSPKSG AV RS G P+A
Sbjct: 121 LHNPADAGELFVRFELAVLNDLGFGLDLAECAATGARSDLAYVSPKSGRAVSRSAGAPWA 180

Query: 181 EKMLVLPSFL-WKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLEL 239
           +KML+LP FL        D DSL +AF+LT +FL+++  +   +     R+ F+   L+ 
Sbjct: 181 DKMLLLPPFLGVDGNHAADFDSLAAAFRLTGFFLHRHVYEPRGMEASAARDGFVQAALKA 240

Query: 240 I 240
           +
Sbjct: 241 L 241


>gi|327191326|gb|EGE58359.1| DNA repair protein (recombination protein O) [Rhizobium etli
           CNPAF512]
          Length = 281

 Score =  344 bits (882), Expect = 8e-93,   Method: Composition-based stats.
 Identities = 112/241 (46%), Positives = 161/241 (66%), Gaps = 1/241 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M WQD AIILG++ +GE ++I EVMTR  GRHLG VR+G+S  MQP+LQ GN V V WR+
Sbjct: 26  MQWQDHAIILGIKRHGETSVIAEVMTRDRGRHLGLVRSGRSRAMQPVLQPGNAVEVIWRA 85

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LGEFR E +    A+L+ ++  +YG+Q++  L R LPER+P   L+D L + L+ 
Sbjct: 86  RLDEHLGEFRVEPVTLRAARLMETATAVYGVQAMGALLRLLPERDPHPHLFDALEVILDH 145

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P+  G++FV+ EL +L ++GFGLDL +C  TG   DL +VSPKSG AV RS G P+A
Sbjct: 146 LHNPADAGELFVRFELAVLNDLGFGLDLGECAATGARSDLAYVSPKSGRAVSRSAGAPWA 205

Query: 181 EKMLVLPSFL-WKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLEL 239
           +KML+LP FL  +     D DSL +AF+LT +FL+++  +   +     R+ F+   L+ 
Sbjct: 206 DKMLLLPPFLGVEGNHAADFDSLAAAFRLTGFFLHRHVYEPRGMEAAAARDGFVQAALKA 265

Query: 240 I 240
           +
Sbjct: 266 L 266


>gi|241203893|ref|YP_002974989.1| DNA repair protein RecO [Rhizobium leguminosarum bv. trifolii
           WSM1325]
 gi|240857783|gb|ACS55450.1| DNA repair protein RecO [Rhizobium leguminosarum bv. trifolii
           WSM1325]
          Length = 256

 Score =  342 bits (878), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 113/241 (46%), Positives = 164/241 (68%), Gaps = 1/241 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M WQD AIILGV+ +GE ++I+EVMTR  GRHLG VR+G+S  MQP+LQAGN V V WR+
Sbjct: 1   MQWQDHAIILGVKRHGETSVIVEVMTRDRGRHLGLVRSGRSRAMQPVLQAGNAVEVIWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LGEFR E +    A+L+ ++  +YG+Q++  L R LPER+P   L+D L + L+ 
Sbjct: 61  RLDEHLGEFRVEPVTLRAARLMETATAVYGVQAMGALLRLLPERDPHPHLFDALEVILDH 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P+  G++FV+ EL +L ++GFGLDL +C  TG   DL++VSPKSG AV R+ G P+A
Sbjct: 121 LHNPADAGELFVRFELAVLNDLGFGLDLAECAATGARSDLVYVSPKSGRAVSRAAGAPWA 180

Query: 181 EKMLVLPSFL-WKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLEL 239
           +KML+LP FL  +     D +SL +AF+LT +FL+++  +   I     R+ F+   L+ 
Sbjct: 181 DKMLLLPPFLRIEGNHAADFESLSAAFRLTGFFLHRHVYEPRGIEAVAARDGFVQAALKA 240

Query: 240 I 240
           +
Sbjct: 241 L 241


>gi|254780948|ref|YP_003065361.1| DNA repair protein RecO [Candidatus Liberibacter asiaticus str.
           psy62]
 gi|254040625|gb|ACT57421.1| DNA repair protein RecO [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 240

 Score =  342 bits (878), Expect = 3e-92,   Method: Composition-based stats.
 Identities = 240/240 (100%), Positives = 240/240 (100%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS
Sbjct: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC
Sbjct: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
           HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA
Sbjct: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180

Query: 181 EKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLELI 240
           EKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLELI
Sbjct: 181 EKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLELI 240


>gi|116251281|ref|YP_767119.1| DNA repair protein RecO [Rhizobium leguminosarum bv. viciae 3841]
 gi|119361476|sp|Q1MJ50|RECO_RHIL3 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|115255929|emb|CAK07010.1| putative DNA repair protein (recombination protein O) [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 256

 Score =  341 bits (875), Expect = 6e-92,   Method: Composition-based stats.
 Identities = 114/241 (47%), Positives = 163/241 (67%), Gaps = 1/241 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M WQD AIILGV+ +GE ++I EVMTR  GRHLG VR+G+S  MQP+LQAGN V V WR+
Sbjct: 1   MQWQDHAIILGVKRHGETSVIAEVMTRDRGRHLGLVRSGRSRAMQPVLQAGNAVEVIWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LGEFR E +    A+L+ ++  +YG+Q++  L R LPER+P   L+D L + L+ 
Sbjct: 61  RLDEHLGEFRVEPVTLRAARLMETATAVYGVQAMGALLRLLPERDPHPHLFDALEVILDH 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P+  G++FV+ EL +L ++GFGLDL +C  TG   DL++VSPKSG AV R+ G P+A
Sbjct: 121 LHNPADAGELFVRFELAVLNDLGFGLDLAECAATGARSDLVYVSPKSGRAVSRAAGAPWA 180

Query: 181 EKMLVLPSFL-WKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLEL 239
           +KML+LP FL  +     D DSL +AF+LT +FL+++  +   I     R+ F+   L+ 
Sbjct: 181 DKMLLLPPFLSIEGNHAADFDSLSAAFRLTGFFLHRHVYEPRGIEAVAARDGFVQAALKA 240

Query: 240 I 240
           +
Sbjct: 241 L 241


>gi|209548606|ref|YP_002280523.1| DNA repair protein RecO [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|238058646|sp|B5ZW78|RECO_RHILW RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|209534362|gb|ACI54297.1| DNA repair protein RecO [Rhizobium leguminosarum bv. trifolii
           WSM2304]
          Length = 256

 Score =  340 bits (874), Expect = 6e-92,   Method: Composition-based stats.
 Identities = 115/241 (47%), Positives = 162/241 (67%), Gaps = 1/241 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M WQD AIILGV+ +GE ++I EVMTR  GRHLG VR+G+S  MQP+LQAGN V V WR+
Sbjct: 1   MQWQDHAIILGVKRHGETSVIAEVMTRDRGRHLGLVRSGRSRAMQPVLQAGNAVEVIWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LGEFR E +    A+L+ ++  +YG+Q++  L R LPER+P   L+D L + L+ 
Sbjct: 61  RLDEHLGEFRVEPVTLRAARLMETATAVYGVQAMGALLRLLPERDPHPHLFDALEVILDH 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P+  G++FV+ EL +L ++GFGLDL +C  TG   DL +VSPKSG AV RS G P+A
Sbjct: 121 LHNPADAGELFVRFELAVLNDLGFGLDLAECAATGARSDLAYVSPKSGRAVSRSAGAPWA 180

Query: 181 EKMLVLPSFL-WKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLEL 239
           +KML+LP FL  +     D DSL +AF+LT +FL+++  +   I     R+ F+   L+ 
Sbjct: 181 DKMLLLPPFLGIEGNHAADFDSLSAAFRLTGFFLHRHVYEPRGIEAAAARDGFVQAALKA 240

Query: 240 I 240
           +
Sbjct: 241 L 241


>gi|222085393|ref|YP_002543923.1| DNA repair protein RecO [Agrobacterium radiobacter K84]
 gi|254790503|sp|B9JC76|RECO_AGRRK RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|221722841|gb|ACM25997.1| DNA repair protein RecO [Agrobacterium radiobacter K84]
          Length = 259

 Score =  340 bits (872), Expect = 1e-91,   Method: Composition-based stats.
 Identities = 113/241 (46%), Positives = 161/241 (66%), Gaps = 1/241 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M WQD AIILGV+  GE ++I EVMTR  GRH+G VR+G+S  MQP+LQ GNLV V WR+
Sbjct: 1   MQWQDHAIILGVKRLGETSVIAEVMTRDRGRHMGLVRSGRSRSMQPVLQPGNLVEVTWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LGEFR E +    A+L+ ++  +YG+Q++  L R LPER+P   LYD L++ L  
Sbjct: 61  RLHEHLGEFRMEPVRLRAARLMETATAVYGVQAMGALLRLLPERDPHPYLYDALDVILEN 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
            + P   G++FV+ EL +L  +G+GLDL +C  TGV  DL +VSPK+G AVCR+ G P+A
Sbjct: 121 MQNPMDAGELFVRFELAVLNELGYGLDLGECAATGVRDDLAFVSPKTGRAVCRTAGAPWA 180

Query: 181 EKMLVLPSFL-WKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLEL 239
           +KML LP FL     +  + +SL +AF+LT +FL+++  +   I     RE F+   L+ 
Sbjct: 181 DKMLALPPFLAAGTVEAANGESLAAAFRLTGFFLHRHVYEPRGIEIAAAREGFIQAALKA 240

Query: 240 I 240
           +
Sbjct: 241 V 241


>gi|190891077|ref|YP_001977619.1| DNA repair protein (recombination protein O) [Rhizobium etli CIAT
           652]
 gi|238692513|sp|B3PUP2|RECO_RHIE6 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|190696356|gb|ACE90441.1| DNA repair protein (recombination protein O) [Rhizobium etli CIAT
           652]
          Length = 256

 Score =  340 bits (872), Expect = 1e-91,   Method: Composition-based stats.
 Identities = 112/241 (46%), Positives = 161/241 (66%), Gaps = 1/241 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M WQD AIILG++ +GE ++I EVMTR  GRHLG VR+G+S  MQP+LQ GN V V WR+
Sbjct: 1   MQWQDHAIILGIKRHGETSVIAEVMTRDRGRHLGLVRSGRSRAMQPVLQPGNAVEVIWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LGEFR E +    A+L+ ++  +YG+Q++  L R LPER+P   L+D L + L+ 
Sbjct: 61  RLDEHLGEFRVEPVTLRAARLMETATAVYGVQAMGALLRLLPERDPHPHLFDALEVILDH 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P+  G++FV+ EL +L ++GFGLDL +C  TG   DL +VSPKSG AV RS G P+A
Sbjct: 121 LHNPADAGELFVRFELAVLNDLGFGLDLGECAATGARSDLAYVSPKSGRAVSRSAGAPWA 180

Query: 181 EKMLVLPSFL-WKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLEL 239
           +KML+LP FL  +     D DSL +AF+LT +FL+++  +   +     R+ F+   L+ 
Sbjct: 181 DKMLLLPPFLGVEGNHAADFDSLAAAFRLTGFFLHRHVYEPRGMEAAAARDGFVQAALKA 240

Query: 240 I 240
           +
Sbjct: 241 L 241


>gi|20139557|sp|Q92KH5|RECO_RHIME RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
          Length = 247

 Score =  339 bits (871), Expect = 2e-91,   Method: Composition-based stats.
 Identities = 110/240 (45%), Positives = 164/240 (68%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W D+AIILG+R +GE ++I EVMT  +GRHLG VR+G+S  MQP+LQ GN V V+WR+
Sbjct: 1   MQWSDEAIILGIRRHGESSVIAEVMTPGHGRHLGLVRSGRSRTMQPVLQPGNSVEVSWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LGEFR E L+   A L+ ++  +YG+Q++  L R LPER+P   LY+ L + ++ 
Sbjct: 61  RLDEHLGEFRVEPLQLRAASLIETATSVYGIQALGALLRLLPERDPHPHLYEALAVIVDH 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
            + P+  G++FV+ EL +L ++GFGLDL++C  TG   +L++VSPKSG A+CR  G PYA
Sbjct: 121 LQDPADAGELFVRFELAVLNDLGFGLDLSRCGATGARSELVYVSPKSGRAICREAGAPYA 180

Query: 181 EKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLELI 240
           ++ML LP FL    +  D +SL +AF+LT YFLN++  +   +     R+ F+   L+ +
Sbjct: 181 DRMLALPDFLSGGSRAADHESLAAAFRLTAYFLNRHVYEPRGVDAASARDGFVHATLKAL 240


>gi|163760593|ref|ZP_02167674.1| DNA repair protein [Hoeflea phototrophica DFL-43]
 gi|162282208|gb|EDQ32498.1| DNA repair protein [Hoeflea phototrophica DFL-43]
          Length = 256

 Score =  339 bits (871), Expect = 2e-91,   Method: Composition-based stats.
 Identities = 101/241 (41%), Positives = 160/241 (66%), Gaps = 1/241 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D+ IILG+R +GE ++I EVMT  +GRH+G VR G+S R+QP+LQ GN V + WR+
Sbjct: 1   MEWRDEGIILGLRKHGETSVIAEVMTHAHGRHMGIVRGGRSKRLQPVLQPGNSVDLVWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG+++ E++ +   +L+ S++ ++G+Q++  L R LPER+    L+D   + L+ 
Sbjct: 61  RLDEHLGQYQVELINARAGRLMQSAIGVHGVQAMAALLRLLPERDSHPRLHDAFAVILDS 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P   G ++V+ EL +L+++GFGLDLT C  TG ++DL++VSPKSG AV  + G P+A
Sbjct: 121 FDAPEEAGALYVRFELAVLEDLGFGLDLTACAATGASEDLVYVSPKSGRAVSAAAGAPWA 180

Query: 181 EKMLVLPSFLWKEEQTI-DADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLEL 239
           E+ML LP+FL    Q   DA  L   F+L+ YFL+++  +   I   + RE+F    L+ 
Sbjct: 181 ERMLALPAFLADRSQACGDAQMLAHGFKLSGYFLDRHVFEPRGIEAPISRESFCTAALKA 240

Query: 240 I 240
           +
Sbjct: 241 M 241


>gi|307320728|ref|ZP_07600140.1| DNA repair protein RecO [Sinorhizobium meliloti AK83]
 gi|306893655|gb|EFN24429.1| DNA repair protein RecO [Sinorhizobium meliloti AK83]
          Length = 259

 Score =  339 bits (871), Expect = 2e-91,   Method: Composition-based stats.
 Identities = 110/240 (45%), Positives = 165/240 (68%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W D+AIILG+R +GE ++I EVMT  +GRHLG VR+G+S  MQP+LQ GN V V+WR+
Sbjct: 13  MQWSDEAIILGIRRHGESSVIAEVMTPGHGRHLGLVRSGRSRTMQPVLQPGNSVEVSWRA 72

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LGEFR E L+   A+L+ ++  +YG+Q++  L R LPER+P   LY+ L + ++ 
Sbjct: 73  RLDEHLGEFRVEPLQLRAARLIETATSVYGIQALGALLRLLPERDPHPHLYEALAVIVDH 132

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
            + P+  G++FV+ EL +L ++GFGLDL++C  TG   +L++VSPKSG A+CR  G PYA
Sbjct: 133 LQDPADAGELFVRFELAVLNDLGFGLDLSRCGATGARSELVYVSPKSGRAICREAGAPYA 192

Query: 181 EKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLELI 240
           ++ML LP FL    +  D +SL +AF+LT YFLN++  +   +     R+ F+   L+ +
Sbjct: 193 DRMLALPDFLSGGSRAADHESLAAAFRLTAYFLNRHVYEPRGVDAASARDGFVHATLKAL 252


>gi|254718804|ref|ZP_05180615.1| DNA repair protein RecO [Brucella sp. 83/13]
 gi|265983786|ref|ZP_06096521.1| DNA repair protein recO [Brucella sp. 83/13]
 gi|264662378|gb|EEZ32639.1| DNA repair protein recO [Brucella sp. 83/13]
          Length = 247

 Score =  339 bits (871), Expect = 2e-91,   Method: Composition-based stats.
 Identities = 101/241 (41%), Positives = 146/241 (60%), Gaps = 1/241 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D+ +ILG R +GE + I+EVMT  +GRH+G VR G+S RMQP+LQ GN V V+W +
Sbjct: 1   MEWRDEGVILGTRRHGETSAIVEVMTCGHGRHMGMVRGGRSRRMQPLLQPGNHVDVSWWA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL +++G F  E L    A+L+ + + LYG+Q      R LPER+P   LY+ L + +  
Sbjct: 61  RLDEHMGTFTIEPLGFAAARLIETPVALYGIQLAAAHLRLLPERDPHRGLYETLRLIIEH 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P   G++ ++ E+M+L+ +GFGLDL +C  TG   DL++VSPKSG AVCR  G P+A
Sbjct: 121 FDDPLAAGELLLRFEVMMLEELGFGLDLKECAATGRKDDLIYVSPKSGRAVCREAGAPWA 180

Query: 181 EKMLVLPSFLWKEE-QTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLEL 239
           +K+L LPSF+     +    D L  AF +T YFL ++  +         R  FL  +   
Sbjct: 181 DKLLALPSFVNDTALRASCYDDLDRAFTMTGYFLMRHVWEPRAQTPPDSRSGFLNAVGRA 240

Query: 240 I 240
           I
Sbjct: 241 I 241


>gi|218509904|ref|ZP_03507782.1| DNA repair protein RecO [Rhizobium etli Brasil 5]
          Length = 245

 Score =  339 bits (870), Expect = 2e-91,   Method: Composition-based stats.
 Identities = 112/241 (46%), Positives = 161/241 (66%), Gaps = 1/241 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M WQD AIILG++ +GE ++I EVMTR  GRHLG VR+G+S  MQP+LQ GN V V WR+
Sbjct: 1   MQWQDHAIILGIKRHGETSVIAEVMTRDRGRHLGLVRSGRSRAMQPVLQPGNAVEVIWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LGEFR E +    A+L+ ++  +YG+Q++  L R LPER+P   L+D L + L+ 
Sbjct: 61  RLDEHLGEFRVEPVTLRAARLMETATAVYGVQAMGALLRLLPERDPHPHLFDALEVILDH 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P+  G++FV+ EL +L ++GFGLDL +C  TG   DL +VSPKSG AV RS G P+A
Sbjct: 121 LHNPADAGELFVRFELAVLNDLGFGLDLGECAATGARSDLAYVSPKSGRAVSRSAGAPWA 180

Query: 181 EKMLVLPSFL-WKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLEL 239
           +KML+LP FL  +     D DSL +AF+LT +FL+++  +   +     R+ F+   L+ 
Sbjct: 181 DKMLLLPPFLGVEGNHAADFDSLAAAFRLTGFFLHRHVYEPRGMEAAAARDGFVQAALKA 240

Query: 240 I 240
           +
Sbjct: 241 L 241


>gi|195970186|ref|NP_385194.3| DNA repair protein RecO [Sinorhizobium meliloti 1021]
 gi|307300911|ref|ZP_07580680.1| DNA repair protein RecO [Sinorhizobium meliloti BL225C]
 gi|15074020|emb|CAC45667.1| Recombinational DNA repair protein (RecF pathway) [Sinorhizobium
           meliloti 1021]
 gi|306903866|gb|EFN34452.1| DNA repair protein RecO [Sinorhizobium meliloti BL225C]
          Length = 259

 Score =  339 bits (870), Expect = 2e-91,   Method: Composition-based stats.
 Identities = 110/240 (45%), Positives = 164/240 (68%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W D+AIILG+R +GE ++I EVMT  +GRHLG VR+G+S  MQP+LQ GN V V+WR+
Sbjct: 13  MQWSDEAIILGIRRHGESSVIAEVMTPGHGRHLGLVRSGRSRTMQPVLQPGNSVEVSWRA 72

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LGEFR E L+   A L+ ++  +YG+Q++  L R LPER+P   LY+ L + ++ 
Sbjct: 73  RLDEHLGEFRVEPLQLRAASLIETATSVYGIQALGALLRLLPERDPHPHLYEALAVIVDH 132

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
            + P+  G++FV+ EL +L ++GFGLDL++C  TG   +L++VSPKSG A+CR  G PYA
Sbjct: 133 LQDPADAGELFVRFELAVLNDLGFGLDLSRCGATGARSELVYVSPKSGRAICREAGAPYA 192

Query: 181 EKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLELI 240
           ++ML LP FL    +  D +SL +AF+LT YFLN++  +   +     R+ F+   L+ +
Sbjct: 193 DRMLALPDFLSGGSRAADHESLAAAFRLTAYFLNRHVYEPRGVDAASARDGFVHATLKAL 252


>gi|163842935|ref|YP_001627339.1| DNA repair protein RecO [Brucella suis ATCC 23445]
 gi|163673658|gb|ABY37769.1| DNA repair protein RecO [Brucella suis ATCC 23445]
          Length = 247

 Score =  339 bits (869), Expect = 3e-91,   Method: Composition-based stats.
 Identities = 102/241 (42%), Positives = 146/241 (60%), Gaps = 1/241 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D+ +ILG R +GE + I+EVMT  +GRH+G VR G+S RMQP+LQ GN V V+W +
Sbjct: 1   MEWRDEGVILGTRRHGETSAIVEVMTCGHGRHMGMVRGGRSRRMQPLLQPGNHVDVSWWA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL +++G F  E L    A+L+ + + LYG+Q      R LPER+P   LY+ L + +  
Sbjct: 61  RLDEHMGTFTIEPLSFAAARLIETPVALYGIQLAAAHLRLLPERDPHRGLYETLRLIIEH 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P   G++ ++ E+M+L+ +GFGLDL +C  TG   DL++VSPKSG AVCR  G P+A
Sbjct: 121 FDDPLAAGELLLRFEVMMLEELGFGLDLKECAATGRKDDLIYVSPKSGRAVCREAGAPWA 180

Query: 181 EKMLVLPSFLWKEE-QTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLEL 239
           EK+L LPSF+     +    D L  AF +T YFL ++  +         R  FL  +   
Sbjct: 181 EKLLSLPSFVNDTALRASCYDDLDRAFTMTGYFLMRHVWEPRAQTPPDSRSGFLNAVGRA 240

Query: 240 I 240
           I
Sbjct: 241 I 241


>gi|23501551|ref|NP_697678.1| DNA repair protein RecO [Brucella suis 1330]
 gi|62289624|ref|YP_221417.1| DNA repair protein RecO [Brucella abortus bv. 1 str. 9-941]
 gi|82699552|ref|YP_414126.1| DNA repair protein RecO [Brucella melitensis biovar Abortus 2308]
 gi|148559418|ref|YP_001258648.1| DNA repair protein RecO [Brucella ovis ATCC 25840]
 gi|161618634|ref|YP_001592521.1| DNA repair protein RecO [Brucella canis ATCC 23365]
 gi|189023877|ref|YP_001934645.1| DNA repair protein RecO [Brucella abortus S19]
 gi|225852185|ref|YP_002732418.1| DNA repair protein RecO [Brucella melitensis ATCC 23457]
 gi|237815119|ref|ZP_04594117.1| DNA repair protein RecO [Brucella abortus str. 2308 A]
 gi|254688939|ref|ZP_05152193.1| DNA repair protein RecO [Brucella abortus bv. 6 str. 870]
 gi|254693421|ref|ZP_05155249.1| DNA repair protein RecO [Brucella abortus bv. 3 str. Tulya]
 gi|254697074|ref|ZP_05158902.1| DNA repair protein RecO [Brucella abortus bv. 2 str. 86/8/59]
 gi|254701451|ref|ZP_05163279.1| DNA repair protein RecO [Brucella suis bv. 5 str. 513]
 gi|254703997|ref|ZP_05165825.1| DNA repair protein RecO [Brucella suis bv. 3 str. 686]
 gi|254707629|ref|ZP_05169457.1| DNA repair protein RecO [Brucella pinnipedialis M163/99/10]
 gi|254709789|ref|ZP_05171600.1| DNA repair protein RecO [Brucella pinnipedialis B2/94]
 gi|254713791|ref|ZP_05175602.1| DNA repair protein RecO [Brucella ceti M644/93/1]
 gi|254717152|ref|ZP_05178963.1| DNA repair protein RecO [Brucella ceti M13/05/1]
 gi|254729970|ref|ZP_05188548.1| DNA repair protein RecO [Brucella abortus bv. 4 str. 292]
 gi|256031279|ref|ZP_05444893.1| DNA repair protein RecO [Brucella pinnipedialis M292/94/1]
 gi|256060791|ref|ZP_05450953.1| DNA repair protein RecO [Brucella neotomae 5K33]
 gi|256113203|ref|ZP_05454071.1| DNA repair protein RecO [Brucella melitensis bv. 3 str. Ether]
 gi|256257187|ref|ZP_05462723.1| DNA repair protein RecO [Brucella abortus bv. 9 str. C68]
 gi|256264305|ref|ZP_05466837.1| recombination protein O [Brucella melitensis bv. 2 str. 63/9]
 gi|256369101|ref|YP_003106609.1| DNA repair protein RecO [Brucella microti CCM 4915]
 gi|260545621|ref|ZP_05821362.1| recombination protein O [Brucella abortus NCTC 8038]
 gi|260566756|ref|ZP_05837226.1| recombination protein O [Brucella suis bv. 4 str. 40]
 gi|260754426|ref|ZP_05866774.1| DNA repair protein recO [Brucella abortus bv. 6 str. 870]
 gi|260757645|ref|ZP_05869993.1| DNA repair protein recO [Brucella abortus bv. 4 str. 292]
 gi|260761472|ref|ZP_05873815.1| DNA repair protein recO [Brucella abortus bv. 2 str. 86/8/59]
 gi|260883454|ref|ZP_05895068.1| DNA repair protein recO [Brucella abortus bv. 9 str. C68]
 gi|261213672|ref|ZP_05927953.1| DNA repair protein recO [Brucella abortus bv. 3 str. Tulya]
 gi|261218967|ref|ZP_05933248.1| DNA repair protein recO [Brucella ceti M13/05/1]
 gi|261315121|ref|ZP_05954318.1| DNA repair protein recO [Brucella pinnipedialis M163/99/10]
 gi|261317324|ref|ZP_05956521.1| DNA repair protein recO [Brucella pinnipedialis B2/94]
 gi|261321534|ref|ZP_05960731.1| DNA repair protein recO [Brucella ceti M644/93/1]
 gi|261324782|ref|ZP_05963979.1| DNA repair protein recO [Brucella neotomae 5K33]
 gi|261751991|ref|ZP_05995700.1| DNA repair protein recO [Brucella suis bv. 5 str. 513]
 gi|261754650|ref|ZP_05998359.1| DNA repair protein recO [Brucella suis bv. 3 str. 686]
 gi|265988362|ref|ZP_06100919.1| DNA repair protein recO [Brucella pinnipedialis M292/94/1]
 gi|265994611|ref|ZP_06107168.1| DNA repair protein recO [Brucella melitensis bv. 3 str. Ether]
 gi|297248035|ref|ZP_06931753.1| DNA repair protein RecO [Brucella abortus bv. 5 str. B3196]
 gi|38258601|sp|Q8G1P8|RECO_BRUSU RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|75497079|sp|Q57E78|RECO_BRUAB RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|119361447|sp|Q2YMZ9|RECO_BRUA2 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|23347462|gb|AAN29593.1| DNA repair protein RecO, putative [Brucella suis 1330]
 gi|62195756|gb|AAX74056.1| putatiave DNA repair protein RecO [Brucella abortus bv. 1 str.
           9-941]
 gi|82615653|emb|CAJ10640.1| Cytochrome P450:Recombination protein O, RecO [Brucella melitensis
           biovar Abortus 2308]
 gi|148370675|gb|ABQ60654.1| DNA repair protein RecO [Brucella ovis ATCC 25840]
 gi|161335445|gb|ABX61750.1| DNA repair protein RecO [Brucella canis ATCC 23365]
 gi|189019449|gb|ACD72171.1| Recombination protein O, RecO [Brucella abortus S19]
 gi|225640550|gb|ACO00464.1| DNA repair protein RecO [Brucella melitensis ATCC 23457]
 gi|237789956|gb|EEP64166.1| DNA repair protein RecO [Brucella abortus str. 2308 A]
 gi|255999261|gb|ACU47660.1| DNA repair protein RecO [Brucella microti CCM 4915]
 gi|260097028|gb|EEW80903.1| recombination protein O [Brucella abortus NCTC 8038]
 gi|260156274|gb|EEW91354.1| recombination protein O [Brucella suis bv. 4 str. 40]
 gi|260667963|gb|EEX54903.1| DNA repair protein recO [Brucella abortus bv. 4 str. 292]
 gi|260671904|gb|EEX58725.1| DNA repair protein recO [Brucella abortus bv. 2 str. 86/8/59]
 gi|260674534|gb|EEX61355.1| DNA repair protein recO [Brucella abortus bv. 6 str. 870]
 gi|260872982|gb|EEX80051.1| DNA repair protein recO [Brucella abortus bv. 9 str. C68]
 gi|260915279|gb|EEX82140.1| DNA repair protein recO [Brucella abortus bv. 3 str. Tulya]
 gi|260924056|gb|EEX90624.1| DNA repair protein recO [Brucella ceti M13/05/1]
 gi|261294224|gb|EEX97720.1| DNA repair protein recO [Brucella ceti M644/93/1]
 gi|261296547|gb|EEY00044.1| DNA repair protein recO [Brucella pinnipedialis B2/94]
 gi|261300762|gb|EEY04259.1| DNA repair protein recO [Brucella neotomae 5K33]
 gi|261304147|gb|EEY07644.1| DNA repair protein recO [Brucella pinnipedialis M163/99/10]
 gi|261741744|gb|EEY29670.1| DNA repair protein recO [Brucella suis bv. 5 str. 513]
 gi|261744403|gb|EEY32329.1| DNA repair protein recO [Brucella suis bv. 3 str. 686]
 gi|262765724|gb|EEZ11513.1| DNA repair protein recO [Brucella melitensis bv. 3 str. Ether]
 gi|263094578|gb|EEZ18376.1| recombination protein O [Brucella melitensis bv. 2 str. 63/9]
 gi|264660559|gb|EEZ30820.1| DNA repair protein recO [Brucella pinnipedialis M292/94/1]
 gi|297175204|gb|EFH34551.1| DNA repair protein RecO [Brucella abortus bv. 5 str. B3196]
 gi|326408685|gb|ADZ65750.1| Recombination protein O, RecO [Brucella melitensis M28]
 gi|326538410|gb|ADZ86625.1| DNA repair protein RecO [Brucella melitensis M5-90]
          Length = 247

 Score =  338 bits (868), Expect = 4e-91,   Method: Composition-based stats.
 Identities = 102/241 (42%), Positives = 146/241 (60%), Gaps = 1/241 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D+ +ILG R +GE + I+EVMT  +GRH+G VR G+S RMQP+LQ GN V V+W +
Sbjct: 1   MEWRDEGVILGTRRHGETSAIVEVMTCGHGRHMGMVRGGRSRRMQPLLQPGNHVDVSWWA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL +++G F  E L    A+L+ + + LYG+Q      R LPER+P   LY+ L + +  
Sbjct: 61  RLDEHMGTFTIEPLSFAAARLIETPVALYGIQLAAAHLRLLPERDPHRGLYETLRLIIEH 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P   G++ ++ E+M+L+ +GFGLDL +C  TG   DL++VSPKSG AVCR  G P+A
Sbjct: 121 FDDPLAAGELLLRFEVMMLEELGFGLDLKECAATGRKDDLIYVSPKSGRAVCREAGAPWA 180

Query: 181 EKMLVLPSFLWKEE-QTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLEL 239
           EK+L LPSF+     +    D L  AF +T YFL ++  +         R  FL  +   
Sbjct: 181 EKLLSLPSFVNDTALRASCYDDLDRAFTMTGYFLMRHVWEPRAQTPPDSRSGFLNAVGRA 240

Query: 240 I 240
           I
Sbjct: 241 I 241


>gi|150395917|ref|YP_001326384.1| DNA repair protein RecO [Sinorhizobium medicae WSM419]
 gi|166221910|sp|A6U7B9|RECO_SINMW RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|150027432|gb|ABR59549.1| DNA repair protein RecO [Sinorhizobium medicae WSM419]
          Length = 249

 Score =  338 bits (868), Expect = 4e-91,   Method: Composition-based stats.
 Identities = 111/240 (46%), Positives = 164/240 (68%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W D AIILG+R +GE ++I EVMT  +GRHLG VR+G+S  MQP+LQ GN V V WR+
Sbjct: 1   MQWSDQAIILGIRRHGESSVIAEVMTPGHGRHLGLVRSGRSRAMQPVLQPGNSVEVVWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LGEFR E L+   A+L+ ++  +YG+Q++  L R LPER+P   LY+ L + ++ 
Sbjct: 61  RLDEHLGEFRVEPLQLRAARLIETATSVYGIQALGSLLRLLPERDPHPHLYEALAVIVDH 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
            + P+  G++FV+ EL +L ++GFGLDL++C  TG   +L++VSPKSG A+CR  G PYA
Sbjct: 121 LQDPADAGELFVRFELAVLNDLGFGLDLSRCGATGARSELVYVSPKSGRAICREAGAPYA 180

Query: 181 EKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLELI 240
           E+ML LP FL  + +  D +SL +AF+LT YFLN++  +   +     R+ F+   L+ +
Sbjct: 181 ERMLALPDFLSGQNRAADHESLAAAFRLTAYFLNRHVYEPRGVDAASARDGFVHATLKAL 240


>gi|227821417|ref|YP_002825387.1| DNA repair protein RecO [Sinorhizobium fredii NGR234]
 gi|227340416|gb|ACP24634.1| DNA repair protein RecO [Sinorhizobium fredii NGR234]
          Length = 276

 Score =  337 bits (866), Expect = 7e-91,   Method: Composition-based stats.
 Identities = 112/240 (46%), Positives = 162/240 (67%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W D AIILG+R +GE ++I EVMT  +GRHLG VR+G+S  MQP+LQ GN V V WR+
Sbjct: 29  MQWSDQAIILGIRRHGESSVIAEVMTSAHGRHLGLVRSGRSRTMQPVLQPGNSVEVTWRA 88

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LGEFR E LE   A+L+ ++  +YG+Q++  L R LPER+P   LY+ L + ++ 
Sbjct: 89  RLDEHLGEFRLEPLELRAARLMEAATSVYGIQALGALLRLLPERDPHPHLYEALAVIVDH 148

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
            + P+  G++FV+ EL +L ++GFGLDL++C  TG   +L++VSPK+G AV R+ G PYA
Sbjct: 149 LQDPADAGELFVRFELAVLNDLGFGLDLSECAATGHRAELIYVSPKTGRAVSRAAGAPYA 208

Query: 181 EKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLELI 240
           E+ML LP FL       D DSL +AF+LT YFLN++  +   +     R+ F+   L+ +
Sbjct: 209 ERMLALPDFLSGTRSAADHDSLAAAFRLTAYFLNRHVYEPRGVDVSSARDGFVHATLKAL 268


>gi|306842071|ref|ZP_07474743.1| DNA repair protein RecO [Brucella sp. BO2]
 gi|306287821|gb|EFM59244.1| DNA repair protein RecO [Brucella sp. BO2]
          Length = 247

 Score =  337 bits (865), Expect = 7e-91,   Method: Composition-based stats.
 Identities = 100/241 (41%), Positives = 145/241 (60%), Gaps = 1/241 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D+ +ILG R +GE + I+EVMT  +GRH+G VR G+S RMQP+LQ GN V V+W +
Sbjct: 1   MEWRDEGVILGTRRHGETSAIVEVMTCGHGRHMGMVRGGRSRRMQPLLQPGNHVDVSWWA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL +++G F  E L    A+L+ + + LYG+Q      R LPER+P   LY+ L + +  
Sbjct: 61  RLDEHMGTFTIEPLGFAAARLIETPVALYGIQLAAAHLRLLPERDPHRGLYETLRLIIEH 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P   G++ ++ E+M+L+ +GFGLDL +C  TG    L++VSPKSG AVCR  G P+A
Sbjct: 121 FDDPLAAGELLLRFEVMMLEELGFGLDLKECAATGRKDGLIYVSPKSGRAVCREAGAPWA 180

Query: 181 EKMLVLPSFLWKEE-QTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLEL 239
           +K+L LPSF+     +    D L  AF +T YFL ++  +         R  FL  +   
Sbjct: 181 DKLLALPSFVNDTALRASCYDDLDRAFTMTGYFLMRHVWEPRAQTPPDSRSGFLNAVGRA 240

Query: 240 I 240
           I
Sbjct: 241 I 241


>gi|294852027|ref|ZP_06792700.1| DNA repair protein RecO [Brucella sp. NVSL 07-0026]
 gi|294820616|gb|EFG37615.1| DNA repair protein RecO [Brucella sp. NVSL 07-0026]
          Length = 247

 Score =  337 bits (865), Expect = 9e-91,   Method: Composition-based stats.
 Identities = 102/241 (42%), Positives = 146/241 (60%), Gaps = 1/241 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D+ +ILG R +GE + I+EVMT  +GRH+G VR G+S RMQP+LQ GN V V+W +
Sbjct: 1   MEWRDEGVILGTRRHGETSAIVEVMTCWHGRHMGMVRGGRSRRMQPLLQPGNHVDVSWWA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL +++G F  E L    A+L+ + + LYG+Q      R LPER+P   LY+ L + +  
Sbjct: 61  RLDEHMGTFTIEPLSFAAARLIETPVALYGIQLAAAHLRLLPERDPHRGLYETLRLIIEH 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P   G++ ++ E+M+L+ +GFGLDL +C  TG   DL++VSPKSG AVCR  G P+A
Sbjct: 121 FDDPLAAGELLLRFEVMMLEELGFGLDLKECAATGRKDDLIYVSPKSGRAVCREAGAPWA 180

Query: 181 EKMLVLPSFLWKEE-QTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLEL 239
           EK+L LPSF+     +    D L  AF +T YFL ++  +         R  FL  +   
Sbjct: 181 EKLLSLPSFVNDTALRASCYDDLDRAFTMTGYFLMRHVWEPRAQTPPDSRSGFLNAVGRA 240

Query: 240 I 240
           I
Sbjct: 241 I 241


>gi|225627162|ref|ZP_03785200.1| DNA repair protein RecO [Brucella ceti str. Cudo]
 gi|256159389|ref|ZP_05457171.1| DNA repair protein RecO [Brucella ceti M490/95/1]
 gi|256254687|ref|ZP_05460223.1| DNA repair protein RecO [Brucella ceti B1/94]
 gi|260168417|ref|ZP_05755228.1| DNA repair protein RecO [Brucella sp. F5/99]
 gi|261221865|ref|ZP_05936146.1| DNA repair protein recO [Brucella ceti B1/94]
 gi|261757878|ref|ZP_06001587.1| recombination protein O [Brucella sp. F5/99]
 gi|265997829|ref|ZP_06110386.1| DNA repair protein recO [Brucella ceti M490/95/1]
 gi|225617997|gb|EEH15041.1| DNA repair protein RecO [Brucella ceti str. Cudo]
 gi|260920449|gb|EEX87102.1| DNA repair protein recO [Brucella ceti B1/94]
 gi|261737862|gb|EEY25858.1| recombination protein O [Brucella sp. F5/99]
 gi|262552297|gb|EEZ08287.1| DNA repair protein recO [Brucella ceti M490/95/1]
          Length = 247

 Score =  336 bits (862), Expect = 2e-90,   Method: Composition-based stats.
 Identities = 102/241 (42%), Positives = 146/241 (60%), Gaps = 1/241 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D+ +ILG R +GE + I+EVMT  +GRH+G VR G+S RMQP+LQ GN V V+W +
Sbjct: 1   MEWRDEGVILGRRRHGETSAIVEVMTCGHGRHMGMVRGGRSRRMQPLLQPGNHVDVSWWA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL +++G F  E L    A+L+ + + LYG+Q      R LPER+P   LY+ L + +  
Sbjct: 61  RLDEHMGTFTIEPLSFAAARLIETPVALYGIQLAAAHLRLLPERDPHRGLYETLRLIIEH 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P   G++ ++ E+M+L+ +GFGLDL +C  TG   DL++VSPKSG AVCR  G P+A
Sbjct: 121 FDDPLAAGELLLRFEVMMLEELGFGLDLKECAATGRKDDLIYVSPKSGRAVCREAGAPWA 180

Query: 181 EKMLVLPSFLWKEE-QTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLEL 239
           EK+L LPSF+     +    D L  AF +T YFL ++  +         R  FL  +   
Sbjct: 181 EKLLSLPSFVNDTALRASCYDDLDRAFTMTGYFLMRHVWEPRAQTPPDSRSGFLNAVGRA 240

Query: 240 I 240
           I
Sbjct: 241 I 241


>gi|17987568|ref|NP_540202.1| DNA repair protein RecO [Brucella melitensis bv. 1 str. 16M]
 gi|256044360|ref|ZP_05447264.1| DNA repair protein RecO [Brucella melitensis bv. 1 str. Rev.1]
 gi|260563712|ref|ZP_05834198.1| DNA repair protein recO [Brucella melitensis bv. 1 str. 16M]
 gi|265990775|ref|ZP_06103332.1| DNA repair protein recO [Brucella melitensis bv. 1 str. Rev.1]
 gi|20139477|sp|Q8YG76|RECO_BRUME RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|17983272|gb|AAL52466.1| DNA repair protein reco [Brucella melitensis bv. 1 str. 16M]
 gi|260153728|gb|EEW88820.1| DNA repair protein recO [Brucella melitensis bv. 1 str. 16M]
 gi|263001559|gb|EEZ14134.1| DNA repair protein recO [Brucella melitensis bv. 1 str. Rev.1]
          Length = 247

 Score =  335 bits (861), Expect = 2e-90,   Method: Composition-based stats.
 Identities = 101/241 (41%), Positives = 145/241 (60%), Gaps = 1/241 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D+ +ILG R +GE + I+EVMT  +GRH+G VR G+S RMQP+LQ GN V V+W +
Sbjct: 1   MEWRDEGVILGTRRHGETSAIVEVMTCGHGRHMGMVRGGRSRRMQPLLQPGNHVDVSWWA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL +++G F  E L    A+L+ + + LYG+Q      R LPER+P   LY+ L + +  
Sbjct: 61  RLDEHMGTFTIEPLSFAAARLIETPVALYGIQLAAAHLRLLPERDPHRGLYETLRLIIEH 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P   G++ ++ E+M+L+ +GFGLDL +C  TG   DL++VSP SG AVCR  G P+A
Sbjct: 121 FDDPLAAGELLLRFEVMMLEELGFGLDLKECAATGRKDDLIYVSPTSGRAVCREAGAPWA 180

Query: 181 EKMLVLPSFLWKEE-QTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLEL 239
           EK+L LPSF+     +    D L  AF +T YFL ++  +         R  FL  +   
Sbjct: 181 EKLLSLPSFVNDTALRASCYDDLDRAFTMTGYFLMRHVWEPRAQTPPDSRSGFLNAVGRA 240

Query: 240 I 240
           I
Sbjct: 241 I 241


>gi|325292418|ref|YP_004278282.1| DNA repair protein RecO [Agrobacterium sp. H13-3]
 gi|325060271|gb|ADY63962.1| DNA repair protein RecO [Agrobacterium sp. H13-3]
          Length = 254

 Score =  334 bits (856), Expect = 8e-90,   Method: Composition-based stats.
 Identities = 115/241 (47%), Positives = 166/241 (68%), Gaps = 1/241 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M WQD+AIILGV+ +GE ++I EVMTR  GRHLG VR G+S  MQP+LQAGN V V WR+
Sbjct: 1   MQWQDEAIILGVKRHGETSVIAEVMTRLRGRHLGMVRGGRSRSMQPVLQAGNRVDVIWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL  +LGEFR E L+   A+L+ ++  +YG+Q++  L R LPER+P   LY  L++ L+ 
Sbjct: 61  RLDDHLGEFRIEPLQLRAAQLMETATAVYGVQAMGALLRLLPERDPHPHLYQALDVILDN 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P   G++FV+ EL +L ++GFGLDLT+C  TG+  DL++VSPK+G AVC + G PYA
Sbjct: 121 LHDPVDAGELFVRFELAVLNDLGFGLDLTECAATGLRTDLIYVSPKTGRAVCSTAGAPYA 180

Query: 181 EKMLVLPSFLWKEEQ-TIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLEL 239
           E+ML LP+FL + +    D DSL +AF+LT +FL+++      ++ +  R+ F+   L+ 
Sbjct: 181 ERMLSLPAFLGEGQSKAADRDSLAAAFRLTGHFLHRHVYDPRGLNENAARDGFVQAALKA 240

Query: 240 I 240
           +
Sbjct: 241 L 241


>gi|260462318|ref|ZP_05810526.1| DNA repair protein RecO [Mesorhizobium opportunistum WSM2075]
 gi|259031812|gb|EEW33080.1| DNA repair protein RecO [Mesorhizobium opportunistum WSM2075]
          Length = 258

 Score =  334 bits (856), Expect = 8e-90,   Method: Composition-based stats.
 Identities = 103/239 (43%), Positives = 151/239 (63%), Gaps = 1/239 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D+ IILG R +GE + ILEVMTR +GRHLG VR G+S + QP+LQ GN V + WR+
Sbjct: 1   MEWRDEGIILGTRKHGETSAILEVMTRTHGRHLGLVRGGRSRKQQPVLQPGNRVDLLWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG F+ E +E + A+L+ S++ +YGLQ++    R LPER+    LY+ L++ +  
Sbjct: 61  RLDEHLGTFQAEPIEMNAARLMDSAIAVYGLQTMAAHLRLLPERDAHGGLYEALSVMIVH 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
                  G++  + EL++L  +GFGLDL++C  TG  QDL +VSPKSG AV R  GLP+ 
Sbjct: 121 LDDADAAGELVARFELLILDELGFGLDLSRCAATGTQQDLAYVSPKSGRAVSREAGLPWR 180

Query: 181 EKMLVLPSFL-WKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLE 238
           +KML LP+FL        D  +++ AF+LT +F  ++  +   I     R  FL  L +
Sbjct: 181 DKMLALPAFLQRGSGLRADPGAVEDAFRLTGFFFTRHVYEPRAIEQPDARLGFLAALRK 239


>gi|15888381|ref|NP_354062.1| DNA repair protein RecO [Agrobacterium tumefaciens str. C58]
 gi|42559508|sp|Q8UGJ8|RECO_AGRT5 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|15156061|gb|AAK86847.1| DNA repair protein RecO [Agrobacterium tumefaciens str. C58]
          Length = 254

 Score =  333 bits (855), Expect = 1e-89,   Method: Composition-based stats.
 Identities = 112/241 (46%), Positives = 166/241 (68%), Gaps = 1/241 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M WQD+AIILGV+ +GE ++I EVMT   GRHLG VR+G+S  MQP+LQAGN V V WR+
Sbjct: 1   MQWQDEAIILGVKRHGETSVIAEVMTPSRGRHLGMVRSGRSRTMQPVLQAGNRVDVIWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL  +LGEFR E L+    +L+ ++  +YG+Q++  L R LPER+P   LY  L++ L+ 
Sbjct: 61  RLHDHLGEFRIEPLQLRAGQLMETATAVYGVQAMGALLRLLPERDPHPHLYQALDVILDN 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P   G++FV+ EL +L ++GFGLDL++C  TG+  DL++VSPK+G AVCR+ G PYA
Sbjct: 121 LHDPVDAGELFVRFELAVLNDLGFGLDLSECAATGLRSDLIYVSPKTGRAVCRTAGAPYA 180

Query: 181 EKMLVLPSFLWKEEQ-TIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLEL 239
            +ML LP+FL + +    D +SL +AF+LTD+FL+++      ++ +  R+ F+   L+ 
Sbjct: 181 ARMLALPAFLGEGQSKAADPESLAAAFRLTDHFLHRHVYDPRGLNENAARDGFVQAALKA 240

Query: 240 I 240
           +
Sbjct: 241 L 241


>gi|240850199|ref|YP_002971592.1| DNA repair protein RecO [Bartonella grahamii as4aup]
 gi|240267322|gb|ACS50910.1| DNA repair protein RecO [Bartonella grahamii as4aup]
          Length = 248

 Score =  332 bits (851), Expect = 3e-89,   Method: Composition-based stats.
 Identities = 100/235 (42%), Positives = 147/235 (62%), Gaps = 1/235 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W++ A+ILG R YGE ++ILEVMTR++GR++G V+ G+S RM  +LQ GN V   W +
Sbjct: 1   MKWKEQAVILGTRQYGETSVILEVMTREHGRYMGVVKGGRSRRMAALLQPGNFVEAEWWA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG FR E L+ H A+L+     LY LQ I    R LPER+P   LYD+L++F+  
Sbjct: 61  RLEEHLGLFRLEALDLHAARLICLPEALYALQLIAFHLRLLPERDPHPVLYDILHLFMQN 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P V  ++ V+ E+ LL+ +GFGLDL+ C  TG  + L +VSPKSG AVC   G P+ 
Sbjct: 121 FDEPFVNAELLVRFEMRLLEELGFGLDLSCCAATGRQERLHYVSPKSGRAVCEEAGEPWK 180

Query: 181 EKMLVLPSFLWKE-EQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLG 234
           +K+L+LP FL +   +  D+  + + F LT +FL ++  +   I    +R N + 
Sbjct: 181 KKLLILPQFLVQRTTRPTDSSDIINGFILTGFFLMRHVWEPRDIKQPSVRMNLIQ 235


>gi|13476445|ref|NP_108015.1| DNA repair protein RecO [Mesorhizobium loti MAFF303099]
 gi|20139624|sp|Q985A3|RECO_RHILO RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|14027206|dbj|BAB54160.1| DNA repair protein; RecO [Mesorhizobium loti MAFF303099]
          Length = 253

 Score =  331 bits (850), Expect = 4e-89,   Method: Composition-based stats.
 Identities = 102/239 (42%), Positives = 150/239 (62%), Gaps = 1/239 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D+ IILG R +GE + ILEVMTR +GRHLG VR G+S + QP+LQ GN V + WR+
Sbjct: 1   MEWRDEGIILGTRKHGETSAILEVMTRAHGRHLGLVRGGRSRKQQPVLQPGNRVDLLWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG F+ E +E + A+L+ S++ +YGLQ++    R LPER+    LY+ L++ +  
Sbjct: 61  RLDEHLGTFQAEAIEMNAARLMDSAVAVYGLQTMAAHLRLLPERDAHGGLYEALSVMIVH 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
                  G++  + EL++L  +GFGLDL++C  TG  QDL +VSPKSG AV R  G P+ 
Sbjct: 121 LDDADAAGELVARFELLILDELGFGLDLSQCAATGTRQDLAYVSPKSGRAVSREAGAPWR 180

Query: 181 EKMLVLPSFL-WKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLE 238
           +KML LP+FL        D  +++ AF+LT +F  ++  +   I     R  FL  L +
Sbjct: 181 DKMLALPAFLQRGSGLRADPAAVEDAFRLTGFFFTRHVYEPRAIEQPDARAGFLAALRK 239


>gi|74420976|gb|ABA05175.1| DNA replication and repair protein RecO [Nitrobacter winogradskyi
           Nb-255]
          Length = 278

 Score =  331 bits (849), Expect = 5e-89,   Method: Composition-based stats.
 Identities = 97/241 (40%), Positives = 136/241 (56%), Gaps = 3/241 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W DD I+LGVR +GE + I+E++TR +GRHLG VR G   RM+P+LQ GN V   WR+
Sbjct: 17  MEWTDDGIVLGVRRHGESSAIVELLTRTHGRHLGLVRGGAGSRMRPLLQPGNSVSALWRA 76

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG +  E      A LL+SS   YG+  +  L R LPER+P   ++ ML   L+ 
Sbjct: 77  RLDEHLGTYALEGTRMRAASLLASSHATYGVTHLAALARLLPERDPHEVIFAMLERTLDD 136

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
                      ++ EL +L  +GFGLDL+ C  TG T DL++VSPKSGGAV R  G P+ 
Sbjct: 137 FDRAGGAAIHLIRFELAMLSELGFGLDLSACAATGATGDLIYVSPKSGGAVSRQAGEPWR 196

Query: 181 EKMLVLPSFLW---KEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLL 237
           +++L LP FL     E+       L   F+LT  FL ++ L+         R  F+  ++
Sbjct: 197 DRLLPLPPFLRVTHDEQDGWSEQDLLDGFELTGRFLLRHVLEPRGQGHSDARAGFINAVV 256

Query: 238 E 238
            
Sbjct: 257 R 257


>gi|121601946|ref|YP_988791.1| DNA repair protein RecO [Bartonella bacilliformis KC583]
 gi|166221884|sp|A1US38|RECO_BARBK RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|120614123|gb|ABM44724.1| DNA repair protein RecO [Bartonella bacilliformis KC583]
          Length = 245

 Score =  331 bits (849), Expect = 6e-89,   Method: Composition-based stats.
 Identities = 102/235 (43%), Positives = 151/235 (64%), Gaps = 1/235 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W++ AIILG R YGE ++ILEV+TRQ+GR++G V+ G+S RM  +LQ GN V   W +
Sbjct: 1   MKWKEQAIILGARQYGETSVILEVVTRQHGRYMGVVKGGRSRRMAALLQPGNFVEAEWWA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG F+ E L+   ++L+     LYGLQ +   FR LPER+P   LYD+L++F+  
Sbjct: 61  RLDEHLGLFKLEALDLCASRLMFLPEALYGLQLMASHFRLLPERDPHPILYDILHLFMQN 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
                V  ++ V+ E+ LL+ +GFGLDL+ C VTG  + L +VSPKSG AVC  VGLP+ 
Sbjct: 121 FDEQFVNAELLVRFEMRLLEELGFGLDLSHCAVTGRQEKLYYVSPKSGRAVCEEVGLPWK 180

Query: 181 EKMLVLPSFLWKE-EQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLG 234
            K+L+LP FL +   + +D D +++ F LTD+FL ++  +   I    +R   + 
Sbjct: 181 NKLLLLPKFLIERTNRPVDFDDIRNGFTLTDFFLTRHVWEPRGIKQPSVRAILIQ 235


>gi|115525024|ref|YP_781935.1| DNA repair protein RecO [Rhodopseudomonas palustris BisA53]
 gi|122295836|sp|Q07M79|RECO_RHOP5 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|115518971|gb|ABJ06955.1| DNA repair protein RecO [Rhodopseudomonas palustris BisA53]
          Length = 258

 Score =  330 bits (848), Expect = 7e-89,   Method: Composition-based stats.
 Identities = 99/240 (41%), Positives = 142/240 (59%), Gaps = 2/240 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W DD I+LGVR +GE + I+E++TR +GRHLG VR G   +++P+LQ GN V   WR+
Sbjct: 1   MEWTDDGIVLGVRRHGESSAIVELLTRAHGRHLGLVRGGAGSKLRPVLQPGNSVHAGWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG +  E +    A LL+     YG+  +  L R LPER+P  E+Y+ +   L  
Sbjct: 61  RLDEHLGYYALEGMRLRAATLLAVPHAAYGITHLAALARLLPERDPHPEMYETVERILED 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
               ++ G   V+ EL +L  +GFGLDL+ C  TGVT DL++VSPKSGGAV R+ G P+ 
Sbjct: 121 FDDATMAGAHLVRFELAMLGELGFGLDLSACAATGVTSDLIYVSPKSGGAVSRTAGEPWR 180

Query: 181 EKMLVLPSFLWKEEQTI--DADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLE 238
           +K+L LP FL ++E      AD L+  F LT  FL +  L+         R+ F+  +  
Sbjct: 181 DKLLRLPPFLREDEDAAGCTADDLRDGFALTGRFLLRNVLEPRGQGHSDARDGFINAVTR 240


>gi|319408285|emb|CBI81938.1| DNA repair protein RecO [Bartonella schoenbuchensis R1]
          Length = 248

 Score =  330 bits (847), Expect = 9e-89,   Method: Composition-based stats.
 Identities = 99/235 (42%), Positives = 149/235 (63%), Gaps = 1/235 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W++ AIILG R +GE ++ILE+MTRQ+GR++G V+ G+S  M  +LQ GN V   W +
Sbjct: 1   MRWKEQAIILGTRQHGETSVILEIMTRQHGRYMGMVKGGRSRSMAALLQPGNFVEAEWWA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG F+ E L+ H ++L+     LY LQ +    R LPER+P   LYDML+IF+  
Sbjct: 61  RLDEHLGLFKLEALDLHASRLMLIPEALYTLQLMASHLRLLPERDPHPILYDMLHIFMQN 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
                VI ++ ++ E+ LLK +GFGLDL+ CVVTG  ++L +VSPKSG AV    G  + 
Sbjct: 121 FDEWFVIAELLIRFEMRLLKELGFGLDLSCCVVTGCRENLHYVSPKSGRAVSEEAGYLWR 180

Query: 181 EKMLVLPSFLWKE-EQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLG 234
           +K+L LP FL +   + ID + +++ F LT++FL ++  +   I    +R N + 
Sbjct: 181 DKLLPLPQFLIQRASRPIDFNDMRNGFALTNFFLTRHVWEPRRIQQPSVRVNLIN 235


>gi|85716281|ref|ZP_01047255.1| DNA repair protein RecO [Nitrobacter sp. Nb-311A]
 gi|85696953|gb|EAQ34837.1| DNA repair protein RecO [Nitrobacter sp. Nb-311A]
          Length = 260

 Score =  330 bits (847), Expect = 1e-88,   Method: Composition-based stats.
 Identities = 98/241 (40%), Positives = 137/241 (56%), Gaps = 3/241 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W DD I+LGVR +GE + I+E++TR +GRHLG VR G   RM+P+LQ GN V   WR+
Sbjct: 1   MEWIDDGIVLGVRRHGESSAIVELLTRDHGRHLGLVRGGAGSRMRPLLQPGNSVNALWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG +  E      A LL+SS   YG+  +  L R LPER+P   ++ ML   L+ 
Sbjct: 61  RLDEHLGAYALEGTRMRAASLLASSHATYGVTHLAALARLLPERDPHEGIFTMLERTLDD 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
                      ++ EL +L  +GFGLDL+ C  TGVT DL++VSPKSGGAV R  G P+ 
Sbjct: 121 FDHAGGAAIHLIRFELAMLSELGFGLDLSACAATGVTGDLIYVSPKSGGAVSRQAGEPWR 180

Query: 181 EKMLVLPSFLW---KEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLL 237
           +++L LP FL     E+       L   F+LT  FL ++ L+         R  F+  ++
Sbjct: 181 DRLLPLPPFLRASHDEQNGCSEQDLLDGFELTGRFLLRHVLEPRGQGHSDARAGFINAVV 240

Query: 238 E 238
            
Sbjct: 241 R 241


>gi|49475306|ref|YP_033347.1| DNA repair protein RecO [Bartonella henselae str. Houston-1]
 gi|61215010|sp|Q6G457|RECO_BARHE RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|49238112|emb|CAF27319.1| DNA repair protein reco [Bartonella henselae str. Houston-1]
          Length = 256

 Score =  330 bits (846), Expect = 1e-88,   Method: Composition-based stats.
 Identities = 101/235 (42%), Positives = 147/235 (62%), Gaps = 1/235 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W++ AIILG R YGE ++ILEVMTRQ+GR++G V+ G+S RM  +LQ GN V   W +
Sbjct: 1   MKWKEQAIILGTRQYGETSVILEVMTRQHGRYMGVVKGGRSRRMAVLLQPGNFVEAEWWA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG FR E L+ H A+L+     LY LQ IV     LPER+P   LYD+L++F+  
Sbjct: 61  RLDEHLGLFRLEALDLHAARLILFPEALYALQLIVFHLHLLPERDPHPILYDILHLFMQS 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P +  ++ V+ E+  L+ +GFGLDL++C  TG  + L +VSPKSG AVC   G P+ 
Sbjct: 121 FDEPFINAELLVRFEMRFLEELGFGLDLSRCAATGRLEKLCYVSPKSGRAVCEEAGHPWR 180

Query: 181 EKMLVLPSFLWKEE-QTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLG 234
           EK+L LP FL +   + +D   +K+ F LT +FL ++  +   I    +R + + 
Sbjct: 181 EKLLNLPQFLVQRTVRPVDFSDIKNGFILTGFFLMRHVWEPRNIKQPSVRISLIQ 235


>gi|162139842|ref|YP_318527.2| DNA repair protein RecO [Nitrobacter winogradskyi Nb-255]
 gi|119361470|sp|Q3SRB6|RECO_NITWN RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
          Length = 262

 Score =  329 bits (844), Expect = 2e-88,   Method: Composition-based stats.
 Identities = 97/241 (40%), Positives = 136/241 (56%), Gaps = 3/241 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W DD I+LGVR +GE + I+E++TR +GRHLG VR G   RM+P+LQ GN V   WR+
Sbjct: 1   MEWTDDGIVLGVRRHGESSAIVELLTRTHGRHLGLVRGGAGSRMRPLLQPGNSVSALWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG +  E      A LL+SS   YG+  +  L R LPER+P   ++ ML   L+ 
Sbjct: 61  RLDEHLGTYALEGTRMRAASLLASSHATYGVTHLAALARLLPERDPHEVIFAMLERTLDD 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
                      ++ EL +L  +GFGLDL+ C  TG T DL++VSPKSGGAV R  G P+ 
Sbjct: 121 FDRAGGAAIHLIRFELAMLSELGFGLDLSACAATGATGDLIYVSPKSGGAVSRQAGEPWR 180

Query: 181 EKMLVLPSFLW---KEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLL 237
           +++L LP FL     E+       L   F+LT  FL ++ L+         R  F+  ++
Sbjct: 181 DRLLPLPPFLRVTHDEQDGWSEQDLLDGFELTGRFLLRHVLEPRGQGHSDARAGFINAVV 240

Query: 238 E 238
            
Sbjct: 241 R 241


>gi|315122361|ref|YP_004062850.1| DNA repair protein RecO [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313495763|gb|ADR52362.1| DNA repair protein RecO [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 240

 Score =  326 bits (836), Expect = 2e-87,   Method: Composition-based stats.
 Identities = 182/240 (75%), Positives = 217/240 (90%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M+WQDDAI+LGVRSYGEKNIILEVMTR YGRHLGFVR GQS R+QP+LQ GNLVRVNWRS
Sbjct: 1   MHWQDDAIVLGVRSYGEKNIILEVMTRHYGRHLGFVRYGQSRRIQPVLQVGNLVRVNWRS 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL Q+LGEFR E++E  C+KLLSS++ LYGLQS++P+FRFLPER+PC +LYD+LN+F+N 
Sbjct: 61  RLEQDLGEFRLEIIEYRCSKLLSSAISLYGLQSMIPIFRFLPERDPCPDLYDLLNLFINS 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
           HKI S++GKIF+QIEL+LLKNIGFGL++TKCVVTGV+ DL WVSPKSGGA+C S+GLPYA
Sbjct: 121 HKISSILGKIFIQIELILLKNIGFGLEITKCVVTGVSHDLSWVSPKSGGAICHSLGLPYA 180

Query: 181 EKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLELI 240
            KMLVLP FLWKE+Q IDADSL++AF+LT YFL+KYA QHNIIHC+ LR NFL KL+EL+
Sbjct: 181 SKMLVLPLFLWKEQQNIDADSLRNAFRLTGYFLDKYAFQHNIIHCNSLRINFLNKLIELL 240


>gi|163867994|ref|YP_001609198.1| DNA repair protein RecO [Bartonella tribocorum CIP 105476]
 gi|189039650|sp|A9IRN6|RECO_BART1 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|161017645|emb|CAK01203.1| DNA repair protein RecO [Bartonella tribocorum CIP 105476]
          Length = 248

 Score =  326 bits (836), Expect = 2e-87,   Method: Composition-based stats.
 Identities = 101/235 (42%), Positives = 146/235 (62%), Gaps = 1/235 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W++ A+ILGVR YGE ++ILE++TR+ GR++G V+ G+S RM  +LQ GN V   W +
Sbjct: 1   MKWKEQAVILGVRQYGETSVILEIITRERGRYMGVVKGGRSRRMAALLQPGNFVEAEWSA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG FR E L+ H A+L+     LY LQ I    R LPER+P   LYD+L++F+  
Sbjct: 61  RLEEHLGLFRLEALDFHAARLICLPEALYALQLIAFHLRLLPERDPHPVLYDILHLFMQN 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P V  ++ V+ E+ LL+ +GFGLDL+ C  TG  Q L +VSPKSG AVC   G P+ 
Sbjct: 121 FDEPFVNAELLVRFEMRLLEELGFGLDLSCCAATGRKQKLYYVSPKSGRAVCEEAGEPWK 180

Query: 181 EKMLVLPSFLWKE-EQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLG 234
           +K+L+LP FL +   +  D   + + F LT +FL +Y  +   I    +R N + 
Sbjct: 181 KKLLILPQFLVQRATRPADFRDIINGFNLTSFFLMRYVWEPRDIKQPSVRTNLIQ 235


>gi|90424142|ref|YP_532512.1| DNA repair protein RecO [Rhodopseudomonas palustris BisB18]
 gi|119361479|sp|Q214J3|RECO_RHOPB RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|90106156|gb|ABD88193.1| DNA repair protein RecO [Rhodopseudomonas palustris BisB18]
          Length = 254

 Score =  325 bits (835), Expect = 2e-87,   Method: Composition-based stats.
 Identities = 97/242 (40%), Positives = 139/242 (57%), Gaps = 3/242 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W D+ I+LGVR +GE + I+E++TR +GRHLG VR G   +++P+LQ GN V   WR+
Sbjct: 1   MEWTDEGIVLGVRRHGESSAIVELLTRGHGRHLGLVRGGAGSKLRPLLQPGNSVSAVWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG +  E      A LL+SS  +YG+  +  L R LPER+P  E+Y+ L   L+ 
Sbjct: 61  RLDEHLGYYVLEGTRMRAAMLLASSHAVYGVTHLASLARLLPERDPQPEIYERLERTLDD 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
                      ++ EL +L  +GFGLDL  C  TGVT DL++VSPKSGGAV R+ G P+ 
Sbjct: 121 FDDVGEAAVHVIRFELTMLAELGFGLDLANCAATGVTSDLIYVSPKSGGAVSRAAGEPWR 180

Query: 181 EKMLVLPSFLWKEE---QTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLL 237
           +K+L LP FL +            L+  F LT  FL +  L+         R+ F+  ++
Sbjct: 181 DKLLRLPPFLREGSAQRNDWSDQDLQDGFLLTGRFLLRNVLEPRGQGHSDARDGFINAVV 240

Query: 238 EL 239
            L
Sbjct: 241 RL 242


>gi|110633306|ref|YP_673514.1| DNA repair protein RecO [Mesorhizobium sp. BNC1]
 gi|119361464|sp|Q11JS6|RECO_MESSB RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|110284290|gb|ABG62349.1| DNA replication and repair protein RecO [Chelativorans sp. BNC1]
          Length = 248

 Score =  325 bits (834), Expect = 3e-87,   Method: Composition-based stats.
 Identities = 100/239 (41%), Positives = 146/239 (61%), Gaps = 1/239 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W D+ I+LG R +GE ++ILE +T  +GRHLG VR G+S RMQP+LQ GN V + WR+
Sbjct: 1   MEWHDEGIVLGTRRHGESSVILEAITAAHGRHLGLVRGGRSKRMQPVLQPGNRVDLTWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG F+ E LE + A+LL+S++ +YG+Q +    R LPER+P   L++ L +    
Sbjct: 61  RLDEHLGLFQVEPLELNAARLLNSAVAIYGIQLLAAHLRLLPERDPHPGLFEALGVIAAH 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P   G +  + EL +L  +GFGLDL +C VTG  +DL +VSPK+G AV R  G P+A
Sbjct: 121 LDEPETAGVLVARFELAVLDALGFGLDLARCAVTGSREDLAYVSPKTGRAVTREAGAPWA 180

Query: 181 EKMLVLPSFLWKEEQT-IDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLE 238
           +K+L LP+FL    +   D   L  AF LT +F  ++  +   +     R  FL  ++ 
Sbjct: 181 DKLLPLPTFLTAGNEALYDRAILSQAFALTGFFFARHVYEPRGLTEPEARAGFLAAVMR 239


>gi|86749733|ref|YP_486229.1| DNA repair protein RecO [Rhodopseudomonas palustris HaA2]
 gi|119361478|sp|Q2IWU2|RECO_RHOP2 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|86572761|gb|ABD07318.1| DNA replication and repair protein RecO [Rhodopseudomonas palustris
           HaA2]
          Length = 249

 Score =  325 bits (834), Expect = 3e-87,   Method: Composition-based stats.
 Identities = 98/243 (40%), Positives = 140/243 (57%), Gaps = 3/243 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W D+ IILGVR +GE   I+E++TR +GRHLG VR G S R++P+LQ GN V   WR+
Sbjct: 1   MEWSDEGIILGVRRHGEAGAIVELLTRGHGRHLGLVRGGASSRLRPLLQPGNSVLAVWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG ++ E      A +L+SS  +YG+  +  L R LPER+P  ++Y+ML   L+ 
Sbjct: 61  RLDEHLGYYQLEGTRMRAATMLASSHAVYGITHLASLARLLPERDPHEDIYEMLERTLDD 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
                      ++ EL +L  +GFGLDL+ C  TG T DL++VSPKSGGAV R+ G P+ 
Sbjct: 121 FDDVGDAATHLIRFELAMLAELGFGLDLSACAATGATTDLIYVSPKSGGAVSRTAGEPWR 180

Query: 181 EKMLVLPSFLW---KEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLL 237
           EK+L LP FL              L+  F LT  FL +  L+         R+ F+  + 
Sbjct: 181 EKLLRLPDFLREDNDGRNGWSDQDLRDGFDLTGRFLLRNVLEPRGQGHSDARDGFINAVA 240

Query: 238 ELI 240
           + +
Sbjct: 241 KHL 243


>gi|192291353|ref|YP_001991958.1| DNA repair protein RecO [Rhodopseudomonas palustris TIE-1]
 gi|238692599|sp|B3QJH7|RECO_RHOPT RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|192285102|gb|ACF01483.1| DNA repair protein RecO [Rhodopseudomonas palustris TIE-1]
          Length = 250

 Score =  325 bits (834), Expect = 3e-87,   Method: Composition-based stats.
 Identities = 98/244 (40%), Positives = 139/244 (56%), Gaps = 4/244 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W D+ IILGVR +GE   I+E++TR +GRHLG VR G S RM+P+LQ GN V  +WR+
Sbjct: 1   MEWSDEGIILGVRRHGESAAIVELLTRGHGRHLGMVRGGASARMRPLLQPGNSVLASWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG ++ E  +   A LL SS  +YG+  +  L R LPER+P  E+Y  L + L+ 
Sbjct: 61  RLDEHLGYYQLEATKMRAATLLGSSHAVYGVTHLASLARLLPERDPHEEIYQRLVLTLDD 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
                V     ++ EL +L  +GFGLDL+ C  TG T +L++VSPKSG AV RS G P+ 
Sbjct: 121 FDDFGVAAAHLIRFELAILAELGFGLDLSACAATGSTTELIYVSPKSGSAVSRSAGEPWR 180

Query: 181 EKMLVLPSFLWK----EEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKL 236
           +++L LP+FL               L   F+LT  FL +  L+         R  F+  +
Sbjct: 181 DRLLRLPAFLRDDEAESGNGWSGQDLFDGFELTGRFLLRNVLEPRGQSHSDARAGFINAI 240

Query: 237 LELI 240
              +
Sbjct: 241 TRAL 244


>gi|299135099|ref|ZP_07028290.1| DNA repair protein RecO [Afipia sp. 1NLS2]
 gi|298590076|gb|EFI50280.1| DNA repair protein RecO [Afipia sp. 1NLS2]
          Length = 249

 Score =  325 bits (833), Expect = 4e-87,   Method: Composition-based stats.
 Identities = 93/241 (38%), Positives = 135/241 (56%), Gaps = 3/241 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W D+ IILG R +GE + I+E++TR +GRHLG VR G   RM+P+LQ GN V   WR+
Sbjct: 1   MEWTDEGIILGTRRHGESSAIVELLTRSHGRHLGLVRGGAGTRMRPLLQPGNSVSAVWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG +  E  +   A +L+     YG+  +  L R LPER P   +Y++L   L+ 
Sbjct: 61  RLDEHLGYYAIEGTQLRAATMLACPHAAYGITHLAALARLLPERAPHDGIYELLEAILDD 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P V     V+ E+ +L  +GFGLDL+ C  TG   DL++VSPKSG AV R+ G P+ 
Sbjct: 121 FDEPVVAATHVVRFEMAMLDELGFGLDLSSCAATGAQADLIYVSPKSGCAVSRAAGEPWR 180

Query: 181 EKMLVLPSFLWKEEQTIDAD---SLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLL 237
           E++L LP FL    +   A+    +   F+LT  FL +  L+         R+ F+  + 
Sbjct: 181 ERLLPLPPFLRAGHEDSGAETERDMMEGFRLTGLFLLRNVLEPRGQGHSDARDGFIAAVA 240

Query: 238 E 238
            
Sbjct: 241 R 241


>gi|91977125|ref|YP_569784.1| DNA repair protein RecO [Rhodopseudomonas palustris BisB5]
 gi|119361480|sp|Q136V6|RECO_RHOPS RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|91683581|gb|ABE39883.1| DNA replication and repair protein RecO [Rhodopseudomonas palustris
           BisB5]
          Length = 249

 Score =  324 bits (832), Expect = 5e-87,   Method: Composition-based stats.
 Identities = 96/243 (39%), Positives = 140/243 (57%), Gaps = 3/243 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W D+ IILGVR +GE   I+E++TR +GRHLG VR G S RM+P+LQ GN V   WR+
Sbjct: 1   MEWSDEGIILGVRRHGEAGAIVELLTRSHGRHLGLVRGGASSRMRPLLQPGNSVLAVWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG ++ E      A +L+SS  +YG+  +  L R LPER+P  ++Y+ML   L+ 
Sbjct: 61  RLDEHLGYYQLEGTRMRAATMLASSHAVYGVTHLASLARLLPERDPHEDIYEMLERTLDD 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
                      ++ EL +L  +GFGLDL+ C  TG T +L++VSPKSG AV R+ G P+ 
Sbjct: 121 FDDVGDAATHLIRFELAMLAELGFGLDLSACAATGATVELIYVSPKSGSAVSRAAGEPWR 180

Query: 181 EKMLVLPSFLWKEE---QTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLL 237
           +K+L LP+FL  +           L+  F LT  FL +  L+         R+ F+  + 
Sbjct: 181 DKLLRLPAFLRDDNDGRNGWSDQDLRDGFDLTGRFLLRNVLEPRGQGHSDARDGFINAVT 240

Query: 238 ELI 240
             +
Sbjct: 241 RHL 243


>gi|319784500|ref|YP_004143976.1| DNA repair protein RecO [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
 gi|317170388|gb|ADV13926.1| DNA repair protein RecO [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
          Length = 258

 Score =  324 bits (831), Expect = 7e-87,   Method: Composition-based stats.
 Identities = 104/239 (43%), Positives = 151/239 (63%), Gaps = 1/239 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D+ IILG R +GE + ILEV+TR +GRHLG VR G+S + QP+LQ GN V + WR+
Sbjct: 1   MEWRDEGIILGTRKHGETSAILEVLTRAHGRHLGLVRGGRSRKQQPVLQPGNRVDLLWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG F+ E +E + A+L+ S++ +YGLQ++    R LPER+    LY+ L + +  
Sbjct: 61  RLDEHLGTFQAEAIEMNAARLMDSAVAVYGLQTMAAHLRLLPERDAHEGLYETLAVMIVH 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
                V G++  + EL++L  +GFGLDL++C  TG  QDL +VSPKSG AV R  GLP+ 
Sbjct: 121 LDDADVAGELVARFELLVLDELGFGLDLSQCAATGTRQDLAYVSPKSGRAVSREAGLPWR 180

Query: 181 EKMLVLPSFL-WKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLE 238
           ++ML LP+FL        DA  +  AF+LT +F N++  +   I     R  FL  L +
Sbjct: 181 DRMLALPAFLQRGSGLRADAADVDDAFRLTGFFFNRHVYEPRGIEPPDARTGFLAALRK 239


>gi|222148084|ref|YP_002549041.1| DNA repair protein RecO [Agrobacterium vitis S4]
 gi|221735072|gb|ACM36035.1| DNA repair protein RecO [Agrobacterium vitis S4]
          Length = 264

 Score =  324 bits (830), Expect = 8e-87,   Method: Composition-based stats.
 Identities = 110/245 (44%), Positives = 160/245 (65%), Gaps = 5/245 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W D AI+LG R +GE ++I E+MT   GRHLG VR G+S  MQP+LQ GN+V V WR+
Sbjct: 1   MEWTDQAIVLGARRHGETSVIAEMMTLARGRHLGLVRGGRSRTMQPVLQPGNVVEVTWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG+FR E L+     L+SS+  +YG+Q++  L R LPEREP   LY+ +NI L+ 
Sbjct: 61  RLEEHLGDFRVEPLQLRAGHLMSSATAVYGVQALASLLRLLPEREPHGHLYEAMNIILDH 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P+  G++F++ EL +L ++GFGLDLT C  TG  QDL++VSPK+G AV  + GLPYA
Sbjct: 121 LHEPASAGELFIRFELAILNDLGFGLDLTACAATGGRQDLVFVSPKTGRAVSHAAGLPYA 180

Query: 181 EKMLVLPSF-----LWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGK 235
           +++L LP F     L  +++  DA +L+ AF+LT YFL ++  +   +     R+ F   
Sbjct: 181 DRLLTLPVFLQPEPLVGKDKQADAQALQQAFRLTGYFLQRHVYEPRGLTAGAARDGFCQA 240

Query: 236 LLELI 240
            L+ +
Sbjct: 241 ALKAL 245


>gi|218529181|ref|YP_002419997.1| DNA repair protein RecO [Methylobacterium chloromethanicum CM4]
 gi|254764643|sp|B7KPI6|RECO_METC4 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|218521484|gb|ACK82069.1| DNA repair protein RecO [Methylobacterium chloromethanicum CM4]
          Length = 246

 Score =  324 bits (830), Expect = 9e-87,   Method: Composition-based stats.
 Identities = 95/240 (39%), Positives = 138/240 (57%), Gaps = 6/240 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W DD +++G+R +GE  ++LE+MT ++GRHLG V  G+S RMQP+LQ GN +R  WR+
Sbjct: 1   MQWIDDGLVIGLRKHGETGVVLELMTPEHGRHLGLVHGGRSRRMQPMLQPGNTLRATWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL   LG +  E L  + ++L+ S L LYG+  +  L R LPER+P   LY+   I +  
Sbjct: 61  RLDGALGAYAVEPLTLNASRLMDSGLALYGVAHLSALLRLLPERDPHPALYEAAQILIAH 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P +   + V+ EL LL  +GFGLDL+ C  TG    L++VSPKSG AV  S G P+ 
Sbjct: 121 LDDPEIAPALMVRFELALLAGLGFGLDLSHCAATGANDALVYVSPKSGRAVSASAGEPFR 180

Query: 181 EKMLVLPSFLWKEEQT------IDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLG 234
           +++L LP FL   +Q        D   ++  F LT YFL+++  +         R  F+ 
Sbjct: 181 DRLLPLPPFLRDRDQPGSGWRTPDTQDVREGFTLTGYFLDQHVWRPRAQDTPEERARFVA 240


>gi|90420864|ref|ZP_01228769.1| DNA repair protein recO [Aurantimonas manganoxydans SI85-9A1]
 gi|90334839|gb|EAS48611.1| DNA repair protein recO [Aurantimonas manganoxydans SI85-9A1]
          Length = 243

 Score =  324 bits (830), Expect = 9e-87,   Method: Composition-based stats.
 Identities = 101/239 (42%), Positives = 150/239 (62%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+++AI+LGVR  GE +++ EVMTR  GRHLG VR G+S + QP+LQ GN V V+WR+
Sbjct: 1   MEWREEAIVLGVRRLGETSVVAEVMTRARGRHLGLVRGGRSRKQQPVLQPGNSVAVHWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL +++G F  E LE   A+L+ S + L G+Q +    R L ER+P   LYD L I ++ 
Sbjct: 61  RLDEHMGAFVLEPLELRAARLMESGVGLNGVQLVAAHLRLLAERDPHARLYDGLQIIVDH 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P ++ ++ ++ E+ LL+ +GFGLDL +C  TG   DL +VSP++G AV R  G P+ 
Sbjct: 121 LDRPELVAELMLRFEIALLEELGFGLDLERCAATGQRDDLAYVSPRTGRAVSRDAGAPWH 180

Query: 181 EKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLEL 239
           +K+L LP+FL       DA+SL + ++LT YFL ++  +   I     R  FL  L ++
Sbjct: 181 DKLLTLPAFLADAATASDAESLAAGYRLTGYFLGRHVYEPRGIDVPDARAGFLSALRKI 239


>gi|39935766|ref|NP_948042.1| DNA repair protein RecO [Rhodopseudomonas palustris CGA009]
 gi|61215044|sp|Q6N6B8|RECO_RHOPA RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|39649619|emb|CAE28141.1| putative DNA repair protein RecO [Rhodopseudomonas palustris
           CGA009]
          Length = 250

 Score =  324 bits (830), Expect = 9e-87,   Method: Composition-based stats.
 Identities = 98/244 (40%), Positives = 139/244 (56%), Gaps = 4/244 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W D+ IILGVR +GE   I+E++TR +GRHLG VR G S RM+P+LQ GN V  +WR+
Sbjct: 1   MEWSDEGIILGVRRHGESAAIVELLTRGHGRHLGMVRGGASARMRPLLQPGNSVLASWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG ++ E  +   A LL SS  +YG+  +  L R LPER+P  E+Y  L + L+ 
Sbjct: 61  RLDEHLGYYQLEATKMRAATLLGSSHAVYGVTHLASLARLLPERDPHEEIYQRLVLTLDD 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
                V     ++ EL +L  +GFGLDL+ C  TG T +L++VSPKSG AV RS G P+ 
Sbjct: 121 FDDFGVAAAHLIRFELAILAELGFGLDLSACAATGSTTELIYVSPKSGSAVSRSAGEPWR 180

Query: 181 EKMLVLPSFLWK----EEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKL 236
           +++L LP+FL               L   F+LT  FL +  L+         R  F+  +
Sbjct: 181 DRLLRLPAFLRDDEAESGHGWSGQDLFDGFELTGRFLLRNVLEPRGQSHSDARAGFINAI 240

Query: 237 LELI 240
              +
Sbjct: 241 TRAL 244


>gi|209884979|ref|YP_002288836.1| DNA repair protein RecO [Oligotropha carboxidovorans OM5]
 gi|229470366|sp|B6JGG5|RECO_OLICO RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|209873175|gb|ACI92971.1| DNA repair protein RecO [Oligotropha carboxidovorans OM5]
          Length = 249

 Score =  324 bits (830), Expect = 1e-86,   Method: Composition-based stats.
 Identities = 96/241 (39%), Positives = 132/241 (54%), Gaps = 3/241 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W DD IILG R +GE N I+E++TR +GRHLG VR G   RM+P+LQ GN V   WR+
Sbjct: 1   MEWTDDGIILGTRRHGEANAIVELLTRSHGRHLGLVRGGAGTRMRPLLQPGNSVGAVWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG +  E      A +LS S   YG+  +  L R LPER P   +Y+     L  
Sbjct: 61  RLDEHLGYYALEGTRLRAATMLSYSHAAYGITHLAALARLLPERAPHDGIYEQFEAILED 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P +     V+ E+ +L+ +GFGLDL+ C  TG   DL++VSPKSG AV RS G P+ 
Sbjct: 121 FDDPVIAATHVVRFEMAMLEELGFGLDLSCCAATGTHTDLIYVSPKSGCAVSRSAGEPWR 180

Query: 181 EKMLVLPSFLWKEEQTIDAD---SLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLL 237
           E++L LP+FL    +    D    +   F+LT  FL +  L+         R  F+  + 
Sbjct: 181 ERLLPLPAFLRAGNEESSPDGEADIMEGFRLTGMFLLRNVLEPRGQAHSDARAGFIAAVA 240

Query: 238 E 238
            
Sbjct: 241 R 241


>gi|254512349|ref|ZP_05124416.1| DNA repair protein RecO [Rhodobacteraceae bacterium KLH11]
 gi|221536060|gb|EEE39048.1| DNA repair protein RecO [Rhodobacteraceae bacterium KLH11]
          Length = 241

 Score =  323 bits (829), Expect = 1e-86,   Method: Composition-based stats.
 Identities = 94/243 (38%), Positives = 132/243 (54%), Gaps = 5/243 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D  I+L  R +GE   I+EV T  +GRH G VR G S ++ PILQ G  + V WR+
Sbjct: 1   MDWRDHGILLTARRHGETAAIIEVFTEGHGRHAGVVRGGTSRKIAPILQPGAQLDVLWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLN 119
           RL +++G F+ E L S  A   S  L L GL ++V L  F LPEREP   +Y      ++
Sbjct: 61  RLEEHIGTFQVEPLRSRAAAAFSGRLALAGLNAVVALLSFCLPEREPHPAIYKQTEQLMD 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                 V    +++ EL LL+ +GFGLDL+ C VTGVT  L++VSPK+G AV R+    +
Sbjct: 121 LLGQDEVWPLAYLRWELALLEELGFGLDLSACAVTGVTDGLVYVSPKTGRAVSRAGAGEW 180

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHN--IIHCHLLRENFLGKLL 237
           A+K+L LP  L  E    DA  +  A + T YFL  + L  +         R  F+ +  
Sbjct: 181 ADKLLPLPPCLRGEGAAPDAG-IAEALRTTGYFLENH-LAPSLGHTPLPDARARFVAQFT 238

Query: 238 ELI 240
             +
Sbjct: 239 RRL 241


>gi|92117771|ref|YP_577500.1| DNA repair protein RecO [Nitrobacter hamburgensis X14]
 gi|119361468|sp|Q1QL57|RECO_NITHX RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|91800665|gb|ABE63040.1| DNA replication and repair protein RecO [Nitrobacter hamburgensis
           X14]
          Length = 253

 Score =  323 bits (829), Expect = 1e-86,   Method: Composition-based stats.
 Identities = 95/241 (39%), Positives = 138/241 (57%), Gaps = 3/241 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W DD I+LGVR +GE + I+E++TR +GRHLG VR G   RM+P+LQ GN V   WR+
Sbjct: 1   MEWTDDGIVLGVRRHGESSAIVELLTRGHGRHLGLVRGGAGSRMRPLLQPGNSVSALWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG +  E      A LL +S   YG+  +  L R LPER+P   +++ L   L+ 
Sbjct: 61  RLDEHLGAYALEGTRMRAANLLGASHATYGVTHLASLARLLPERDPHDGIFERLERTLDD 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
                      ++ EL +L  +GFGLDL+ CV TG T +L++VSPKSGGAV R  G P+ 
Sbjct: 121 FDTAGEAAIHLIRFELAMLTELGFGLDLSTCVATGTTTELIYVSPKSGGAVSRQAGEPWR 180

Query: 181 EKMLVLPSFLW---KEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLL 237
           +++L LP FL    +E+       L   F+LT  FL ++ L+         R  F+  ++
Sbjct: 181 DRLLRLPPFLREADEEQSGWSDQDLLDGFELTGRFLLRHVLEPRGQGHSDARAGFINAVV 240

Query: 238 E 238
           +
Sbjct: 241 K 241


>gi|163850484|ref|YP_001638527.1| DNA repair protein RecO [Methylobacterium extorquens PA1]
 gi|240137548|ref|YP_002962019.1| DNA repair protein RecO [Methylobacterium extorquens AM1]
 gi|238687373|sp|A9W1K0|RECO_METEP RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|163662089|gb|ABY29456.1| DNA repair protein RecO [Methylobacterium extorquens PA1]
 gi|240007516|gb|ACS38742.1| DNA repair protein RecO [Methylobacterium extorquens AM1]
          Length = 246

 Score =  322 bits (826), Expect = 3e-86,   Method: Composition-based stats.
 Identities = 95/240 (39%), Positives = 138/240 (57%), Gaps = 6/240 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W DD +++G+R +GE  ++LE+MT ++GRHLG V  G+S RMQP+LQ GN +R  WR+
Sbjct: 1   MQWIDDGLVIGLRKHGETGVVLELMTPEHGRHLGLVHGGRSRRMQPMLQPGNTLRATWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL   LG +  E L  + ++L+ S L LYG+  +  L R LPER+P   LY+   I +  
Sbjct: 61  RLDGALGAYAVEPLTLNASRLMDSGLALYGVAHLSALLRLLPERDPHPALYEAAQILIAH 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P +   + V+ EL LL  +GFGLDL+ C  TG    L++VSPKSG AV  S G P+ 
Sbjct: 121 LDDPEIAPALMVRFELALLAGLGFGLDLSHCAATGANDALVYVSPKSGRAVSASAGEPFR 180

Query: 181 EKMLVLPSFLWKEEQT------IDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLG 234
           +++L LP FL   +Q        D   ++  F LT YFL+++  +         R  F+ 
Sbjct: 181 DRLLPLPPFLRDRDQPGSGWRTPDTHDVREGFTLTGYFLDQHVWRPRAQDTPEERARFVA 240


>gi|254560020|ref|YP_003067115.1| DNA repair protein RecO [Methylobacterium extorquens DM4]
 gi|254267298|emb|CAX23130.1| DNA repair protein RecO [Methylobacterium extorquens DM4]
          Length = 246

 Score =  322 bits (825), Expect = 3e-86,   Method: Composition-based stats.
 Identities = 96/240 (40%), Positives = 139/240 (57%), Gaps = 6/240 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W DD +++G+R +GE  ++LE+MT ++GRHLG V  G+S RMQP+LQ GN +R  WR+
Sbjct: 1   MQWIDDGLVIGLRKHGETGVVLELMTPEHGRHLGLVHGGRSRRMQPMLQPGNTLRATWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL   LG +  E L  + ++L+ S L LYG+  +  L R LPER+P   LY+   I +  
Sbjct: 61  RLDGALGAYAVEPLTLNASRLMDSGLALYGVAHLSALLRLLPERDPHPALYEAAQILIAH 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P +   + V+ EL LL  +GFGLDL+ C  TG    L++VSPKSG AV  S G P+ 
Sbjct: 121 LDDPEIAPALMVRFELALLAGLGFGLDLSHCAATGANDALVYVSPKSGRAVSASAGEPFR 180

Query: 181 EKMLVLPSFLWKEEQ------TIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLG 234
           +++L LP FL   +Q      T D   ++  F LT YFL+++  +         R  F+ 
Sbjct: 181 DRLLPLPPFLRDRDQSGSGWRTPDTHDVREGFTLTGYFLDQHVWRPRAQDTPEERARFVA 240


>gi|170748446|ref|YP_001754706.1| DNA repair protein RecO [Methylobacterium radiotolerans JCM 2831]
 gi|170654968|gb|ACB24023.1| DNA repair protein RecO [Methylobacterium radiotolerans JCM 2831]
          Length = 239

 Score =  322 bits (825), Expect = 3e-86,   Method: Composition-based stats.
 Identities = 103/234 (44%), Positives = 141/234 (60%), Gaps = 1/234 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W DDA++LG+R +GE  +ILE MT  +GRHLG V  G+S RMQP+LQAGN VR+ WR+
Sbjct: 1   MQWTDDALVLGLRRHGETGVILEAMTEAHGRHLGLVHGGRSRRMQPVLQAGNRVRLTWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL + LG +  E L+S  ++L+ SSL LYG+  +  L R LPER+P   LY+   I +  
Sbjct: 61  RLDEGLGSYAVEPLDSQVSRLIGSSLALYGMNHMAALLRLLPERDPHPALYEAAGILVEH 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P+V   + V+ EL +L  +GFGLDLT C  TG    L +VSPKSG AV  S G PY 
Sbjct: 121 LDDPAVAPPLMVRFELAILSELGFGLDLTACAATGGNDALAYVSPKSGRAVSASAGEPYR 180

Query: 181 EKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLG 234
           +++L LP+FL     +   D +   F LT YFL+++      +     R  F+ 
Sbjct: 181 DRLLALPTFL-HAGGSPGPDGVAQGFTLTGYFLDRHVWGPRGLGPPEERARFVA 233


>gi|254469353|ref|ZP_05082758.1| DNA repair protein RecO [Pseudovibrio sp. JE062]
 gi|211961188|gb|EEA96383.1| DNA repair protein RecO [Pseudovibrio sp. JE062]
          Length = 253

 Score =  322 bits (825), Expect = 4e-86,   Method: Composition-based stats.
 Identities = 102/244 (41%), Positives = 147/244 (60%), Gaps = 6/244 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M WQ + I++G R  GE NI+LEV+T   GR LG VR G+S R QP LQ GN + + WR+
Sbjct: 1   MQWQAEGIVIGTRKQGENNILLEVLTPDRGRCLGLVRGGRSRRQQPALQLGNHLNLTWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG F  E L+   A L+ ++  ++GLQS+    R LPER+P   L+  L++ L+ 
Sbjct: 61  RLDEHLGFFTVEPLQLRAAHLMQTARAIHGLQSLCAQIRLLPERDPHPNLFHALDVILDH 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
            + P +   + ++ EL LL  +GFGLDLT+C  TG T +L+WVSPKSG AVC++ G PYA
Sbjct: 121 LEDPQIGAALVLRFELELLNELGFGLDLTECAATGATDELIWVSPKSGRAVCKTAGQPYA 180

Query: 181 EKMLVLPSFL------WKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLG 234
            K+L LP FL        +   I    +++ F LT YFL KY  +   I     R++++ 
Sbjct: 181 SKLLTLPEFLKAPQARLSQNIQISKGDMEAGFSLTGYFLFKYIYEPRSIPWPPARDSYVT 240

Query: 235 KLLE 238
            L +
Sbjct: 241 ALKK 244


>gi|316934141|ref|YP_004109123.1| DNA repair protein RecO [Rhodopseudomonas palustris DX-1]
 gi|315601855|gb|ADU44390.1| DNA repair protein RecO [Rhodopseudomonas palustris DX-1]
          Length = 250

 Score =  321 bits (824), Expect = 4e-86,   Method: Composition-based stats.
 Identities = 96/244 (39%), Positives = 140/244 (57%), Gaps = 4/244 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W D+ IILGVR +GE   I+E++TR +GRHLG VR   S RM+P+LQ GN V  +WR+
Sbjct: 1   MDWSDEGIILGVRRHGEAGAIVELLTRSHGRHLGMVRGAASARMRPLLQPGNSVLASWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG ++ E  +   A LL+SS  +YG+  +  L R LPER+P  E+Y  L + L+ 
Sbjct: 61  RLDEHLGYYQLEATKMRAATLLASSHAVYGVTHLASLARLLPERDPHEEIYHRLILTLDD 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
                +     ++ EL +L  +GFGLDL+ C  TG T +L++VSPKSG AV R  G P+ 
Sbjct: 121 FDDLGIAAAHLIRFELAILAELGFGLDLSACAATGATTELIYVSPKSGSAVSRIAGEPWR 180

Query: 181 EKMLVLPSFLWKEEQTIDA----DSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKL 236
           +++L LP FL  +E   ++      L   F LT  FL +  L+         R  F+  +
Sbjct: 181 DRLLRLPPFLRDDEAASESGWSGQDLFDGFALTGRFLLRNVLEPRGQGHSDARAGFINAV 240

Query: 237 LELI 240
              +
Sbjct: 241 TRAL 244


>gi|27380169|ref|NP_771698.1| DNA repair protein RecO [Bradyrhizobium japonicum USDA 110]
 gi|30179751|sp|Q9RH67|RECO_BRAJA RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|27353323|dbj|BAC50323.1| recO-like protein [Bradyrhizobium japonicum USDA 110]
          Length = 250

 Score =  320 bits (822), Expect = 7e-86,   Method: Composition-based stats.
 Identities = 97/240 (40%), Positives = 138/240 (57%), Gaps = 2/240 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W D+ I+LGVR +GE + I+E++TR +GRHLG VR G   RM+P+LQ GN V   WR+
Sbjct: 1   MEWTDEGIVLGVRRHGESSAIVELLTRAHGRHLGLVRGGAGSRMRPLLQPGNSVSAVWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG +  E L+   A LL+SS  +YG+  +  + R LPER+P  E++ +L   L+ 
Sbjct: 61  RLDEHLGTYAVEGLKLRAATLLASSHGVYGVTHLASIARLLPERDPHEEIFGLLEHSLDD 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
                      +  EL +L  +GFGL L  C VTG T DL++VSPKSGGAV R  G P+ 
Sbjct: 121 FDDIGSAAVHVIHFELAMLAELGFGLALDNCAVTGETTDLIYVSPKSGGAVSRGAGEPWR 180

Query: 181 EKMLVLPSFLWKEEQTID--ADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLE 238
           +++L LP FL   E   +     L+  F+LT  FL ++ L+         R  F+  L  
Sbjct: 181 DRLLRLPPFLRHGETATELTDQDLQDGFRLTGLFLLRHVLEPRGQVHSDARAGFINALTR 240


>gi|6655025|gb|AAF22872.1| recO-like protein [Bradyrhizobium japonicum]
          Length = 250

 Score =  320 bits (822), Expect = 8e-86,   Method: Composition-based stats.
 Identities = 97/240 (40%), Positives = 138/240 (57%), Gaps = 2/240 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W D+ I+LGVR +GE + I+E++TR +GRHLG VR G   RM+P+LQ GN V   WR+
Sbjct: 1   MEWTDEGIVLGVRRHGESSAIVELLTRAHGRHLGLVRGGAGSRMRPLLQPGNSVTAVWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG +  E L+   A LL+SS  +YG+  +  + R LPER+P  E++ +L   L+ 
Sbjct: 61  RLDEHLGTYAVEGLKLRAATLLASSHGVYGVTHLASIARLLPERDPHEEIFGLLEHSLDD 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
                      +  EL +L  +GFGL L  C VTG T DL++VSPKSGGAV R  G P+ 
Sbjct: 121 FDDIGSAAVHVIHFELAMLAELGFGLALDNCAVTGETTDLIYVSPKSGGAVSRGAGEPWR 180

Query: 181 EKMLVLPSFLWKEEQTID--ADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLE 238
           +++L LP FL   E   +     L+  F+LT  FL ++ L+         R  F+  L  
Sbjct: 181 DRLLRLPPFLRHGETATELTDQDLQDGFRLTGLFLLRHVLEPRGQVHSDARAGFINALTR 240


>gi|49474068|ref|YP_032110.1| DNA repair protein RecO [Bartonella quintana str. Toulouse]
 gi|61215004|sp|Q6G080|RECO_BARQU RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|49239572|emb|CAF25929.1| DNA repair protein recO [Bartonella quintana str. Toulouse]
          Length = 243

 Score =  320 bits (822), Expect = 8e-86,   Method: Composition-based stats.
 Identities = 101/235 (42%), Positives = 146/235 (62%), Gaps = 1/235 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W++ A+ILG R YGE +IILEVMTRQ+GR++G V+ G S RM  +LQ GN V   W +
Sbjct: 1   MKWKEQAVILGTRQYGETSIILEVMTRQHGRYMGIVKGGHSRRMAGLLQPGNFVEAEWWA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG FR E L+ + A+L+     LY LQ IV   R LPER+P   LYD+L++F+  
Sbjct: 61  RLDEHLGLFRLEALDLYAARLILLPEALYALQLIVFHLRLLPERDPYPSLYDILHLFMQN 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
                V  ++ V+ E+ LL+ +GFGLDL++C  TG  + L +VSPKSG AVC   G P+ 
Sbjct: 121 FDESFVNAELLVRFEMRLLEELGFGLDLSRCAATGRQERLFYVSPKSGRAVCEEAGRPWK 180

Query: 181 EKMLVLPSFLWKE-EQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLG 234
           EK+L LP FL +   + ++   + + F LT +FL ++  +   I    +R N + 
Sbjct: 181 EKLLTLPQFLVRRAIRPVNFSDIINGFILTGFFLMRHVWEPRGIKQPSVRVNLIQ 235


>gi|260432760|ref|ZP_05786731.1| DNA repair protein RecO [Silicibacter lacuscaerulensis ITI-1157]
 gi|260416588|gb|EEX09847.1| DNA repair protein RecO [Silicibacter lacuscaerulensis ITI-1157]
          Length = 241

 Score =  317 bits (814), Expect = 7e-85,   Method: Composition-based stats.
 Identities = 89/242 (36%), Positives = 130/242 (53%), Gaps = 3/242 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D  I+L  R +GE   I+EV T  +GRH G VR G S ++ PILQ G  + V WR+
Sbjct: 1   MDWRDHGILLTARRHGETAAIIEVFTETHGRHAGVVRGGASRKIAPILQPGAQLDVLWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLN 119
           RL +++G F+ E L S  A   S  L L GL ++V L  F LPEREP   +Y      ++
Sbjct: 61  RLQEHIGTFQVEPLRSRAAAAFSGRLALSGLNAVVALLSFFLPEREPHPGIYRQTEQLMD 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                 +    +++ EL LL+ +GFGLDLT+C VTG T+ L +VSPK+G AV       +
Sbjct: 121 LLGQDEIWPLAYLRWELALLEELGFGLDLTRCAVTGTTEGLAYVSPKTGRAVSAEGAGDW 180

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFL-NKYALQHNIIHCHLLRENFLGKLLE 238
           A+++L LP  L  +    D D + +  + T YFL ++ A           R  F+ +   
Sbjct: 181 ADRLLPLPPVLRGQGGAPD-DEIAAGLRTTGYFLAHRVAPSLGHTPLPEARARFVDQFTR 239

Query: 239 LI 240
            +
Sbjct: 240 RL 241


>gi|114705890|ref|ZP_01438793.1| DNA repair protein RecO [Fulvimarina pelagi HTCC2506]
 gi|114538736|gb|EAU41857.1| DNA repair protein RecO [Fulvimarina pelagi HTCC2506]
          Length = 241

 Score =  316 bits (811), Expect = 1e-84,   Method: Composition-based stats.
 Identities = 93/236 (39%), Positives = 148/236 (62%), Gaps = 1/236 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+++ ++LGVR +GE ++I E+MTR  GRHLG VR G+S  M+P+LQ GN V  +WR+
Sbjct: 1   MEWREEGVVLGVRRHGETSVIAELMTRSRGRHLGLVRGGRSKAMRPVLQPGNSVMAHWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL +++G F  E + S    L+ S++ L+G+Q      R L ER+P   LYD L + +  
Sbjct: 61  RLDEHMGAFALEPVASRAGGLMESTVGLHGVQLAASHLRLLAERDPHPRLYDGLIVLIEN 120

Query: 121 HKIPSV-IGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                +  G++ ++ EL +L+ +GFGLDL +C  +G  +DL++VSPKSG AV R  G PY
Sbjct: 121 LNADRLTAGELMLRFELAVLEELGFGLDLARCAASGTKEDLVYVSPKSGRAVSREPGEPY 180

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGK 235
            +K+L LP+FL   ++  D ++L++ F LT YFL+++  +   +     R +F+  
Sbjct: 181 HDKLLALPAFLTDTDRAADGETLRTGFTLTRYFLSRHVYEPRGLDEPHSRTSFISA 236


>gi|188580258|ref|YP_001923703.1| DNA repair protein RecO [Methylobacterium populi BJ001]
 gi|238692877|sp|B1ZA19|RECO_METPB RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|179343756|gb|ACB79168.1| DNA repair protein RecO [Methylobacterium populi BJ001]
          Length = 246

 Score =  316 bits (810), Expect = 2e-84,   Method: Composition-based stats.
 Identities = 94/240 (39%), Positives = 139/240 (57%), Gaps = 6/240 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W D+ +++G+R +GE  ++LE+MT ++GRHLG V  G+S RMQP+LQ GN +R  WR+
Sbjct: 1   MQWIDEGLVIGLRKHGETGVVLELMTLEHGRHLGLVHGGRSRRMQPMLQPGNTLRATWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL   LG +  E L  + ++L+ S L LYG+  +  L R LPER+P   LY+   + +  
Sbjct: 61  RLDGALGSYAVEPLTLNASRLMDSGLALYGIGHLSTLLRLLPERDPHPALYEAAQVLIAH 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P +   + V+ EL LL  +GFGLDL+ C  TG    L++VSPKSG AV  S G P+ 
Sbjct: 121 LDEPEIAPALMVRFELALLAGLGFGLDLSHCAATGANDALVYVSPKSGRAVSASAGEPFR 180

Query: 181 EKMLVLPSFLWKEEQT------IDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLG 234
           +++L LP FL   +Q        DA  ++  F LT YFL+++  +         R  F+ 
Sbjct: 181 DRLLALPPFLRDRDQPGSGWRTPDAHDVREGFTLTGYFLDQHVWRPRAQDTPEERARFVA 240


>gi|254485777|ref|ZP_05098982.1| DNA repair protein RecO [Roseobacter sp. GAI101]
 gi|214042646|gb|EEB83284.1| DNA repair protein RecO [Roseobacter sp. GAI101]
          Length = 241

 Score =  314 bits (806), Expect = 6e-84,   Method: Composition-based stats.
 Identities = 93/242 (38%), Positives = 128/242 (52%), Gaps = 3/242 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D  I+L  R +GE + I+EV T   GRH G VR G S ++ PILQ G  + V WR+
Sbjct: 1   MEWRDQGILLSARRHGETSAIIEVFTPTQGRHAGIVRGGTSRKIAPILQPGAQLDVAWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLN 119
           RL  ++G F  E + S     +S  L L GL ++  L  F LPEREP   LY      L+
Sbjct: 61  RLEGHIGAFTVEPVRSRAVSAMSDRLSLAGLNTVTALLSFCLPEREPHPPLYHRTQALLD 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                 +    ++Q EL LL+ +G+GLDLT C VTG T  L++VSPKSG AV R     +
Sbjct: 121 LLDQGDLWPLAYLQWELSLLEEMGYGLDLTACAVTGATDALVFVSPKSGRAVTREGAGEW 180

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQH-NIIHCHLLRENFLGKLLE 238
           A+KML LP  L  E +  D + L   F+ T YFL ++  ++         R  ++     
Sbjct: 181 ADKMLPLPPVLLGEGEARDDEIL-QGFKTTGYFLEQHLARNLGGRPLPEARARYVDAFSR 239

Query: 239 LI 240
            I
Sbjct: 240 QI 241


>gi|148256029|ref|YP_001240614.1| DNA repair protein RecO [Bradyrhizobium sp. BTAi1]
 gi|166221886|sp|A5EKL4|RECO_BRASB RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|146408202|gb|ABQ36708.1| DNA replication and repair protein RecO [Bradyrhizobium sp. BTAi1]
          Length = 248

 Score =  314 bits (804), Expect = 1e-83,   Method: Composition-based stats.
 Identities = 99/241 (41%), Positives = 139/241 (57%), Gaps = 2/241 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W DD I+LG+R +GE + +LE++TR++GRHLG VR     RM+P+LQ GN VR  WR+
Sbjct: 1   MEWTDDGIVLGLRRHGESSAVLELLTREHGRHLGLVRGASGARMRPMLQPGNTVRAVWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG +  + L    A+L+S +   YG+  +  L R LPER+P  E+Y  L   L+ 
Sbjct: 61  RLDEHLGMYAIDGLTLRAAELMSVAHGAYGVTHLAALARLLPERDPHQEMYLRLEHALDD 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
                      V+ EL +L  +GFGLDL  C  TG T DL++VSPKSGGAV RS G P+A
Sbjct: 121 FAEAGGAAVHIVRFELAILAELGFGLDLESCAATGETTDLVYVSPKSGGAVSRSAGAPWA 180

Query: 181 EKMLVLPSFLWKEEQ--TIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLE 238
           +++L LP FL + E         L   F+LT  FL ++ L+         RE F+  +  
Sbjct: 181 DRLLPLPPFLRESEDDHGFSDQDLLDGFRLTGLFLLRHVLEPRGQGHSDAREGFINAVTR 240

Query: 239 L 239
            
Sbjct: 241 A 241


>gi|328543511|ref|YP_004303620.1| DNA repair protein recO [polymorphum gilvum SL003B-26A1]
 gi|326413255|gb|ADZ70318.1| DNA repair protein recO [Polymorphum gilvum SL003B-26A1]
          Length = 253

 Score =  313 bits (803), Expect = 1e-83,   Method: Composition-based stats.
 Identities = 108/240 (45%), Positives = 145/240 (60%), Gaps = 4/240 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W +D IILG RS+GE  ++LE+MTR+ GRHLG VR G+S R QP+LQ GNLVR  WR+
Sbjct: 1   MEWSEDGIILGTRSHGESGVVLELMTRRRGRHLGLVRGGRSRRQQPVLQPGNLVRATWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           R+A  LG F  E L+     L+ S+L L+ LQ +  L R LPER+    LYD L I L+ 
Sbjct: 61  RIADQLGAFTVEPLQLRAGALMDSALALHALQHLAGLLRLLPERDAHERLYDALTIVLDH 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
                + G + V+ EL LL  +GFGLDLT+C  TG   DL +VSPKSG AV R  G PY 
Sbjct: 121 LGEAMIAGPLIVRFELELLNELGFGLDLTRCAATGQLWDLAYVSPKSGRAVSRDAGAPYR 180

Query: 181 EKMLVLPSFLWKEEQTIDAD----SLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKL 236
           +++L LPSFL + E+   ++     +    +LT +FL ++ L+       L RE  +  L
Sbjct: 181 DQLLPLPSFLVEGERQPGSEITFADISQGLRLTAFFLARHVLEPQGHAPSLSREELVKAL 240


>gi|307946583|ref|ZP_07661918.1| DNA repair protein RecO [Roseibium sp. TrichSKD4]
 gi|307770247|gb|EFO29473.1| DNA repair protein RecO [Roseibium sp. TrichSKD4]
          Length = 256

 Score =  313 bits (802), Expect = 1e-83,   Method: Composition-based stats.
 Identities = 98/242 (40%), Positives = 141/242 (58%), Gaps = 4/242 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W    I+LG R +GE ++ILEVMT  YGRHLG VR G+S   QP +Q GN ++V WR+
Sbjct: 1   MEWTATGIVLGSRKHGENDVILEVMTETYGRHLGLVRGGRSRTRQPQIQPGNELQVTWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL + LG +  E L    A+L++S L L+G+Q +  L R LPER+P   LY  L + L+ 
Sbjct: 61  RLPEQLGTYSIEPLRLRAAELMASPLGLHGVQHLGALLRMLPERDPHAALYRALTLVLDQ 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
            +   +   + ++ EL LL  +GFGLDL+ C  TG  +DL +VSPKSG AV R  G PY 
Sbjct: 121 LQDGDIGPPLLIRFELELLNELGFGLDLSCCAATGSQEDLAYVSPKSGRAVSRDAGQPYH 180

Query: 181 EKMLVLPSFLWKEEQTIDAD----SLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKL 236
           +K+L LP FL   ++   ++     L + F+LT +FL ++           LR+  L  +
Sbjct: 181 DKLLPLPDFLIDGQRQPGSELLFKDLSNGFKLTRFFLARHEKWQTDPAIESLRQQLLQTI 240

Query: 237 LE 238
            +
Sbjct: 241 EK 242


>gi|149913474|ref|ZP_01902007.1| DNA repair protein RecO [Roseobacter sp. AzwK-3b]
 gi|149812594|gb|EDM72423.1| DNA repair protein RecO [Roseobacter sp. AzwK-3b]
          Length = 244

 Score =  313 bits (802), Expect = 2e-83,   Method: Composition-based stats.
 Identities = 83/238 (34%), Positives = 128/238 (53%), Gaps = 4/238 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D  I+L  R++GE ++I+EV T ++GRH G VR G S ++ P+LQ G  + + WR+
Sbjct: 1   MEWRDQGILLSTRTHGETSVIIEVFTPEHGRHAGVVRGGTSRKLAPVLQPGAQLDLRWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLN 119
           RL  ++G F  E + S  A  +   L L GL ++  L  F LP+RE    LY      L+
Sbjct: 61  RLEDHIGTFTVEPVRSRAAASMGDRLSLAGLNAVTALLLFCLPDREAHRRLYRRTEALLD 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTG-VTQDLLWVSPKSGGAVCRSVGLP 178
                 V    ++  E+ LL  +GFGLDL+ C V G    DL +VSP+SG AV R+    
Sbjct: 121 LLGQGDVWPLAYLNWEMALLDEMGFGLDLSGCAVMGPQANDLSYVSPRSGRAVSRAGAGE 180

Query: 179 YAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYA-LQHNIIHCHLLRENFLGK 235
           +A+++L LP+ L       DA+ +   FQ+T +FL  +   +         R+ F+ +
Sbjct: 181 WADRLLPLPACLLGAGPAPDAE-VAEGFQVTGHFLQNHLAPELGNKPLPAARQRFVDR 237


>gi|146341374|ref|YP_001206422.1| DNA repair protein RecO [Bradyrhizobium sp. ORS278]
 gi|166221887|sp|A4YWC5|RECO_BRASO RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|146194180|emb|CAL78201.1| putative DNA repair protein RecO (Recombination protein O)
           [Bradyrhizobium sp. ORS278]
          Length = 248

 Score =  312 bits (801), Expect = 2e-83,   Method: Composition-based stats.
 Identities = 97/241 (40%), Positives = 140/241 (58%), Gaps = 2/241 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W DD I+LG+R +GE + ++E++TR++GRHLG VR     RM+P+LQ GN VR  WR+
Sbjct: 1   MEWTDDGIVLGLRRHGESSAVVELLTREHGRHLGLVRGAAGKRMRPVLQPGNTVRAIWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG +  + L    A+L+S+S   YG+  +  L R LPER+P  ++Y  L   L+ 
Sbjct: 61  RLDEHLGMYAVDGLTLRAAELMSASHGAYGVTHLASLARLLPERDPHEDMYFRLEHALDD 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
                      V+ EL +L  +GFGLDL  C  TG T DL++VSPKSGGAV R+ G P+A
Sbjct: 121 FADAGAAAAHIVRFELAILTELGFGLDLESCAATGETSDLIYVSPKSGGAVSRTAGAPWA 180

Query: 181 EKMLVLPSFLW--KEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLE 238
           +++L LP FL    E+       L   F+LT  FL ++ L+         RE F+  +  
Sbjct: 181 DRLLPLPPFLRESDEDHGWSDQDLLDGFRLTGLFLLRHVLEPRGQGHSDAREGFINAVTR 240

Query: 239 L 239
            
Sbjct: 241 A 241


>gi|304392068|ref|ZP_07374010.1| DNA repair protein RecO [Ahrensia sp. R2A130]
 gi|303296297|gb|EFL90655.1| DNA repair protein RecO [Ahrensia sp. R2A130]
          Length = 241

 Score =  312 bits (801), Expect = 2e-83,   Method: Composition-based stats.
 Identities = 94/240 (39%), Positives = 141/240 (58%), Gaps = 4/240 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W D AI+LGVR +GE +++ E+MTRQ GRHLG V  G+S  M+PILQ GN V   WR+
Sbjct: 1   MEWTDQAIVLGVRKHGETSVVAELMTRQRGRHLGLVHGGRSRTMRPILQPGNRVTATWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG+FR E      A+L+ +   +Y LQ++    R L ER+   +LYD L++ L+ 
Sbjct: 61  RLDEHLGQFRIEADNLRAARLMETDYAIYALQTLASHLRLLAERDAHPQLYDTLDLVLDA 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P+  G++ ++ EL LL  +GFGLDL  C  TG   +L+ VSP++G AV  +   PY 
Sbjct: 121 LDNPAAAGELVIRFELALLDELGFGLDLNACAATGARANLVSVSPRTGRAVSGAAAAPYG 180

Query: 181 EKMLVLPSFLW----KEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKL 236
           +++L LPSFL           D ++L   F LT +FL++       I+    R++ +  +
Sbjct: 181 DRLLALPSFLTTAQADRTSGADEETLAQGFALTGHFLHRNVFGARGINPPAERDSLIRAV 240


>gi|255263314|ref|ZP_05342656.1| DNA repair protein RecO [Thalassiobium sp. R2A62]
 gi|255105649|gb|EET48323.1| DNA repair protein RecO [Thalassiobium sp. R2A62]
          Length = 242

 Score =  312 bits (800), Expect = 2e-83,   Method: Composition-based stats.
 Identities = 83/239 (34%), Positives = 124/239 (51%), Gaps = 3/239 (1%)

Query: 2   YWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSR 61
            W+D+  +L VR +GE   I+E+ T ++GRH G VR G S ++ PILQ G  + V W++R
Sbjct: 3   QWRDEGALLSVRRHGESAAIVEIFTAEHGRHAGIVRGGTSRKIAPILQPGAQLDVVWKAR 62

Query: 62  LAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLNC 120
           L ++LG F  E + S  A ++S  L L GL ++  L  F +PERE    LY    + ++ 
Sbjct: 63  LEEHLGSFSVEPVRSRAAAVMSDRLALAGLNAVCALLAFAMPEREAHPSLYRQSTVLMDL 122

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
                     +++ EL LL+ +GFGLDL  C VTG  + L +VSPKSG AV       +A
Sbjct: 123 LGNTDAWPLAYLRWELALLEELGFGLDLGSCAVTGSVEGLCYVSPKSGRAVSAEGAGEWA 182

Query: 181 EKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNI-IHCHLLRENFLGKLLE 238
           +++L LP  L       DA+ L    + T YFL  +  +          R   +  L+ 
Sbjct: 183 DRLLPLPDVLLGVGSAPDAEIL-QGLETTGYFLEHWLARALGDRPVPDARGRMVDALVR 240


>gi|163744852|ref|ZP_02152212.1| DNA repair protein RecO [Oceanibulbus indolifex HEL-45]
 gi|161381670|gb|EDQ06079.1| DNA repair protein RecO [Oceanibulbus indolifex HEL-45]
          Length = 240

 Score =  312 bits (799), Expect = 3e-83,   Method: Composition-based stats.
 Identities = 84/242 (34%), Positives = 121/242 (50%), Gaps = 4/242 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D  I+L  R +GE + I+EV T + GRH G VR G S ++ P LQ G  + + WR+
Sbjct: 1   MEWRDQGILLSARRHGETSAIIEVFTPEQGRHAGIVRGGTSRKIAPSLQPGAQLDLAWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLN 119
           RL  ++G F  E L S  A  +   L L GL ++  L  F LPEREP   LY      L+
Sbjct: 61  RLEDHIGAFTVEPLRSRAAVAMQDRLALAGLNAVTALLSFCLPEREPHPALYRRTETLLD 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                 V    +++ EL LL+ +G+ LDL  C VTGV++DL++VSPKSG AV       +
Sbjct: 121 MLGQGDVWPLAYLKWELRLLEEMGYALDLESCAVTGVSEDLIYVSPKSGRAVSAKGAGEW 180

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQH-NIIHCHLLRENFLGKLLE 238
           AE++L LP+ L           +      T +FL  +  +          R  F+     
Sbjct: 181 AERLLPLPAVL--RGGAGSDAEIAQGLVTTGHFLTAHLARDLGGKPLPESRARFIDAFSR 238

Query: 239 LI 240
            +
Sbjct: 239 RL 240


>gi|56698028|ref|YP_168399.1| DNA repair protein RecO [Ruegeria pomeroyi DSS-3]
 gi|61214680|sp|Q5LNK7|RECO_SILPO RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|56679765|gb|AAV96431.1| DNA repair protein RecO, putative [Ruegeria pomeroyi DSS-3]
          Length = 241

 Score =  310 bits (796), Expect = 8e-83,   Method: Composition-based stats.
 Identities = 94/241 (39%), Positives = 134/241 (55%), Gaps = 5/241 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D  I+L VR +GE + I++  T  +GRH G VR G S R+ PILQ G  + ++WR+
Sbjct: 1   MDWRDQGILLAVRRHGETSAIIDTFTASHGRHAGVVRGGTSRRIAPILQPGAQLDLSWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLN 119
           RL  +LG F  E L S  A  +S  L L GL ++V L  F LPERE    LY      L+
Sbjct: 61  RLEDHLGSFTVEPLRSRAAAAMSGRLALAGLNAVVSLLSFCLPEREAHPRLYKQSEQLLD 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                 +    +++ EL LL  +GFGLDL+ C VTG + DL++VSP+SG AV       +
Sbjct: 121 LLGQDEIWPLAYLRWELALLDTLGFGLDLSSCAVTGNSDDLVYVSPRSGRAVSAGAAGEW 180

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLEL 239
           AE++L LP  L  E    D + +  A + T +FL  + +   + H  L +    G+LL+L
Sbjct: 181 AERLLPLPPCLRGEGPAPDPE-IAQALRTTGHFLE-HRVAPALGHAPLPQAR--GRLLDL 236

Query: 240 I 240
           I
Sbjct: 237 I 237


>gi|158423630|ref|YP_001524922.1| recombination protein O [Azorhizobium caulinodans ORS 571]
 gi|158330519|dbj|BAF88004.1| recombination protein O [Azorhizobium caulinodans ORS 571]
          Length = 245

 Score =  309 bits (793), Expect = 2e-82,   Method: Composition-based stats.
 Identities = 92/240 (38%), Positives = 134/240 (55%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W D  I+LGVR +GE + I+++MTR+ GRH G VR G S R+  +LQ GN +   WR+
Sbjct: 1   MEWTDAGIVLGVRRHGETSAIVDLMTRERGRHAGLVRGGGSRRLAALLQPGNTLHATWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL   LG    E L      ++ S+   +G+  +V L R LPER+P   L+  L+  L+ 
Sbjct: 61  RLEGQLGLMTVEPLTLRSDAIMRSAHGSFGVTHLVGLMRLLPERDPHPGLFASLDAILDA 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P+  G++  + E+ LL  +GFGLDLT C  TG   DL +VSP+SG AV RS G PYA
Sbjct: 121 FDEPAHAGELLARFEMALLVELGFGLDLTTCAATGGNNDLAYVSPRSGRAVSRSAGEPYA 180

Query: 181 EKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLELI 240
           +K+  LP+FL           ++ A ++T +FL+   L+   +     R +FL  L   +
Sbjct: 181 DKLFGLPTFLIGGIVPPSLPDMEEALRMTGFFLSTRVLEPRGLALGEARASFLAALRRAL 240


>gi|254461391|ref|ZP_05074807.1| DNA repair protein RecO [Rhodobacterales bacterium HTCC2083]
 gi|206677980|gb|EDZ42467.1| DNA repair protein RecO [Rhodobacteraceae bacterium HTCC2083]
          Length = 244

 Score =  309 bits (792), Expect = 2e-82,   Method: Composition-based stats.
 Identities = 89/243 (36%), Positives = 131/243 (53%), Gaps = 5/243 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D  I+L VR +GE N I++V T ++GRH G VR G S ++ PILQ G  + V+WR+
Sbjct: 1   MEWRDQGILLSVRRHGETNAIIDVFTIEHGRHAGIVRGGTSRKIAPILQPGAQLDVSWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLN 119
           RL  +LG +  E L S  A  L   L L GL ++  L  F LPERE    LY      L+
Sbjct: 61  RLEDHLGTYTVEPLRSRAAAALGDRLSLAGLNAVTALLAFALPEREANTRLYKQSEQLLD 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                 V    +++ E+ LL+  G GLDL+ C VTG  ++L+++SP++G AV   V  P+
Sbjct: 121 LLGQHEVWPLAYLRFEMALLEACGMGLDLSACAVTGTNENLIYISPRTGRAVSEQVAGPW 180

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHN--IIHCHLLRENFLGKLL 237
             K+L LP  L  +    DA+ ++ A + T YFL++  L  +         R  ++    
Sbjct: 181 VNKLLPLPPILIGQGMGSDAE-IEQALRTTGYFLSQ-KLAPSLGNRSLPEARGRYVDLFS 238

Query: 238 ELI 240
            LI
Sbjct: 239 RLI 241


>gi|85705116|ref|ZP_01036216.1| DNA repair protein RecO [Roseovarius sp. 217]
 gi|85670438|gb|EAQ25299.1| DNA repair protein RecO [Roseovarius sp. 217]
          Length = 244

 Score =  308 bits (791), Expect = 3e-82,   Method: Composition-based stats.
 Identities = 87/239 (36%), Positives = 127/239 (53%), Gaps = 5/239 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D  I+L  R +GE  +I+EV T + GRH G VR G S +M PILQ G  + + WR+
Sbjct: 1   MDWRDQGILLSSRRHGESAVIIEVFTPERGRHAGVVRGGASRKMAPILQPGAQLDLEWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLN 119
           RL  ++G FR E + S    +L + L L GL ++  L  F LPERE    LY+     L+
Sbjct: 61  RLEDHIGTFRVEPVRSRAG-VLGNPLTLAGLNAVCALLLFALPEREAHGALYERTETLLD 119

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVT-QDLLWVSPKSGGAVCRSVGLP 178
                 V    ++  EL LL+++GFGLDL+ C V G    DL ++SP++G AV R+    
Sbjct: 120 LLAESEVWPLAYLHWELALLEDLGFGLDLSTCAVMGEKANDLSYISPRTGRAVSRAGAGE 179

Query: 179 YAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYA-LQHNIIHCHLLRENFLGKL 236
           + +K+L LP  L       DA+ L     +T +FL  +   Q         RE F+ ++
Sbjct: 180 WVDKLLPLPPCLMGHGPAPDAEIL-QGLTVTGHFLRTHLAPQMRNKPLPEARERFVARM 237


>gi|110678689|ref|YP_681696.1| DNA repair protein RecO [Roseobacter denitrificans OCh 114]
 gi|119361483|sp|Q16AI3|RECO_ROSDO RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|109454805|gb|ABG31010.1| DNA repair protein RecO [Roseobacter denitrificans OCh 114]
          Length = 241

 Score =  308 bits (790), Expect = 3e-82,   Method: Composition-based stats.
 Identities = 82/236 (34%), Positives = 121/236 (51%), Gaps = 3/236 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+++ I+L  R +GE   I+EV T  +GRH G VR G S ++ PILQ G  + + WR+
Sbjct: 1   MEWREEGILLSTRRHGESAAIIEVFTPSHGRHAGVVRGGTSRKIAPILQPGAQLDLTWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLN 119
           RL  ++G F  E + S  A  +   L L GL ++  L  F LPERE    LY      L+
Sbjct: 61  RLEDHIGSFLVEPVRSRAAAAMGDRLALAGLNAVTALLGFCLPEREAHRPLYVETERLLD 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                 +    +++ E+ LL ++G+ L L  C VTG   DL++VSPKSG AV       +
Sbjct: 121 LLGEGEIWPLAYLRWEVQLLHDMGYALALEACAVTGQRDDLIYVSPKSGRAVSAKGAGDW 180

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQH-NIIHCHLLRENFLG 234
           A+++L LP  L       DA+ +  AF  T YFL ++  +          R  F+ 
Sbjct: 181 ADRLLPLPPILRGIGGGPDAE-IAQAFITTGYFLTEHLARDLGGKPLPEARARFVE 235


>gi|254466686|ref|ZP_05080097.1| DNA repair protein RecO [Rhodobacterales bacterium Y4I]
 gi|206687594|gb|EDZ48076.1| DNA repair protein RecO [Rhodobacterales bacterium Y4I]
          Length = 241

 Score =  308 bits (789), Expect = 4e-82,   Method: Composition-based stats.
 Identities = 89/243 (36%), Positives = 128/243 (52%), Gaps = 5/243 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D  I+L VR +GE + I++V T  +GRH G VR G   RM PILQ G  + V WR+
Sbjct: 1   MEWRDHGILLSVRRHGESSAIIDVFTEGHGRHAGVVRGGAGRRMAPILQPGAQLDVTWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLN 119
           RL  +LG +  E L S  A  LS  L L GL ++  L  F LPEREP  +LY      L+
Sbjct: 61  RLEDHLGSYHAEPLRSRAAAALSGRLALAGLNTVTALLSFCLPEREPHPDLYTRSEQLLD 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                 +    +++ EL LL+ +GFGLDL+ C VTG    L ++SPK+G AV R     +
Sbjct: 121 LLGNEDLWPLAYLRWELALLEEMGFGLDLSACAVTGSRFGLAYISPKTGRAVSREGAGDW 180

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHN--IIHCHLLRENFLGKLL 237
           A+++L LP  +  +    DA+ +  A + T +FL  + L  +         R   +  L 
Sbjct: 181 ADRLLPLPPVMLGQGSAADAE-IVQALRATGFFLEAH-LAPSLGNHPLPEARGRLMDLLS 238

Query: 238 ELI 240
             +
Sbjct: 239 RRL 241


>gi|254450984|ref|ZP_05064421.1| DNA repair protein RecO [Octadecabacter antarcticus 238]
 gi|198265390|gb|EDY89660.1| DNA repair protein RecO [Octadecabacter antarcticus 238]
          Length = 242

 Score =  305 bits (782), Expect = 3e-81,   Method: Composition-based stats.
 Identities = 78/240 (32%), Positives = 126/240 (52%), Gaps = 3/240 (1%)

Query: 2   YWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSR 61
            W+D+  ++ VR +GE + I+EV T   G   G VR G S ++ P LQ G  + V W++R
Sbjct: 3   EWRDEGALIRVRKHGESSAIIEVFTPSRGLTAGIVRGGTSRKIAPTLQPGAQLDVTWKAR 62

Query: 62  LAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLNC 120
           L  +LG F  E + S  A+++   L L GL ++  L  F LP+RE   +LY      L+ 
Sbjct: 63  LEDHLGSFTVEPIRSRTAQVMQDRLALAGLNAVTGLLSFLLPDREAHAQLYARTIQLLDL 122

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
                V    ++Q E+ LL  +GFG+DL+ C V+G+  DL +VSP++G AV R     +A
Sbjct: 123 LGQNDVWPLAYLQWEIALLDEMGFGMDLSACAVSGLNDDLFYVSPRTGRAVSRLAAGEWA 182

Query: 181 EKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQH-NIIHCHLLRENFLGKLLEL 239
           +++L LP  L  +    D + +  A + T +FLN +  +    +     R+  +  +  L
Sbjct: 183 DRLLPLPHVLLGKGDA-DLNEIVLALRTTGHFLNNHLAKSLGNLPIPEARQRLIDAMKRL 241


>gi|83858198|ref|ZP_00951720.1| DNA repair protein RecO [Oceanicaulis alexandrii HTCC2633]
 gi|83853021|gb|EAP90873.1| DNA repair protein RecO [Oceanicaulis alexandrii HTCC2633]
          Length = 242

 Score =  304 bits (779), Expect = 7e-81,   Method: Composition-based stats.
 Identities = 83/237 (35%), Positives = 127/237 (53%), Gaps = 2/237 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W     I+ VR +GE + ++EV+T ++GRH G VR G+S  M+PILQ GN +R  WR+
Sbjct: 1   MEWTASGRIVAVRPHGETSAVIEVLTAEHGRHAGLVRGGRSKAMRPILQPGNRIRAVWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLN 119
           RL  +LG F  E  +     L+   L L GL +   +    LPERE    + D   + ++
Sbjct: 61  RLESHLGGFAVEAEDLSAGVLMEDPLALSGLNAACAMASICLPEREEHPAVADAFEVLIS 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
             + P +   ++V+ E  LL ++G+GLDL +C  TGV   L++VSPKSG AV    G PY
Sbjct: 121 ALEDPDLWPALYVRWEAGLLADLGYGLDLRRCAATGVETGLVYVSPKSGRAVSAEAGEPY 180

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKL 236
            ++ML LP F+    Q  +   + +  +LT +F+ +  L          R   + +L
Sbjct: 181 RDRMLALPGFMKGGGQVSE-GDVGAGLKLTAHFIERRVLWPADRMLPDARTRMIERL 236


>gi|220923264|ref|YP_002498566.1| DNA repair protein RecO [Methylobacterium nodulans ORS 2060]
 gi|254764644|sp|B8IL75|RECO_METNO RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|219947871|gb|ACL58263.1| DNA repair protein RecO [Methylobacterium nodulans ORS 2060]
          Length = 246

 Score =  304 bits (779), Expect = 7e-81,   Method: Composition-based stats.
 Identities = 96/239 (40%), Positives = 136/239 (56%), Gaps = 5/239 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W D+ ++LG R +GE +++LE+MT  +GRHLG V  G+S RMQP+LQ GN VR  WR+
Sbjct: 1   MQWSDEGLVLGARRHGETSVVLELMTAGHGRHLGLVHGGRSRRMQPVLQPGNRVRAVWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL + LG F  E +ES   +L+ S L LYGL     L R LPER+P   LY    + +  
Sbjct: 61  RLDEGLGHFAVEPIESAAGRLMGSRLALYGLAHAAALLRLLPERDPHPSLYAAAQVLVAH 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P++   + V+ EL +L ++GFGLDL+ C  TG    L +VSPKSG AV  + G P+ 
Sbjct: 121 LTDPAIAPALMVRFELAVLADLGFGLDLSACAATGSNAYLAYVSPKSGRAVSAAAGEPWR 180

Query: 181 EKMLVLPSFLW-----KEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLG 234
           +++L LP FL          T     ++  F LT YFL+++      +     RE F+ 
Sbjct: 181 DRLLALPDFLVAREAGGTGATPTPRDVRQGFTLTGYFLDQHVWHPRGVAPPEARELFVA 239


>gi|319405460|emb|CBI79079.1| DNA repair protein RecO [Bartonella sp. AR 15-3]
          Length = 248

 Score =  303 bits (778), Expect = 9e-81,   Method: Composition-based stats.
 Identities = 105/235 (44%), Positives = 150/235 (63%), Gaps = 1/235 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W++ AIILG R +GE ++ILE+MTRQ+GR++G V+ G+S RM P+LQ GN V   W +
Sbjct: 1   MKWKEPAIILGTRQHGETSVILEIMTRQHGRYMGIVKGGRSRRMAPLLQPGNFVEAEWWA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG FR E L+SH ++L+     LY LQ +    R LPER+P   LYDML  F+  
Sbjct: 61  RLDEHLGLFRLEALDSHASRLIVLPEALYSLQLMASHLRLLPERDPHPVLYDMLYFFMQN 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P +  ++ V+ EL+LL+ +GFGLDL+ C VTG  + L +VSPKSG AVC  +G P+ 
Sbjct: 121 FDDPFINAELLVRFELLLLEELGFGLDLSCCAVTGRQEKLCYVSPKSGRAVCEEIGRPWK 180

Query: 181 EKMLVLPSFLWKEEQ-TIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLG 234
           +K+L+LP FL ++    ID D +     LTD+FL +Y  +   I    LR + + 
Sbjct: 181 DKLLLLPQFLVQKTACPIDFDDINKGLTLTDFFLTRYVWEARGIKQPSLRVSLIQ 235


>gi|83855024|ref|ZP_00948554.1| DNA repair protein RecO [Sulfitobacter sp. NAS-14.1]
 gi|83842867|gb|EAP82034.1| DNA repair protein RecO [Sulfitobacter sp. NAS-14.1]
          Length = 245

 Score =  303 bits (777), Expect = 1e-80,   Method: Composition-based stats.
 Identities = 86/237 (36%), Positives = 123/237 (51%), Gaps = 3/237 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D  I+L  R +GE + I+EV T + GRH G VR G S ++ PILQ G  + + WR+
Sbjct: 1   MEWRDQGILLSARRHGETSAIIEVFTPERGRHAGIVRGGTSRKIAPILQPGAQLDIAWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLN 119
           RL  ++G F  E + S  A  +   L L GL ++  L  F LPERE    LY      L+
Sbjct: 61  RLEDHIGAFTVEPVRSRAALAMHDRLSLAGLNAVTGLLAFALPEREAHPPLYRRTEALLD 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                 +    ++Q E+ LL  +G+GLDL+ C VTG T  L++VSPK+G AV R     +
Sbjct: 121 LLGQGDLWPLAYLQWEISLLDELGYGLDLSACAVTGRTSGLVFVSPKTGRAVTREGAGEW 180

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNI-IHCHLLRENFLGK 235
            +KML L   L  E    DA  +  AF+ T YFL ++  +          R  ++  
Sbjct: 181 VDKMLPLSPVLRGEGDASDA-DIALAFKTTGYFLERHLARDLGDKPLPEARARYVEA 236


>gi|163793044|ref|ZP_02187020.1| GTP-binding protein Era [alpha proteobacterium BAL199]
 gi|159181690|gb|EDP66202.1| GTP-binding protein Era [alpha proteobacterium BAL199]
          Length = 253

 Score =  303 bits (777), Expect = 1e-80,   Method: Composition-based stats.
 Identities = 80/241 (33%), Positives = 126/241 (52%), Gaps = 5/241 (2%)

Query: 2   YWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSR 61
            W D+ I+L  +++GE + I+ ++TR +GRH G VR   S R + + Q GN V   WR+R
Sbjct: 3   DWTDEGIVLAAKAHGEGSAIVVLLTRDHGRHAGLVRGAFSGRARGVYQPGNRVTAEWRAR 62

Query: 62  LAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLNC 120
           LA +LG +  E+   H A +L   L L GL +   +    LPEREP  +++D L   L+ 
Sbjct: 63  LADHLGNYTCELGHGHAAAVLDDPLKLAGLSAACAIAEASLPEREPHPQVHDGLVALLDA 122

Query: 121 HKIP---SVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGL 177
              P        ++V+ E+ +L ++G+GLDL  C  TG   DL +VSP++G AV  + G 
Sbjct: 123 MAEPELGDAWIAVYVRWEIGVLADLGYGLDLESCAATGANDDLAYVSPRTGRAVSLAAGE 182

Query: 178 PYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLL 237
           PY +++L LP FL       D D L     L+ +F+ ++    +       R  F+ +  
Sbjct: 183 PYRDRLLSLPRFLIGRGGG-DQDDLFRGLALSGFFMERHVFATHGRQPPPARTRFVERFA 241

Query: 238 E 238
            
Sbjct: 242 R 242


>gi|149200802|ref|ZP_01877777.1| DNA repair protein RecO [Roseovarius sp. TM1035]
 gi|149145135|gb|EDM33161.1| DNA repair protein RecO [Roseovarius sp. TM1035]
          Length = 244

 Score =  303 bits (777), Expect = 1e-80,   Method: Composition-based stats.
 Identities = 86/238 (36%), Positives = 128/238 (53%), Gaps = 5/238 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D  I+L  R +GE ++I+EV T + GRH G VR G S +M P+LQ G  + + WR+
Sbjct: 1   MDWRDQGILLNSRRHGESSVIIEVFTPERGRHAGVVRGGASRKMAPVLQPGAQLDLEWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLN 119
           RL  ++G FR E L+S  A  +   + L GL ++  L  F LPERE   ELY    I L+
Sbjct: 61  RLEDHIGTFRVEPLKSR-AWTMGDRMALAGLNAVCALLLFVLPEREAHAELYRKTLILLD 119

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVT-QDLLWVSPKSGGAVCRSVGLP 178
               P +    ++  E+ LL+ +GFGLDL +C V G    DL ++SPK+G AV R+    
Sbjct: 120 ILDQPEIWTLAYLNWEMALLEEMGFGLDLRRCAVLGEKANDLSYISPKTGRAVSRAGAGE 179

Query: 179 YAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYA-LQHNIIHCHLLRENFLGK 235
           +A+++L LP  L       D + L   F++T  FL  +   Q         R  ++ +
Sbjct: 180 WADRLLPLPPCLMGHGPAPDGEIL-QGFEVTGQFLRNHLAPQLGNRPLPEARARYVAR 236


>gi|182679932|ref|YP_001834078.1| DNA repair protein RecO [Beijerinckia indica subsp. indica ATCC
           9039]
 gi|238691211|sp|B2IBG3|RECO_BEII9 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|182635815|gb|ACB96589.1| DNA repair protein RecO [Beijerinckia indica subsp. indica ATCC
           9039]
          Length = 250

 Score =  303 bits (776), Expect = 1e-80,   Method: Composition-based stats.
 Identities = 92/240 (38%), Positives = 128/240 (53%), Gaps = 2/240 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W D+ +I+G+R YGE   ILEV T  +GRH G VR G   R++ +LQ GN     WR+
Sbjct: 1   MEWHDEGLIIGLRRYGETGAILEVFTPAHGRHFGLVRGGFGRRLRALLQPGNQADFTWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL Q LG    E  +    +L +S L L G+  I  L R LPER+P  ELY ++ + L  
Sbjct: 61  RLDQQLGLLAVEPTKLMTTRLFASGLALQGMNLIAALLRLLPERDPHPELYAVVRVLLEH 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P+V   +  + EL +L   GFGLDL+ C  TG TQ+L++VSPKSG AV    G PY 
Sbjct: 121 LDEPAVAPILLARFELAMLTETGFGLDLSACAATGATQELIYVSPKSGRAVSARAGAPYH 180

Query: 181 EKMLVLPSFLWKEE--QTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLE 238
           +K+L LP F       +    + +++ F LT +FL +             R  FL +  +
Sbjct: 181 DKLLGLPPFFLDGSLLKNPTLEEVEAGFALTGHFLMRDLFGPRGQTLPDARHAFLAETAK 240


>gi|254436668|ref|ZP_05050162.1| DNA repair protein RecO [Octadecabacter antarcticus 307]
 gi|198252114|gb|EDY76428.1| DNA repair protein RecO [Octadecabacter antarcticus 307]
          Length = 242

 Score =  302 bits (774), Expect = 3e-80,   Method: Composition-based stats.
 Identities = 78/240 (32%), Positives = 124/240 (51%), Gaps = 3/240 (1%)

Query: 2   YWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSR 61
            W+D+  ++ VR +GE + I+EV T   G   G VR G S ++ P LQ G  + V W++R
Sbjct: 3   EWRDEGALVRVRKHGESSAIIEVFTASRGLTAGIVRGGTSRKIAPTLQPGAQLDVTWKAR 62

Query: 62  LAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLNC 120
           L  +LG F  E + S  A+++   L L GL ++  L  F LP+RE    LY      L+ 
Sbjct: 63  LEDHLGSFTVEPIRSRTAQVMQDRLALAGLNAVTGLLSFLLPDREAHAPLYARTIQLLDL 122

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
                V    ++Q E+ LL  +GFG+DL+ C V+G+  DL +VSP++G AV R     +A
Sbjct: 123 LGQNDVWPLAYLQWEVALLDEMGFGMDLSACAVSGLNDDLFYVSPRTGRAVSRLAAGEWA 182

Query: 181 EKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNI-IHCHLLRENFLGKLLEL 239
           +++L LP  L  +    D + +  A + T +FLN +  +          R+  +  +  L
Sbjct: 183 DRLLPLPHVLLGKGDA-DLNEIVLALRTTGHFLNNHLAKSLGDRPIPEARQRLIDAMKRL 241


>gi|298291623|ref|YP_003693562.1| DNA repair protein RecO [Starkeya novella DSM 506]
 gi|296928134|gb|ADH88943.1| DNA repair protein RecO [Starkeya novella DSM 506]
          Length = 243

 Score =  302 bits (773), Expect = 3e-80,   Method: Composition-based stats.
 Identities = 95/229 (41%), Positives = 129/229 (56%), Gaps = 1/229 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W D+ IILG+R +GE N I+E+MT  +GRHLG VR G S R    LQ GN V+  WR+
Sbjct: 1   MEWSDEGIILGLRRHGEGNAIVELMTAAHGRHLGLVRGGGSRRQAAALQPGNGVQATWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG F  EV      +L+ ++   + L  I  L R LPER+P  EL+D+L   +  
Sbjct: 61  RLDEHLGTFALEVTTPRAGRLMGAAHSAFALSHIGSLIRMLPERDPHPELHDVLTAMVEH 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P + G +  + ELM+L  +GFGLDL  C  TG   DLL+VSPKSG AV R  G P+ 
Sbjct: 121 LDEPRLTGMMMARFELMMLSELGFGLDLESCAATGGRNDLLYVSPKSGRAVSRDAGEPWR 180

Query: 181 EKMLVLPSFLWKE-EQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLL 228
            ++L LP FL  E  +      + +AF LT +FL +   +   I     
Sbjct: 181 AQLLNLPYFLIGEVAEPPSPGDVDAAFDLTGHFLARRVFEPRGIPMPES 229


>gi|154247809|ref|YP_001418767.1| DNA repair protein RecO [Xanthobacter autotrophicus Py2]
 gi|238686793|sp|A7IM67|RECO_XANP2 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|154161894|gb|ABS69110.1| DNA repair protein RecO [Xanthobacter autotrophicus Py2]
          Length = 242

 Score =  301 bits (772), Expect = 5e-80,   Method: Composition-based stats.
 Identities = 88/235 (37%), Positives = 127/235 (54%), Gaps = 1/235 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W D+ I+LGVR +GE N I+E++TR  GRHLG VR G S R  P+LQ GN V   WR+
Sbjct: 1   MEWTDEGIVLGVRRHGEGNAIVELLTRLRGRHLGMVRGGASRRQAPLLQPGNTVSATWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL +++G +  E        L+ +    +G   +  +   LPER+P   L+  +   L+ 
Sbjct: 61  RLDEHMGNYALEPAVVRTEVLMRAPHAAFGFTHMAQILHLLPERDPHEGLFLTVGAILDA 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
            +     G++  + EL LL  +GFGL+L  C  TG  +DL++VSPKSG AVC   G PYA
Sbjct: 121 FENRESAGRLLARFELALLAELGFGLELETCAATGRREDLVYVSPKSGRAVCGEAGAPYA 180

Query: 181 EKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGK 235
           +++  LP FL        A  ++ A +LT YFL    L+   +     R  F+  
Sbjct: 181 DRLFALPRFLVDGTAPP-AGDVEDALRLTGYFLLTRVLEPRGLGLSDARAAFISA 234


>gi|163738241|ref|ZP_02145657.1| DNA repair protein RecO [Phaeobacter gallaeciensis BS107]
 gi|161388857|gb|EDQ13210.1| DNA repair protein RecO [Phaeobacter gallaeciensis BS107]
          Length = 241

 Score =  301 bits (772), Expect = 5e-80,   Method: Composition-based stats.
 Identities = 84/236 (35%), Positives = 128/236 (54%), Gaps = 3/236 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D+ I+L +R +GE   I++  T ++GRH G VR G   RM P+LQ G  + + WR+
Sbjct: 1   MEWRDEGILLTMRRHGESAAIVDAFTAEHGRHAGIVRGGAGRRMAPVLQPGAQLDLTWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLN 119
           RL  +LG ++ E++ S  A  +SS L L GL ++  L  F LPERE   ELY      L+
Sbjct: 61  RLEDHLGSYQAELIRSRAATAMSSRLALAGLNAVTALLAFCLPEREAHPELYLRSTQILD 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                 +    +++ E+ LL+ +GFGL+  +C VTG   DL++VSPKSG AV R     +
Sbjct: 121 LLGRDDIWPLAYLRWEVALLEEMGFGLEFEQCAVTGSRLDLIYVSPKSGRAVSRRGAGEW 180

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFL-NKYALQHNIIHCHLLRENFLG 234
           A++ML LP  L       +++ + +A   T +FL N+ A           R   + 
Sbjct: 181 ADRMLPLPPVLMGRGGAENSE-IVTALSTTGFFLQNRLAPSLGNHPLPEARGRLID 235


>gi|163740179|ref|ZP_02147573.1| DNA repair protein RecO [Phaeobacter gallaeciensis 2.10]
 gi|161386037|gb|EDQ10412.1| DNA repair protein RecO [Phaeobacter gallaeciensis 2.10]
          Length = 241

 Score =  301 bits (772), Expect = 5e-80,   Method: Composition-based stats.
 Identities = 85/240 (35%), Positives = 127/240 (52%), Gaps = 3/240 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D+ I+L +R +GE   I++  T ++GRH G VR G   RM P+LQ G  + + WR+
Sbjct: 1   MEWRDEGILLTMRRHGESAAIVDAFTAEHGRHAGIVRGGAGRRMAPVLQPGAQLDLTWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLN 119
           RL  +LG ++ E++ S  A  +SS L L GL ++  L  F LPERE   ELY      L+
Sbjct: 61  RLEDHLGSYQAELIRSRAATAMSSRLALAGLNAVTALLAFCLPEREAHPELYLRSTQILD 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                 +    +++ E+ LL+ +GFGL+  +C VTG   DL++VSPKSG AV R     +
Sbjct: 121 LLGRDDIWPLAYLRWEVALLEEMGFGLEFEQCAVTGSRLDLIYVSPKSGRAVSRRGAGEW 180

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFL-NKYALQHNIIHCHLLRENFLGKLLE 238
           A++ML LP  L       +   + +A   T +FL N+ A           R   +  L  
Sbjct: 181 ADRMLPLPPVLMGRGGA-ENSEIVTALSTTGFFLQNRLAPSLGNHPLPEARGRLIDVLSR 239


>gi|83941547|ref|ZP_00954009.1| DNA repair protein RecO, putative [Sulfitobacter sp. EE-36]
 gi|83847367|gb|EAP85242.1| DNA repair protein RecO, putative [Sulfitobacter sp. EE-36]
          Length = 245

 Score =  301 bits (771), Expect = 7e-80,   Method: Composition-based stats.
 Identities = 86/237 (36%), Positives = 123/237 (51%), Gaps = 3/237 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D  I+L  R +GE + I+EV T + GRH G VR G S ++ PILQ G  + + WR+
Sbjct: 1   MEWRDQGILLSARRHGETSAIIEVFTPERGRHAGIVRGGTSRKIAPILQPGAQLDIAWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLN 119
           RL  ++G F  E + S  A  +   L L GL ++  L  F LPERE    LY      L+
Sbjct: 61  RLEDHIGAFTVEPVRSRAALAMHDRLSLAGLNAVTGLLAFALPEREAHAPLYRRTEALLD 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                 +    ++Q E+ LL  +G+GLDL+ C VTG T  L++VSPK+G AV R     +
Sbjct: 121 LLGQGDLWPLAYLQWEISLLDELGYGLDLSACAVTGRTSGLVFVSPKTGRAVTREGAGEW 180

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNI-IHCHLLRENFLGK 235
            +KML L   L  E    DA  +  AF+ T YFL ++  +          R  ++  
Sbjct: 181 VDKMLPLSPVLRGEGDASDA-DIALAFKTTGYFLERHLARDLGDKPLPEARARYVEA 236


>gi|86135730|ref|ZP_01054309.1| DNA repair protein RecO [Roseobacter sp. MED193]
 gi|85826604|gb|EAQ46800.1| DNA repair protein RecO [Roseobacter sp. MED193]
          Length = 244

 Score =  300 bits (768), Expect = 2e-79,   Method: Composition-based stats.
 Identities = 79/242 (32%), Positives = 123/242 (50%), Gaps = 3/242 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D  I+L  R +GE   I++V T  +GRH G V  G S +  P+LQ G  + + WR+
Sbjct: 1   MEWRDHGILLTRRRHGEGAAIIDVFTEHHGRHAGIVHGGASRKKAPVLQPGAQLDLLWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLN 119
           RL ++LG ++ E L S  A  LS  L L GL ++  L  F LPER    +LY      L+
Sbjct: 61  RLQEHLGSYQAEPLRSRAAAALSGRLALAGLNAVTGLLGFCLPERAAYPDLYKQSEQLLD 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
             +   +    +++ E+ LL  +GFGLDL+ C V+G  +DL ++SPK+G AV R     +
Sbjct: 121 LLEQEEIWPLAYLRWEMALLAAMGFGLDLSACAVSGSNEDLAYISPKTGRAVSRQEAGQW 180

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFL-NKYALQHNIIHCHLLRENFLGKLLE 238
             ++L LP  L    +  D + +    + T +FL  + A           R  F+   + 
Sbjct: 181 VNRLLPLPPVLRGLGEAPDHE-VAEGLRTTGFFLSERLAPNLGNQPLPEARGRFIDAFMR 239

Query: 239 LI 240
            +
Sbjct: 240 RL 241


>gi|114765537|ref|ZP_01444645.1| DNA repair protein RecO [Pelagibaca bermudensis HTCC2601]
 gi|114542130|gb|EAU45162.1| DNA repair protein RecO [Roseovarius sp. HTCC2601]
          Length = 242

 Score =  299 bits (767), Expect = 2e-79,   Method: Composition-based stats.
 Identities = 82/240 (34%), Positives = 122/240 (50%), Gaps = 3/240 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D  I+L  R +GE + ILEV T ++GRH+G +R G S ++ P LQ G  + + WR+
Sbjct: 1   MDWRDTGILLSTRRHGETSAILEVFTAEHGRHMGVLRGGTSRKIAPSLQPGAQLDLTWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLN 119
           RL  ++G +  E   S  A  +S  L L GL ++V L  F LPERE    LY      L+
Sbjct: 61  RLEDHMGAWTVEPQRSRAASAMSDRLSLAGLNAVVALLSFCLPEREAHPALYARTESLLD 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                 +    +++ E+ LL  +GFGLDL+ C VTG  + L +VSP++G AV       +
Sbjct: 121 LLAERELWPLAYMRWEMALLDEMGFGLDLSACAVTGTNEPLDYVSPRTGRAVSAFGAGDW 180

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLN-KYALQHNIIHCHLLRENFLGKLLE 238
             ++L LP  +       D + L  A + T +FL  + A           R  FL +L  
Sbjct: 181 VARLLPLPPVMLGRGSAPDGEIL-DALRTTGHFLENRLAPALGDRPLPAARGLFLDRLAR 239


>gi|163733859|ref|ZP_02141301.1| DNA repair protein RecO [Roseobacter litoralis Och 149]
 gi|161392970|gb|EDQ17297.1| DNA repair protein RecO [Roseobacter litoralis Och 149]
          Length = 241

 Score =  299 bits (767), Expect = 2e-79,   Method: Composition-based stats.
 Identities = 83/236 (35%), Positives = 123/236 (52%), Gaps = 3/236 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+++ I+L  R +GE   I+EV T  +GRH G VR G S ++ PILQ G  + + WR+
Sbjct: 1   MEWREEGILLSTRRHGESAAIIEVFTPSHGRHAGVVRGGTSRKIAPILQPGAQLDLTWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLN 119
           RL  ++G F  E + S  A  +   L L GL ++  L  F LPERE    LY      L+
Sbjct: 61  RLEDHIGSFHVEPVRSRAAAAMGDRLALAGLNAVTALLGFCLPEREAHRALYLETERLLD 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
             +   +    +++ E+ LL  +G+ L+L +C VTG   DL++VSPKSG AV       +
Sbjct: 121 LLEEGELWPLAYLRWEVQLLHEMGYALELDQCAVTGQRDDLIYVSPKSGRAVSAQGAGDW 180

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQH-NIIHCHLLRENFLG 234
           AE++L LP  L       DA+ +  AF  T YFL ++  +          R  F+ 
Sbjct: 181 AERLLPLPPILRGVGGGPDAE-IAQAFVTTGYFLTEHLARDLGGKPLPEARARFVE 235


>gi|170742438|ref|YP_001771093.1| DNA repair protein RecO [Methylobacterium sp. 4-46]
 gi|168196712|gb|ACA18659.1| DNA repair protein RecO [Methylobacterium sp. 4-46]
          Length = 267

 Score =  298 bits (765), Expect = 3e-79,   Method: Composition-based stats.
 Identities = 96/239 (40%), Positives = 134/239 (56%), Gaps = 5/239 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W D+ ++LG R  GE  ++LE+MT  +GRHLG V  G+S RMQP+LQ GN VR  WR+
Sbjct: 22  MQWSDEGLVLGARRLGETGVVLELMTAAHGRHLGLVHGGRSRRMQPVLQPGNRVRAVWRA 81

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL   LG F  E L+S   +L+ S L LYGL     L R LPER+P   LY+   + ++ 
Sbjct: 82  RLDDGLGSFAVEPLDSAAGRLIGSRLALYGLAHAAALLRLLPERDPHPGLYEAARVLIDH 141

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
               ++   + V+ EL +L  +GFGLDL+ C  TG    L +VSPKSG AV  + G P+ 
Sbjct: 142 LADAAIAPPLMVRFELAVLAELGFGLDLSACAATGSNAYLAYVSPKSGRAVSAAAGEPWR 201

Query: 181 EKMLVLPSFLW-----KEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLG 234
           +++L LP FL          T  A  ++  F LT YFL+++      +     RE F+ 
Sbjct: 202 DRLLALPDFLVAREAGGTGATPTARDVRQGFTLTGYFLDQHVWAPRGLAPPEARERFVA 260


>gi|144899859|emb|CAM76723.1| DNA repair protein RecO [Magnetospirillum gryphiswaldense MSR-1]
          Length = 250

 Score =  298 bits (764), Expect = 4e-79,   Method: Composition-based stats.
 Identities = 96/237 (40%), Positives = 132/237 (55%), Gaps = 3/237 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W DD I+L VR  GE  I+  + TR +GRH G V  G     +  LQ GNLV+ +WR+
Sbjct: 1   MDWTDDGIVLAVRRLGEAGIVASLFTRSHGRHPGMVPGGAGRANRAALQPGNLVQASWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLF-RFLPEREPCLELYDMLNIFLN 119
           RL + LG +R E+ E+H AK L  +  L  L S   L    LPER+P   L+D L+  L 
Sbjct: 61  RLPEQLGTYRLELAEAHSAKALDDAGCLAALTSACALCEALLPERQPHAPLFDALSALLV 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
               PS    ++V  EL LL+ +G+GLDL+ C  TG T DL++VSPKS  AV    G P+
Sbjct: 121 SLTAPS-WPSVYVHWELALLRGLGYGLDLSACAATGATTDLIYVSPKSARAVSAQAGQPH 179

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKL 236
           A K+L LP+FL  + +  DA  + +   LT YF+ ++ LQ   I     R   + +L
Sbjct: 180 AHKLLPLPAFLLGKSEG-DATDIAAGLTLTGYFIERHLLQQRHIAMPPARLRLVDRL 235


>gi|114770109|ref|ZP_01447647.1| DNA repair protein RecO [alpha proteobacterium HTCC2255]
 gi|114548946|gb|EAU51829.1| DNA repair protein RecO [alpha proteobacterium HTCC2255]
          Length = 243

 Score =  297 bits (761), Expect = 8e-79,   Method: Composition-based stats.
 Identities = 88/238 (36%), Positives = 135/238 (56%), Gaps = 3/238 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W  + +I+ VR YGE ++I++ +T ++GRHLG VR G S +M   +Q G+ V++ WR+
Sbjct: 1   MEWTSEGVIVSVRKYGENSVIIDTLTPKHGRHLGVVRGGASRKMAATIQPGSQVKLEWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLN 119
           RL ++LG FR E LES  + +    L L  L SI  +  F  PER P  ELY+     ++
Sbjct: 61  RLEEHLGNFRVEQLESR-SDMFDDRLRLAALSSICSIVTFSFPERMPVAELYNSTLNLMD 119

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                     ++   EL +L+ +GFGLDLT C VT VTQDL++VSPKSG AV R     +
Sbjct: 120 TLNTGGDWKPLYALWELQVLEEMGFGLDLTSCAVTNVTQDLIYVSPKSGRAVSRKAAGEW 179

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNI-IHCHLLRENFLGKL 236
            E++L LPSFL  + +T + + + ++ + T +FL+ +             R   + +L
Sbjct: 180 KERLLPLPSFLRNKFETANHEDILNSLKTTGHFLSSWLATSLGERKLPEARNRLISRL 237


>gi|254476248|ref|ZP_05089634.1| DNA repair protein RecO [Ruegeria sp. R11]
 gi|214030491|gb|EEB71326.1| DNA repair protein RecO [Ruegeria sp. R11]
          Length = 241

 Score =  297 bits (760), Expect = 1e-78,   Method: Composition-based stats.
 Identities = 83/241 (34%), Positives = 131/241 (54%), Gaps = 5/241 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D  I+L +R +GE + I+++ T ++GRH G +R G S +M PILQ G  + + WR+
Sbjct: 1   MEWRDQGILLRMRRHGEGSAIVDMFTAEHGRHAGVIRGGASRKMAPILQPGAQLDLLWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLN 119
           RL  +LG ++ E++ S     LS  L L GL ++  L  F LP+REP  +LY      L+
Sbjct: 61  RLEDHLGSYQAELMRSRAGAALSGRLALAGLNAVTGLLAFCLPDREPHPDLYLRSERLLD 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                 +    ++Q E+ LL+ +GFGLDL+ C V+G   +L+++SPKSG AV R+    +
Sbjct: 121 LLGQDEIWPLAYLQWEMALLEELGFGLDLSCCAVSGALDELIYISPKSGRAVSRASAGEW 180

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHN--IIHCHLLRENFLGKLL 237
           A ++L LP+ +  E +    + L      T +FL  + L  +         R  FL  L 
Sbjct: 181 AHRLLPLPAVMRGEGEAGTGEIL-QGLSTTGFFLE-HRLAPSLGNTPLPEARGRFLDVLT 238

Query: 238 E 238
            
Sbjct: 239 R 239


>gi|84515166|ref|ZP_01002529.1| DNA repair protein RecO [Loktanella vestfoldensis SKA53]
 gi|84511325|gb|EAQ07779.1| DNA repair protein RecO [Loktanella vestfoldensis SKA53]
          Length = 243

 Score =  297 bits (760), Expect = 1e-78,   Method: Composition-based stats.
 Identities = 80/239 (33%), Positives = 124/239 (51%), Gaps = 3/239 (1%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRL 62
           W+DDA IL +R +GE + I+EV +  +GRH G VR G S ++ P++Q G  V V W +RL
Sbjct: 4   WRDDAAILAMRPFGESSAIIEVFSANHGRHAGVVRGGASRKIAPLIQPGAQVNVAWAARL 63

Query: 63  AQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLF-RFLPEREPCLELYDMLNIFLNCH 121
             +LG F  E + S  A  ++  L L GL ++  L    LPERE    LY      L+  
Sbjct: 64  DDHLGSFTVEPVRSRNAAAMADRLSLAGLNAVCALLLMVLPERESHPLLYQRSIALLDLL 123

Query: 122 KIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAE 181
              +V    +++ E  LL+ +GFGLDL+ C  +GV +DL +VSPKSG AV R     +A+
Sbjct: 124 DQRAVWPLAYLRWEQALLEEMGFGLDLSACAASGVNEDLAFVSPKSGRAVSRDAAGVWAD 183

Query: 182 KMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNI-IHCHLLRENFLGKLLEL 239
           ++L LP  L  +      + +  A   T +F+    ++     +    R   +  ++  
Sbjct: 184 RLLPLPPVLAGKGDASGVE-IAKALGTTGFFIENRLIKGLGDRNVPAARARLIDAIMRA 241


>gi|217979938|ref|YP_002364085.1| DNA repair protein RecO [Methylocella silvestris BL2]
 gi|254764645|sp|B8EMP4|RECO_METSB RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|217505314|gb|ACK52723.1| DNA repair protein RecO [Methylocella silvestris BL2]
          Length = 247

 Score =  296 bits (759), Expect = 1e-78,   Method: Composition-based stats.
 Identities = 89/236 (37%), Positives = 132/236 (55%), Gaps = 3/236 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D+ +I+GVR YGE ++ILE MTR +GRHLG VR G+S RM+ +LQ GN   + WR+
Sbjct: 1   MEWRDEGLIIGVRQYGEASVILEAMTRGHGRHLGLVRGGRSQRMRAVLQPGNSAELVWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL + LG +  E  +   A L++S+  L+ +  I  L R + ER+P  +LY+   +    
Sbjct: 61  RLDEQLGTWAIEPTQLRAATLMASAEALHAVGLICALLRLIAERDPHPDLYETAVLIAGH 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
                +   + V++E+ +L+  GFGLDL++C  TG  +DL +VSPKSG AV  + G PY 
Sbjct: 121 IGDERLAP-LLVRLEIEILRETGFGLDLSRCAATGAREDLAYVSPKSGRAVSLAAGAPYR 179

Query: 181 EKMLVLPSFLWKE--EQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLG 234
           E++L LP FL  E          +   F LT +FL +             R  +L 
Sbjct: 180 ERLLPLPPFLRDEAPGGEPTPQDVLDGFGLTGFFLKRDVFTPRGQGMPEARRAYLA 235


>gi|221641177|ref|YP_002527439.1| DNA repair protein RecO [Rhodobacter sphaeroides KD131]
 gi|332560104|ref|ZP_08414426.1| DNA repair protein RecO [Rhodobacter sphaeroides WS8N]
 gi|254764657|sp|B9KSB0|RECO_RHOSK RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|221161958|gb|ACM02938.1| DNA repair protein recO [Rhodobacter sphaeroides KD131]
 gi|332277816|gb|EGJ23131.1| DNA repair protein RecO [Rhodobacter sphaeroides WS8N]
          Length = 239

 Score =  295 bits (757), Expect = 3e-78,   Method: Composition-based stats.
 Identities = 86/242 (35%), Positives = 127/242 (52%), Gaps = 7/242 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D+  +L VR +GE + I+EV T  +GRH G VR G S ++ PILQ G  + + W++
Sbjct: 2   MEWRDEGALLSVRRHGESSAIIEVFTAAHGRHAGVVRGGASRKIAPILQPGAQLDLTWKA 61

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLN 119
           RL +++G F  E L S  A LL   L L GL +I  +    LPEREP   L+      L+
Sbjct: 62  RLDEHMGAFTVEPLRSRTA-LLGDRLGLAGLNAICAMLHVTLPEREPHSTLWQESMALLD 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
               P      +++ E+ LL+  GFGLDLT+C VTG  +DL +VSPK+G AV R     +
Sbjct: 121 ALDRPG-WPPAYLRWEMRLLEETGFGLDLTRCAVTGSREDLAFVSPKTGRAVSRGAAGGW 179

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQH--NIIHCHLLRENFLGKLL 237
           A+++  LP  L   +    A+ ++    +T +FL +  L    N       R   +  L 
Sbjct: 180 ADRLFPLPLALLG-QGPASAEEVRQGLAITGHFLGRE-LAPLLNGRPMPEARARLMELLA 237

Query: 238 EL 239
             
Sbjct: 238 RA 239


>gi|209964784|ref|YP_002297699.1| DNA repair protein RecO, putative [Rhodospirillum centenum SW]
 gi|238058647|sp|B6IMY9|RECO_RHOCS RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|209958250|gb|ACI98886.1| DNA repair protein RecO, putative [Rhodospirillum centenum SW]
          Length = 250

 Score =  295 bits (757), Expect = 3e-78,   Method: Composition-based stats.
 Identities = 87/242 (35%), Positives = 125/242 (51%), Gaps = 5/242 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W DDAI+L  R +GE   +  ++TR +GRH G V  GQS RM+P+L+ GN V   W +
Sbjct: 1   MEWTDDAIVLSARPHGETAALAVLLTRGHGRHAGLVHGGQSGRMRPVLEPGNRVAARWAA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPL-FRFLPEREPCLELYDMLNIFLN 119
           RL + LG    E+  +  A LL   L L  L S   L    LPEREP   L+D      +
Sbjct: 61  RLVEQLGTLALELERATAAGLLEDPLRLAALSSACALVDAALPEREPHPALFDATLALFD 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQD--LLWVSPKSGGAVCRSVGL 177
             +   V  +I+V+ E+ LL+  GFGLD   C  TG+T +  L +VSP++G AV  S G 
Sbjct: 121 ALQT-EVWAEIYVRWEIGLLEEAGFGLDFGSCAATGITDNDQLAYVSPRTGRAVSLSAGE 179

Query: 178 PYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLL 237
           PY +++L LP FL        A+ +     LT +FL+++            R  F+ +  
Sbjct: 180 PYRDRLLALPPFLVGR-SAGGAEEVVQGLALTGHFLDRHLFALRHAEVPAARTRFVDRYR 238

Query: 238 EL 239
           + 
Sbjct: 239 KA 240


>gi|126461085|ref|YP_001042199.1| DNA repair protein RecO [Rhodobacter sphaeroides ATCC 17029]
 gi|166221908|sp|A3PGG1|RECO_RHOS1 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|126102749|gb|ABN75427.1| DNA repair protein RecO [Rhodobacter sphaeroides ATCC 17029]
          Length = 239

 Score =  295 bits (756), Expect = 3e-78,   Method: Composition-based stats.
 Identities = 86/242 (35%), Positives = 127/242 (52%), Gaps = 7/242 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D+  +L VR +GE + I+EV T  +GRH G VR G S ++ PILQ G  + + W++
Sbjct: 2   MEWRDEGALLSVRRHGESSAIIEVFTAAHGRHAGVVRGGASRKIAPILQPGAQLDLTWKA 61

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLN 119
           RL +++G F  E L S  A LL   L L GL +I  +    LPEREP   L+      L+
Sbjct: 62  RLDEHMGAFTVEPLRSRTA-LLGDRLGLAGLNAICAMLHVTLPEREPHSTLWQESMALLD 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
               P      +++ E+ LL+  GFGLDLT+C VTG  +DL +VSPK+G AV R     +
Sbjct: 121 ALDRPG-WPPAYLRWEMRLLEETGFGLDLTRCAVTGSREDLAFVSPKTGRAVSRGAAGGW 179

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQH--NIIHCHLLRENFLGKLL 237
           A+++  LP  L   +    A+ ++    +T +FL +  L    N       R   +  L 
Sbjct: 180 ADRLFPLPLALLG-QGPASAEEVRQGLAITGHFLGRE-LAPLLNGRPLPEARARLMELLA 237

Query: 238 EL 239
             
Sbjct: 238 RA 239


>gi|126733738|ref|ZP_01749485.1| DNA repair protein RecO [Roseobacter sp. CCS2]
 gi|126716604|gb|EBA13468.1| DNA repair protein RecO [Roseobacter sp. CCS2]
          Length = 244

 Score =  295 bits (755), Expect = 4e-78,   Method: Composition-based stats.
 Identities = 80/240 (33%), Positives = 122/240 (50%), Gaps = 3/240 (1%)

Query: 2   YWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSR 61
            W+ +A +L  R +GE  +I+EV +  +GRH G VR G S ++ P+LQ G  + V W++R
Sbjct: 3   EWRSEAALLSSRPFGENGVIIEVFSALHGRHAGVVRGGASRKLAPVLQPGAQLSVAWKAR 62

Query: 62  LAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFR-FLPEREPCLELYDMLNIFLNC 120
           L  +LG F  E + S  A  +   L L GL ++  L    LPERE    LY+     L+ 
Sbjct: 63  LESHLGSFAVEPIRSRAAAAMGDRLALAGLNAVCSLLAMVLPEREAHEPLYERTIALLDL 122

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
                V    +++ E  LL+ +GF +DL+ C V GV +DL++VSPKSG AV R     +A
Sbjct: 123 LGQQDVWPLAYLRWEQALLEEMGFAMDLSACAVRGVNEDLIYVSPKSGRAVSREAAGEWA 182

Query: 181 EKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNI-IHCHLLRENFLGKLLEL 239
           ++ML LP  L  +    +A  +  A   T YF+    ++          R   L  ++  
Sbjct: 183 DRMLPLPEVLTGKGDASNAQ-IAKALGTTGYFIEHRLIKGLGDRPMPAARTRLLDAIMRA 241


>gi|315499944|ref|YP_004088747.1| DNA repair protein reco [Asticcacaulis excentricus CB 48]
 gi|315417956|gb|ADU14596.1| DNA repair protein RecO [Asticcacaulis excentricus CB 48]
          Length = 239

 Score =  294 bits (754), Expect = 7e-78,   Method: Composition-based stats.
 Identities = 77/239 (32%), Positives = 123/239 (51%), Gaps = 1/239 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M ++DDA +L  R +GE   ++  +T ++G     V  G S R++P LQ  + VR+++R+
Sbjct: 1   MTFEDDAFVLSARPHGETGAVVHFLTLEHGHIAAHVPGGASRRLKPYLQPASRVRLSYRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFR-FLPEREPCLELYDMLNIFLN 119
           R A  LG    E      A++    + L G+Q    + R  LPERE     +      +N
Sbjct: 61  RTADQLGSATLEPEGDATAEIFDDPMALIGVQCACVMTRAVLPEREAYPGAFYAFETLIN 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
              +P V   ++V+ E+ LL+ +GFGLDL+ C V+G   DL +VSP+S  AV R  G PY
Sbjct: 121 AFGLPGVWPYVYVRFEMGLLEAVGFGLDLSACAVSGSRDDLAYVSPRSARAVSRREGEPY 180

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLE 238
            +K+L LP FL   +  + AD L+    LT +FL ++           +R   +  + +
Sbjct: 181 KDKLLPLPGFLLSSQGGVQADDLRRGLDLTGFFLERHIFHPLNQPLPEIRTRLIDSVRD 239


>gi|77462223|ref|YP_351727.1| DNA repair protein RecO [Rhodobacter sphaeroides 2.4.1]
 gi|77386641|gb|ABA77826.1| putative RecO protein [Rhodobacter sphaeroides 2.4.1]
          Length = 239

 Score =  294 bits (753), Expect = 7e-78,   Method: Composition-based stats.
 Identities = 85/242 (35%), Positives = 127/242 (52%), Gaps = 7/242 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D+  +L VR +GE + I+EV T  +GRH G VR G S ++ PILQ G  + + W++
Sbjct: 2   MEWRDEGALLSVRRHGESSAIIEVFTAAHGRHAGVVRGGASRKIAPILQPGAQLDLTWKA 61

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLN 119
           RL +++G F  E L S  A LL   L L GL +I  +    LPEREP   L+    + L+
Sbjct: 62  RLDEHMGAFTVEPLRSRTA-LLGDRLGLAGLNAICAMLHVTLPEREPHSTLWQESMVLLD 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
               P      +++ E+ LL+  GFGLDLT+C VTG  +DL +VSPK+G AV       +
Sbjct: 121 ALDRPG-WPPAYLRWEMRLLEETGFGLDLTRCAVTGSREDLAFVSPKTGRAVSSGAAGGW 179

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQH--NIIHCHLLRENFLGKLL 237
           A+++  LP  L   +    A+ ++    +T +FL +  L    N       R   +  L 
Sbjct: 180 ADRLFPLPLALLG-QGPASAEEVRQGLAITGHFLGRE-LAPLLNGRPLPEARARLMELLA 237

Query: 238 EL 239
             
Sbjct: 238 RA 239


>gi|119370511|sp|Q3J5V8|RECO_RHOS4 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
          Length = 238

 Score =  294 bits (753), Expect = 7e-78,   Method: Composition-based stats.
 Identities = 85/242 (35%), Positives = 127/242 (52%), Gaps = 7/242 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D+  +L VR +GE + I+EV T  +GRH G VR G S ++ PILQ G  + + W++
Sbjct: 1   MEWRDEGALLSVRRHGESSAIIEVFTAAHGRHAGVVRGGASRKIAPILQPGAQLDLTWKA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLN 119
           RL +++G F  E L S  A LL   L L GL +I  +    LPEREP   L+    + L+
Sbjct: 61  RLDEHMGAFTVEPLRSRTA-LLGDRLGLAGLNAICAMLHVTLPEREPHSTLWQESMVLLD 119

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
               P      +++ E+ LL+  GFGLDLT+C VTG  +DL +VSPK+G AV       +
Sbjct: 120 ALDRPG-WPPAYLRWEMRLLEETGFGLDLTRCAVTGSREDLAFVSPKTGRAVSSGAAGGW 178

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQH--NIIHCHLLRENFLGKLL 237
           A+++  LP  L   +    A+ ++    +T +FL +  L    N       R   +  L 
Sbjct: 179 ADRLFPLPLALLG-QGPASAEEVRQGLAITGHFLGRE-LAPLLNGRPLPEARARLMELLA 236

Query: 238 EL 239
             
Sbjct: 237 RA 238


>gi|300023747|ref|YP_003756358.1| DNA repair protein RecO [Hyphomicrobium denitrificans ATCC 51888]
 gi|299525568|gb|ADJ24037.1| DNA repair protein RecO [Hyphomicrobium denitrificans ATCC 51888]
          Length = 239

 Score =  293 bits (751), Expect = 1e-77,   Method: Composition-based stats.
 Identities = 90/237 (37%), Positives = 131/237 (55%), Gaps = 1/237 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W D+AI+L V+ +GE   ++E+ TR +GRHLG V  G+S R++PILQ GN V   W++
Sbjct: 1   MQWTDEAIVLSVKPHGETAAVIELWTRTHGRHLGLVHGGRSRRLRPILQPGNHVDATWKA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL+  LG    E+  +  A+ L  +  L  L ++  L   LPER+P   LY++    L  
Sbjct: 61  RLSDQLGHVTIEMRRAFAAETLDDAAALAALSTLTTLTHLLPERDPHPNLYEITLFVLGF 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
               +V   + V+ EL LL+ +GFGLDL++C  TG    L++VSP++G AV  S G PY 
Sbjct: 121 LNDATVWPALLVRWELALLEELGFGLDLSQCAATGSNDQLIYVSPRTGRAVSASAGEPYR 180

Query: 181 EKMLVLPSFLWKEEQT-IDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKL 236
           +K+L LP+FL K     +  D ++  F LT +FL    L          R   L  L
Sbjct: 181 DKLLPLPAFLTKHRSGHVTEDDIRLGFALTGHFLETRVLLPRGQSLPQPRSRLLAHL 237


>gi|319407033|emb|CBI80670.1| DNA repair protein RecO [Bartonella sp. 1-1C]
          Length = 248

 Score =  293 bits (751), Expect = 1e-77,   Method: Composition-based stats.
 Identities = 101/235 (42%), Positives = 149/235 (63%), Gaps = 1/235 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W++ AIILG R +GE ++ILE+MTRQ+GR++G V+ G+S RM P+LQ GN V   W +
Sbjct: 1   MKWKEQAIILGTRQHGETSVILEIMTRQHGRYMGIVKGGRSRRMAPLLQPGNFVEAEWWA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG FR E L+ H ++L+     LY LQ +    R LPER+P   LYDML  F+  
Sbjct: 61  RLDEHLGLFRLEALDLHASRLIVLPEALYSLQLMAFYLRLLPERDPHPVLYDMLYFFMQN 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
            + P +  ++ V+ EL+LL+ +GFGLDL+ C VTG  + L +VSPKSG AVC  +G P+ 
Sbjct: 121 FEDPFINAELLVRFELLLLEELGFGLDLSCCAVTGRQEKLYYVSPKSGRAVCEEIGRPWK 180

Query: 181 EKMLVLPSFLWKEE-QTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLG 234
           +K+L+LP FL ++    +D + +     LT++FL +Y      I    LR + + 
Sbjct: 181 DKLLLLPKFLVQKNVYPVDFNDISKGLILTNFFLTRYVWDARGIKQSSLRVSLIQ 235


>gi|114570118|ref|YP_756798.1| DNA repair protein RecO [Maricaulis maris MCS10]
 gi|114340580|gb|ABI65860.1| DNA repair protein RecO [Maricaulis maris MCS10]
          Length = 234

 Score =  293 bits (751), Expect = 1e-77,   Method: Composition-based stats.
 Identities = 85/229 (37%), Positives = 127/229 (55%), Gaps = 2/229 (0%)

Query: 9   ILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQNLGE 68
           +L VR +GE + I+EV+T + GRH G VR  +S  M+PILQ GN + VNWR+RL+++LG 
Sbjct: 1   MLAVRPHGETSAIVEVLTAEQGRHAGLVRGARSRSMRPILQPGNQITVNWRARLSEHLGM 60

Query: 69  FRFEVLESHCAKLLSSSLFLYGLQSIVPLF-RFLPEREPCLELYDMLNIFLNCHKIPSVI 127
           F+ E  +     ++     L GL S   +    LPERE    ++    + L     P + 
Sbjct: 61  FQIEADDLTAGMVMEDRTALAGLNSACAIAVMGLPEREAHPRVHQGFQLLLGAFDNPDIW 120

Query: 128 GKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKMLVLP 187
             ++V+ E  LL ++G+GLD++ C VTGVT+DL  +SP++G AVCR    PYA K+L LP
Sbjct: 121 PALYVRWEAGLLSDLGYGLDMSACAVTGVTEDLTHISPRTGRAVCREEAAPYAPKLLELP 180

Query: 188 SFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKL 236
            F+    + I+A  +     LT YFL +  L          R   + +L
Sbjct: 181 PFMAGSGK-IEAGDIARGLALTGYFLERRVLWPIDKQLPEARGRLMAEL 228


>gi|126726092|ref|ZP_01741934.1| DNA repair protein RecO [Rhodobacterales bacterium HTCC2150]
 gi|126705296|gb|EBA04387.1| DNA repair protein RecO [Rhodobacterales bacterium HTCC2150]
          Length = 245

 Score =  292 bits (749), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 86/241 (35%), Positives = 131/241 (54%), Gaps = 4/241 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D   I+ VR +GE + I+EV T+  GRH G VR   S ++ P LQ G  V V+WR+
Sbjct: 1   MEWRDQGAIISVRHHGETSAIVEVFTKNQGRHAGVVRGATSRKIAPFLQPGGQVDVSWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLN 119
           RL ++LG F  E ++S  A ++S+ L L GL ++  L +F LPERE    LY+     L+
Sbjct: 61  RLNEHLGTFTIEPIQSR-AHVMSNPLALAGLNAVCALLQFTLPERESHPRLYETSIALLD 119

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                S     ++  E++LL ++GFGLDL++C VTG   DL +VSPKSG AV +S    +
Sbjct: 120 SISETSDWPLDYLHWEMLLLDDLGFGLDLSECAVTGTQGDLAYVSPKSGRAVSKSGAGEW 179

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYA-LQHNIIHCHLLRENFLGKLLE 238
           A+++L L   L   + ++    L    + T +FL  +   +         R   + +L  
Sbjct: 180 ADRLLPLTPCLIS-DASVGVTELIEGLRTTGHFLENHLAPELGNRPLPEARARMIDRLGR 238

Query: 239 L 239
           L
Sbjct: 239 L 239


>gi|319404020|emb|CBI77608.1| DNA repair protein RecO [Bartonella rochalimae ATCC BAA-1498]
          Length = 248

 Score =  292 bits (749), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 101/235 (42%), Positives = 149/235 (63%), Gaps = 1/235 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W++ AIILG R +GE ++ILE+MTRQ+GR++G V+ G+S RM P+LQ GN V   W +
Sbjct: 1   MKWKEQAIILGTRQHGETSVILEIMTRQHGRYMGIVKGGRSRRMAPLLQPGNFVEAEWWA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG FR E L  H ++L+     LY LQ +    R LPER+P   LYDML  F+  
Sbjct: 61  RLDEHLGLFRLEALNLHASRLIVLPEALYSLQLMAFYLRLLPERDPHPVLYDMLYFFMQN 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
            + P +  ++ V+ EL+LL+ +GFGLDL+ C VTG  + L +VSPKSG AVC  +G P+ 
Sbjct: 121 FEDPFINAELLVRFELLLLEELGFGLDLSCCAVTGRQEKLYYVSPKSGRAVCEEIGRPWK 180

Query: 181 EKMLVLPSFLWKEE-QTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLG 234
           +K+L+LP FL ++    +D + +     LT++FL +Y  +   I    LR + + 
Sbjct: 181 DKLLLLPQFLVQKSVYPVDFNDISKGLILTNFFLTRYVWEARGIKQLSLRVSLIQ 235


>gi|89070889|ref|ZP_01158124.1| DNA repair protein RecO, putative [Oceanicola granulosus HTCC2516]
 gi|89043528|gb|EAR49739.1| DNA repair protein RecO, putative [Oceanicola granulosus HTCC2516]
          Length = 239

 Score =  291 bits (746), Expect = 4e-77,   Method: Composition-based stats.
 Identities = 85/240 (35%), Positives = 121/240 (50%), Gaps = 3/240 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D  ++L  R +GE  +I EV T   GRH G VR G+S ++ P+LQ G  V V W +
Sbjct: 1   MQWRDGGVLLARRGHGESGVIAEVFTETRGRHAGLVRGGRSKQLAPVLQPGEQVEVTWTA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLN 119
           RL ++LG +R E L S  A +++  L L GL +I  L  F LPEREP   LY      L+
Sbjct: 61  RLEEHLGAYRVEPLRSRAALVMNDRLALAGLNAICGLLAFALPEREPHPALYARSVTLLD 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                      ++  EL LL+ +GFGLDL+ C VTG    L +VSP++G AV  +    +
Sbjct: 121 LLGRTDAWPLAYLHWELALLEELGFGLDLSSCAVTGAEDGLAFVSPRTGRAVSAAGAGEW 180

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNI-IHCHLLRENFLGKLLE 238
           A ++L LP  L  +    DA+ L    + T +FL  +             R   +  L  
Sbjct: 181 AGRLLPLPPALRGQGPGPDAEIL-EGLRTTGHFLATWLAPALGDRPLPEARARLVALLSR 239


>gi|118587959|ref|ZP_01545369.1| DNA repair protein RecO [Stappia aggregata IAM 12614]
 gi|118439581|gb|EAV46212.1| DNA repair protein RecO [Stappia aggregata IAM 12614]
          Length = 251

 Score =  291 bits (746), Expect = 5e-77,   Method: Composition-based stats.
 Identities = 91/242 (37%), Positives = 137/242 (56%), Gaps = 5/242 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W    ++L  R +GE ++ILE MT  +GRHLG VR G+S R +P+LQ GN + + W++
Sbjct: 1   MEWSGRGVVLTTRKHGENDVILEAMTLDHGRHLGLVRGGRSRRHRPVLQPGNELTLTWKA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL+ +LG+F  E        L++SSL L  LQ +  L R LPER     L++ L + L+ 
Sbjct: 61  RLSDHLGQFHIEPETLRAGDLMTSSLGLAALQHLAFLLRLLPERHTYPRLFNALTVVLDH 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
            +       + ++ EL +L+++G GLDL+ C  TG  +DL +VSPKS  AVCR  GLPY 
Sbjct: 121 LEASDAAAALLIRFELEVLRDLGIGLDLSSCAATGSNEDLAYVSPKSARAVCREAGLPYH 180

Query: 181 EKMLVLPSFLWKEEQTIDAD----SLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKL 236
           +++L LP FL   ++   ++     +   F LT +FLN+Y  +H        R   L  L
Sbjct: 181 DRLLPLPGFLLDGQRQAGSELTWADVTQGFDLTSFFLNRYLQEH-GTRDGGTRNQVLTAL 239

Query: 237 LE 238
            +
Sbjct: 240 EK 241


>gi|23014388|ref|ZP_00054207.1| COG1381: Recombinational DNA repair protein (RecF pathway)
           [Magnetospirillum magnetotacticum MS-1]
          Length = 309

 Score =  291 bits (746), Expect = 5e-77,   Method: Composition-based stats.
 Identities = 91/237 (38%), Positives = 128/237 (54%), Gaps = 3/237 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W DD I+L VR +GE   +  ++TR +GRH G V  GQ    +PILQ GNLVR  W  
Sbjct: 74  MEWDDDGIVLAVRRHGETGAVASLLTRSHGRHAGLVHGGQGRTNRPILQPGNLVRAKWTG 133

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFR-FLPEREPCLELYDMLNIFLN 119
           RL + LG F+ E+L ++ A  L  +  L  L S   L    L ER+P         + L 
Sbjct: 134 RLPEQLGNFKLEMLHAYGAAFLDDAARLSALGSACALVETALAERQPHPAC-HAALVALL 192

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                     I+V  EL LL+++GFGLDL+ C  TG T DL WVSPK+G AV R+ G PY
Sbjct: 193 HALEAESWPSIYVHFELALLRDLGFGLDLSACAATGQTDDLAWVSPKTGRAVSRAAGEPY 252

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKL 236
            +K+  LP+FL +  +  DA +++   ++T +FL ++ L          R   +G+L
Sbjct: 253 RDKLFKLPAFLVEGGEG-DAAAIREGLEMTGFFLQRHVLDSRHAVLPAARGRMIGRL 308


>gi|126739720|ref|ZP_01755412.1| DNA repair protein RecO [Roseobacter sp. SK209-2-6]
 gi|126719366|gb|EBA16076.1| DNA repair protein RecO [Roseobacter sp. SK209-2-6]
          Length = 251

 Score =  291 bits (746), Expect = 5e-77,   Method: Composition-based stats.
 Identities = 82/241 (34%), Positives = 127/241 (52%), Gaps = 3/241 (1%)

Query: 2   YWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSR 61
            W+D  I+L  R +GE + I++V T ++GRH G VR G S R+ PILQ G  + + WR+R
Sbjct: 12  EWRDHGILLSARRHGESSAIIDVFTEEHGRHAGVVRGGASRRLAPILQPGAQLDLLWRAR 71

Query: 62  LAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLNC 120
           L ++LG ++ E L S     +S  L L GL ++  L  F LPEREP   LY      L+ 
Sbjct: 72  LEEHLGSYQAEPLRSRAVAAMSGRLALSGLNAVTALLGFCLPEREPHPALYASSERLLDL 131

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
            +   +    +++ E+ LL+ +GFGLDL  C V+G  ++L +VSP++G AV R    P+ 
Sbjct: 132 LEQEELWPLAYLRWEMELLEEMGFGLDLLACAVSGRNEELAYVSPRTGRAVSRQEAGPWV 191

Query: 181 EKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLN-KYALQHNIIHCHLLRENFLGKLLEL 239
            ++L LP  +  + +  D + +    + T YFL  + A           R  FL      
Sbjct: 192 ARLLPLPPVMLGKGEAPDHE-IAEGLKTTGYFLETRLAPALGNRPLPEARGRFLDAFSRR 250

Query: 240 I 240
           +
Sbjct: 251 L 251


>gi|259418038|ref|ZP_05741957.1| DNA repair protein RecO [Silicibacter sp. TrichCH4B]
 gi|259346944|gb|EEW58758.1| DNA repair protein RecO [Silicibacter sp. TrichCH4B]
          Length = 241

 Score =  290 bits (744), Expect = 8e-77,   Method: Composition-based stats.
 Identities = 88/242 (36%), Positives = 131/242 (54%), Gaps = 3/242 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D  I+L VR +GE + ++EV T+ +GRH G VR G S +M P LQ G  + + W +
Sbjct: 1   MDWRDQGILLTVRRHGESSALIEVFTQAHGRHAGLVRGGASRKMAPHLQPGAQLDLTWSA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLN 119
           RL  +LG ++ E L S  A  LS  L L GL ++  L  F LP+RE   ELY      L+
Sbjct: 61  RLEDHLGTYKAEPLRSRAASALSGRLALSGLNAVCALLAFALPDREAYSELYHRSEALLD 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                 +    +++ EL LL+++G+GLDL+ C VTG T+ L++VSPK+G AV  +    +
Sbjct: 121 LLDNEDLWPLGYLRWELSLLEDLGYGLDLSCCAVTGATEGLMYVSPKTGRAVSEAGAGEW 180

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLN-KYALQHNIIHCHLLRENFLGKLLE 238
           A+++L LP  +  E    D + L +A + T +F   K A           R  FL  L  
Sbjct: 181 ADRLLPLPPVMRGEGDGEDIEIL-TALRTTGFFFESKLAPALGNRPVPEARGRFLDALSR 239

Query: 239 LI 240
            +
Sbjct: 240 RL 241


>gi|99082396|ref|YP_614550.1| DNA repair protein RecO [Ruegeria sp. TM1040]
 gi|119361485|sp|Q1GDH8|RECO_SILST RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|99038676|gb|ABF65288.1| DNA repair protein RecO [Ruegeria sp. TM1040]
          Length = 241

 Score =  290 bits (744), Expect = 8e-77,   Method: Composition-based stats.
 Identities = 88/242 (36%), Positives = 129/242 (53%), Gaps = 3/242 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D  I+L VR +GE + ++EV T  +G H G VR G S +M P LQ G  + + W +
Sbjct: 1   MDWRDQGILLTVRRHGESSALIEVFTEDHGLHAGLVRGGASRKMAPHLQPGAQLDLTWSA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLN 119
           RL  +LG ++ E L S     LS  L L GL ++  L  F LP+R P   LY   +  L+
Sbjct: 61  RLEDHLGTYKAEPLRSRAGMALSGRLALAGLNAVCALLAFALPDRAPYPALYHRSSALLD 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                 +    +++ EL LL+++G+GLDL+ C  TGVTQDL +VSPK+G AV  +    +
Sbjct: 121 LLDSEDLWPLAYLRWELSLLEDLGYGLDLSACAATGVTQDLRYVSPKTGRAVSGAAAGEW 180

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLN-KYALQHNIIHCHLLRENFLGKLLE 238
           A+++L LP  +  E    D + L +A + T +FL  K A           R  FL  L  
Sbjct: 181 ADRLLPLPPVMRGEGAAEDIEIL-TALRTTGFFLESKLAPALGNRPIPEARGRFLDALAR 239

Query: 239 LI 240
            +
Sbjct: 240 RV 241


>gi|126728495|ref|ZP_01744311.1| DNA repair protein RecO [Sagittula stellata E-37]
 gi|126711460|gb|EBA10510.1| DNA repair protein RecO [Sagittula stellata E-37]
          Length = 241

 Score =  290 bits (742), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 85/238 (35%), Positives = 125/238 (52%), Gaps = 3/238 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D  I+L  R +GE ++IL+V T + GRH G +R G S +M P LQ G  + ++WR+
Sbjct: 1   MEWRDTGILLATRRHGETSLILDVFTPERGRHSGVLRGGTSRKMAPHLQPGAQLDLSWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLN 119
           RL  ++G F  E   S  A+ L   L L GL ++V L RF LPER P  +LY      L+
Sbjct: 61  RLEDHMGAFTVEPQRSRAAQALGDRLALAGLNAVVALLRFCLPERVPHPDLYTFSEQLLD 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
               P +    +++ E+ LL+ +GF LDL+ C VTG T+ L++VSPKSG AV       +
Sbjct: 121 LLDQPDLWPLAYLRWEMALLEEMGFALDLSCCAVTGRTEGLVYVSPKSGRAVTAEGAGNW 180

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLN-KYALQHNIIHCHLLRENFLGKL 236
              +L LP  +       D   + +A   T YFL  + A Q         R   + ++
Sbjct: 181 VHHLLPLPEVMLGRG-AADNPEVATALGTTGYFLEHRLAPQMGDKPVPEARARLIERI 237


>gi|323137541|ref|ZP_08072618.1| DNA repair protein RecO [Methylocystis sp. ATCC 49242]
 gi|322397167|gb|EFX99691.1| DNA repair protein RecO [Methylocystis sp. ATCC 49242]
          Length = 241

 Score =  288 bits (739), Expect = 3e-76,   Method: Composition-based stats.
 Identities = 96/239 (40%), Positives = 138/239 (57%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D+ +++G R +GE ++ILE+MTRQ+GRHLG VR G+S  M+P+LQ GNLV  +WR+
Sbjct: 1   MEWRDEGLVIGARKHGETSVILELMTRQHGRHLGVVRGGRSQAMRPVLQPGNLVVASWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL  +LG F  E L S  A+ L     L+G+ ++    R LPER+P  EL++M +     
Sbjct: 61  RLEVHLGAFAIEPLASRAARYLDRGAALHGVAALAAWLRLLPERDPYEELFEMADAIACR 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
                    +  + EL LL  +GFGLDL  C +TG   DL +VSPKSG AV R  G P+ 
Sbjct: 121 LDAADFAAPLMARFELALLGALGFGLDLGACALTGARDDLAYVSPKSGRAVSREAGAPWR 180

Query: 181 EKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLEL 239
           E++L  P+FL +       D + +AF+LT YFL +  L    +     R  ++  L   
Sbjct: 181 ERLLPYPAFLREASDVAAVDDVAAAFRLTGYFLTRDVLAPRGVAMPASRALYIDALARA 239


>gi|296444472|ref|ZP_06886437.1| DNA repair protein RecO [Methylosinus trichosporium OB3b]
 gi|296258119|gb|EFH05181.1| DNA repair protein RecO [Methylosinus trichosporium OB3b]
          Length = 240

 Score =  288 bits (738), Expect = 4e-76,   Method: Composition-based stats.
 Identities = 91/239 (38%), Positives = 139/239 (58%), Gaps = 1/239 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D+ +++GVR +GE  +ILE+MTR +GRH+G VR G    ++ +LQ GN V V WR+
Sbjct: 1   MEWRDEGLVIGVRRHGESAVILELMTRAHGRHMGLVRGGSGRALRSVLQVGNSVEVLWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG F  E L S  A+L+  +  L+G+  +  L R LPER+   EL++M  +  + 
Sbjct: 61  RLEEHLGAFAVEPLRSRAARLIDRAFALHGVAHLAALLRLLPERDAQRELFEMAELIADR 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
                +   +  + EL LL+ +GFGLD+ +C +TG TQDL +VSPK+G AV R  G P+ 
Sbjct: 121 LDSLDLAPALMARFELALLQALGFGLDVERCALTGATQDLAFVSPKTGRAVTRDAGAPWR 180

Query: 181 EKMLVLPSFLWK-EEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLE 238
           +++L  P FL        DA  L +AF+LT +FL +       +     R  ++G    
Sbjct: 181 DRLLPFPPFLQDCARAPADASELAAAFRLTGHFLARDVFTPRGLEAPQARALYVGAAAR 239


>gi|329850744|ref|ZP_08265589.1| DNA repair protein RecO [Asticcacaulis biprosthecum C19]
 gi|328841059|gb|EGF90630.1| DNA repair protein RecO [Asticcacaulis biprosthecum C19]
          Length = 244

 Score =  287 bits (734), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 82/238 (34%), Positives = 120/238 (50%), Gaps = 2/238 (0%)

Query: 2   YWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSR 61
            ++D+AI+L  + +GE   IL V+T  +G +   V  G S RM+  LQ G  V   +R+R
Sbjct: 3   EFEDEAIVLSAKLHGESGAILHVLTENHGVYAAHVAGGASRRMKAALQPGASVLFRFRAR 62

Query: 62  LAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFR-FLPEREPCLELYDMLNIFLNC 120
            ++ LG    E   S    +L  S+ L GLQ    + R  LPERE     Y  L+  L  
Sbjct: 63  HSEQLGTASVEASGS-GPDVLDDSVALLGLQCACLMTRQVLPERERHPGAYYALSALLGA 121

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P +   I+V+ E  LL+ +G+GLDL+ C VTG   DL++VSPKS  AV R  G  Y 
Sbjct: 122 FVAPDIWPAIYVRYEAGLLEELGYGLDLSACAVTGSRDDLVYVSPKSARAVSRGAGEAYR 181

Query: 181 EKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLE 238
           +K+LVLP FL   +  + A  +     LT +FL ++    +      +R      L +
Sbjct: 182 DKLLVLPQFLLSSQGGLIAGDVGRGLALTGFFLERHVFHPHNKPLPDVRLRLAEALAD 239


>gi|84500557|ref|ZP_00998806.1| DNA repair protein RecO [Oceanicola batsensis HTCC2597]
 gi|84391510|gb|EAQ03842.1| DNA repair protein RecO [Oceanicola batsensis HTCC2597]
          Length = 241

 Score =  286 bits (732), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 80/237 (33%), Positives = 131/237 (55%), Gaps = 3/237 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D  I+L VR +GE   I +V T   GRH G VR   S ++ P+LQ G  + ++W++
Sbjct: 1   MEWRDQGILLAVRRHGESAAIADVFTPGRGRHAGVVRGATSRKLAPVLQPGAQLDISWKA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLN 119
           RL ++LG F  E + S  A++L   L L GL ++  L  F LPERE    LY      L+
Sbjct: 61  RLEEHLGHFTVEPVRSRAAQILGDRLALAGLNAVTALLCFALPEREAHEALYRRTETLLD 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                 +    ++  EL LL+++G+GLDLT+C VTG  + L ++SP++G AV  +    +
Sbjct: 121 LLGQMDLWPLAYLHWELALLEDLGYGLDLTECAVTGAREGLDYISPRTGRAVTAAGAGDW 180

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNII-HCHLLRENFLGK 235
           A+++L LP  L ++ +  D + + S F++T +FL ++             R+ F+ +
Sbjct: 181 ADRLLPLPPCLLRQGEAPD-EEILSGFRVTGHFLAEHLAPELGQKPIPEARQRFVDR 236


>gi|84684348|ref|ZP_01012249.1| DNA repair protein RecO [Maritimibacter alkaliphilus HTCC2654]
 gi|84667327|gb|EAQ13796.1| DNA repair protein RecO [Rhodobacterales bacterium HTCC2654]
          Length = 246

 Score =  285 bits (731), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 87/242 (35%), Positives = 126/242 (52%), Gaps = 7/242 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D   +L VR +GE ++I+EV T ++GRH G VR G S ++ PILQ G+ + + WR+
Sbjct: 4   MEWRDQGTLLSVRKHGETSVIIEVFTAEHGRHAGVVRGGVSRKIAPILQPGSQLDLVWRA 63

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLN 119
           RL +++G F  E ++S  A ++     L GL +I  L  F LPERE    LY      L+
Sbjct: 64  RLEEHIGAFTVEPVKSRAAAIMGDRNALAGLNAITALLSFALPEREAHPRLYTRSIAMLD 123

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                      ++Q EL LL+ +G+GLDLT C VTG  +DL +VSPKSG AV       +
Sbjct: 124 LLAETPAWPVGYLQWELALLEELGYGLDLTACAVTGGAEDLAYVSPKSGRAVSAEGAGEW 183

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNK---YALQHNIIHCHLLRENFLGKL 236
            +++L LP  L     T D   +    + T YFL     +AL          R   + +L
Sbjct: 184 VDRLLPLPEELLGVV-TQDLAGIPDGLRTTGYFLTHGLAHALGDR--PLPEARARLVDRL 240

Query: 237 LE 238
             
Sbjct: 241 SR 242


>gi|159042759|ref|YP_001531553.1| DNA repair protein RecO [Dinoroseobacter shibae DFL 12]
 gi|254790521|sp|A8LLE2|RECO_DINSH RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|157910519|gb|ABV91952.1| DNA repair protein RecO [Dinoroseobacter shibae DFL 12]
          Length = 241

 Score =  285 bits (730), Expect = 3e-75,   Method: Composition-based stats.
 Identities = 75/241 (31%), Positives = 118/241 (48%), Gaps = 6/241 (2%)

Query: 2   YWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSR 61
            W+++ ++L VR +GE ++I+E  TR +GRHLG VR G S ++ P+LQ G  + + W++R
Sbjct: 3   EWREEGVLLSVRPHGETSVIVEAFTRAHGRHLGVVRGGVSRKLAPVLQPGAQLDLRWKAR 62

Query: 62  LAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLNC 120
           L  ++G F  E +    A +L   L L  + S + L RF L ER      YD     L+ 
Sbjct: 63  LEDHMGAFTVEPVRGRAAAVLGDRLALSAMSSALALARFSLAERAAYPGFYDQTVALLDA 122

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
               +     ++  E+ LL  +GFGLDL+ C V GV +DL +VSP++G AV R     + 
Sbjct: 123 LAEGTGWLPAYLDWEMALLDQMGFGLDLSGCAVRGVNEDLAFVSPRTGRAVSRQAAGAWV 182

Query: 181 EKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQH--NIIHCHLLRENFLGKLLE 238
           +++L LP  +           +      T +FL  + L            R  F+  L  
Sbjct: 183 DRLLPLPEVMLG--GPAHLHGVLEGLTTTGHFLE-HKLAPALGNRPPPEARARFIDVLSR 239

Query: 239 L 239
            
Sbjct: 240 A 240


>gi|89053018|ref|YP_508469.1| DNA repair protein RecO [Jannaschia sp. CCS1]
 gi|119361461|sp|Q28V18|RECO_JANSC RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|88862567|gb|ABD53444.1| DNA repair protein RecO [Jannaschia sp. CCS1]
          Length = 244

 Score =  284 bits (728), Expect = 6e-75,   Method: Composition-based stats.
 Identities = 78/243 (32%), Positives = 128/243 (52%), Gaps = 7/243 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+ D I+L VR +GE + I+E+ T   G HLG VR G S +M P+LQ G  +   WR+
Sbjct: 1   MDWRADGILLAVRRHGEASAIIELFTADQGCHLGVVRGGASRKMAPLLQVGAQLDATWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLN 119
           RL+ ++G +  E+++   A+++   + L GL S+  L  F LPER     L+      L+
Sbjct: 61  RLSDHIGSYTVELVKGRAAEVMEDRVALAGLSSVCALLSFSLPERAAYPGLFARTLAVLD 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                    + ++  E+ LL  +GFGLDL++C  TGVTQDL ++SP++G AV R+    +
Sbjct: 121 GLGAER-WAEAYLGWEMALLTEMGFGLDLSQCAATGVTQDLAFISPRTGRAVSRAAAGEW 179

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHN--IIHCHLLRENFLGKLL 237
           A+++L L   L  E      + + +   +T +FL  + L  +         R+  +  L 
Sbjct: 180 ADRLLPLSPAL--EGMARGPEDILAGLAVTGHFLATH-LAPSLGDKPLPAARQRLIDALE 236

Query: 238 ELI 240
             +
Sbjct: 237 RQV 239


>gi|302383088|ref|YP_003818911.1| DNA repair protein RecO [Brevundimonas subvibrioides ATCC 15264]
 gi|302193716|gb|ADL01288.1| DNA repair protein RecO [Brevundimonas subvibrioides ATCC 15264]
          Length = 243

 Score =  284 bits (727), Expect = 7e-75,   Method: Composition-based stats.
 Identities = 83/239 (34%), Positives = 134/239 (56%), Gaps = 1/239 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M + ++A +L  R++G+  ++++++T  +GRH  +V  G S RM+P LQAG  V  ++R+
Sbjct: 1   MEFHEEAFVLSARAHGDTGVVVDLLTETHGRHAAYVAGGASRRMKPFLQAGARVIADYRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLN 119
           R + +LG  R E +    + L    L L GL +   + +  LPEREP    +      ++
Sbjct: 61  RTSDHLGSARLEPVGEGPSALFDDGLALAGLSAAAAVAQGALPEREPHPGAFLAFEALMS 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
             +IP+V   IFV+ E  LL+++GFGLDL++C VTG   DL+WVSP++G +V  S G PY
Sbjct: 121 AFQIPAVWPAIFVRFEAGLLEDLGFGLDLSRCAVTGTMDDLVWVSPRTGRSVSASAGAPY 180

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLE 238
           A+K+L LP F+   +  +    +K    LT +FL ++            R   + KL E
Sbjct: 181 ADKLLKLPPFMLGAQAGLRDGDVKDGLDLTGHFLEQFVFHPQNKPLPTSRTWMIDKLGE 239


>gi|83951646|ref|ZP_00960378.1| DNA repair protein RecO [Roseovarius nubinhibens ISM]
 gi|83836652|gb|EAP75949.1| DNA repair protein RecO [Roseovarius nubinhibens ISM]
          Length = 257

 Score =  284 bits (727), Expect = 8e-75,   Method: Composition-based stats.
 Identities = 75/240 (31%), Positives = 127/240 (52%), Gaps = 4/240 (1%)

Query: 2   YWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSR 61
            W+D  ++L VR +GE ++I++V+T+ +GR+ G VR G S +++P+LQ G  + + WR+R
Sbjct: 3   EWRDRGLLLAVRPHGETSVIIDVLTQDHGRYAGVVRGGTSRKLRPVLQPGAELDLVWRAR 62

Query: 62  LAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLNC 120
           L  ++G F  E + +  A  L     L GL ++  + RF L ERE    L++     L  
Sbjct: 63  LDSHMGAFTVEPIRASLAVGLGVRQALAGLNAVTAMLRFALAEREAHGPLFERSLGLLEM 122

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVT-QDLLWVSPKSGGAVCRSVGLPY 179
                +    ++  E+ LL  +GFGLDL+ C V G    DL +VSP++G AV R     +
Sbjct: 123 IGEAELWPLAYLHWEMALLDELGFGLDLSTCAVLGREANDLSFVSPRTGRAVSRKGAGEW 182

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYAL-QHNIIHCHLLRENFLGKLLE 238
           A+++L LP+ L  E     A+ L   F +T +FL+++   +         R+  +  +  
Sbjct: 183 ADRLLPLPNCLL-EIAPAPAEDLVQGFAVTGHFLSQHLAGEMQGKPLPDARQRLIDLVAR 241


>gi|254502661|ref|ZP_05114812.1| DNA repair protein RecO [Labrenzia alexandrii DFL-11]
 gi|222438732|gb|EEE45411.1| DNA repair protein RecO [Labrenzia alexandrii DFL-11]
          Length = 244

 Score =  280 bits (716), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 91/235 (38%), Positives = 131/235 (55%), Gaps = 5/235 (2%)

Query: 8   IILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQNLG 67
           ++L  R +GE ++ILEVMT   GRHLG VR G+S R +P LQ GN + + W++RL+ +LG
Sbjct: 1   MVLTTRKHGENDVILEVMTADSGRHLGLVRGGRSKRHRPALQPGNELSLTWKARLSDHLG 60

Query: 68  EFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPSVI 127
           +F+ E   +  A L++S + L  +Q +  L R LPER P   +Y  LN+ L+        
Sbjct: 61  QFQIEPHTARAADLMNSGIGLAAVQHLAALVRLLPERHPYPRIYGALNVVLDHLDASDAA 120

Query: 128 GKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKMLVLP 187
             + ++ EL LL+ +G GLDLT C  TG T DL +VSP+S  AV R  G PY +K+L LP
Sbjct: 121 AALMIRFELELLQELGAGLDLTSCAATGTTDDLAYVSPRSARAVSREAGRPYHDKLLPLP 180

Query: 188 SFLWKEEQTI----DADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLE 238
           SFL   ++          +   FQLT +FL++  L    I     R      L +
Sbjct: 181 SFLLDGQRQAGTELTWQDVTQGFQLTGFFLDRQ-LGERNITDSGTRTLLTNALEK 234


>gi|154253316|ref|YP_001414140.1| DNA repair protein RecO [Parvibaculum lavamentivorans DS-1]
 gi|154157266|gb|ABS64483.1| DNA repair protein RecO [Parvibaculum lavamentivorans DS-1]
          Length = 234

 Score =  279 bits (715), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 85/229 (37%), Positives = 127/229 (55%), Gaps = 1/229 (0%)

Query: 9   ILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQNLGE 68
           +L  R++GE   ILE+ TR+ GRHLG V  G   RM+ +LQ GN +  +WR RL+++LG 
Sbjct: 1   MLSARAHGETGAILELFTREQGRHLGLVHGGAGRRMRSVLQPGNKLAAHWRGRLSEHLGT 60

Query: 69  FRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPSVIG 128
           ++ E+++     L+   L L GL +   +   LPERE    LYD   + L+  +   V  
Sbjct: 61  YQVELVKPLAGLLMDDPLALLGLSAASAICSILPEREAHPALYDGYEVLLDTMRDEDVWP 120

Query: 129 KIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKMLVLPS 188
            +FV+ EL LL+ +GFGLDLT+C  TG   DL +VSP+SG AV R  G  Y E++  LP 
Sbjct: 121 AVFVRWELGLLQELGFGLDLTQCAATGSRDDLAYVSPRSGSAVSRGAGEIYKERLFRLPG 180

Query: 189 FLWKEE-QTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKL 236
           FL   +    +A  +    +LT +FL ++    +  H    R   + K+
Sbjct: 181 FLVGSQAGAAEAADVAEGLRLTGHFLERHLFAAHERHLPDARIRLMEKM 229


>gi|221234572|ref|YP_002517008.1| DNA repair protein RecO [Caulobacter crescentus NA1000]
 gi|254790515|sp|B8GVD0|RECO_CAUCN RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|220963744|gb|ACL95100.1| DNA repair protein recO [Caulobacter crescentus NA1000]
          Length = 243

 Score =  279 bits (714), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 78/240 (32%), Positives = 121/240 (50%), Gaps = 1/240 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D+A +L  RS+GE   I+E++T   G+    V    S RM+P LQ G  V V +R+
Sbjct: 1   MEWEDEAYVLSARSHGETGAIVELLTEARGKVAAHVAGAASRRMKPFLQPGARVIVRYRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFL-PEREPCLELYDMLNIFLN 119
           ++   LG    E +    + L    L L GL +   +     PERE     +  L   + 
Sbjct: 61  KVEGQLGSATLEPMGEGPSSLFDDRLALAGLSAAAAVAAAALPEREAHPGAFHALEALIR 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
             +IP +   ++V+ E  LL+ +GFGLDL+KC  TG   DL++VSP++G AV R  G PY
Sbjct: 121 VLEIPEIWPAVYVRYEAGLLQELGFGLDLSKCAATGAFDDLVYVSPRTGRAVSREAGKPY 180

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLEL 239
            +K+L LP F+   +  +    +K+   +T +FL ++            R   L +L E 
Sbjct: 181 HDKLLPLPPFMLSSQGGLAEGDVKAGLDITGHFLEQFVFGPLNRPLPPARLWLLDRLAEA 240


>gi|254420124|ref|ZP_05033848.1| DNA repair protein RecO [Brevundimonas sp. BAL3]
 gi|196186301|gb|EDX81277.1| DNA repair protein RecO [Brevundimonas sp. BAL3]
          Length = 243

 Score =  279 bits (714), Expect = 3e-73,   Method: Composition-based stats.
 Identities = 80/239 (33%), Positives = 131/239 (54%), Gaps = 1/239 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M + ++A +L  R++G+   +++++T  +GR   +V  G S +M+P LQAG  V  ++R+
Sbjct: 1   MDFHEEAFVLSARAHGDTGAVVDLLTESHGRRAAYVAGGASRKMRPFLQAGARVVADYRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFL-PEREPCLELYDMLNIFLN 119
           R + +LG  R E +    + L   +L L GL +   + +   PEREP   ++      + 
Sbjct: 61  RTSDHLGGARLEPVGEGPSALFDDALALTGLAAAAGVAQGALPEREPHPGVFLAFEALMA 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
              +P V   IFV+ E  LL+++GFGLDL+KC  TG   DL++VSP++G AV R  G PY
Sbjct: 121 AFALPDVWPAIFVRFEAGLLEDLGFGLDLSKCAATGTADDLIYVSPRTGRAVSREAGAPY 180

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLE 238
           A+KML LP F+   +  +    +++ F LT +FL ++            R   L +L E
Sbjct: 181 ADKMLSLPPFMLGAQAGLVEGDVRAGFDLTGHFLEQFVFHPQNKPLPAARVWMLDRLAE 239


>gi|146278602|ref|YP_001168761.1| DNA repair protein RecO [Rhodobacter sphaeroides ATCC 17025]
 gi|172046019|sp|A4WVP2|RECO_RHOS5 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|145556843|gb|ABP71456.1| DNA repair protein RecO [Rhodobacter sphaeroides ATCC 17025]
          Length = 237

 Score =  278 bits (713), Expect = 3e-73,   Method: Composition-based stats.
 Identities = 78/238 (32%), Positives = 122/238 (51%), Gaps = 5/238 (2%)

Query: 2   YWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSR 61
            W+D+  +L VR +GE   I+EV T  +GRHLG VR G S R  P+LQ G  + + W++R
Sbjct: 3   EWRDEGALLSVRRHGESAAIIEVFTASHGRHLGVVRGGASRRHAPVLQPGAQLDLTWKAR 62

Query: 62  LAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFR-FLPEREPCLELYDMLNIFLNC 120
           L  ++G F  E L +    +    L L GL +I  +    LPEREP + L+      ++ 
Sbjct: 63  LDDHMGAFTVEPLRARTG-IFGDRLALAGLNAICAMLHVVLPEREPHVGLWRESIELMDA 121

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P      +++ E+ LL+  GFGLDLT+C VTG  +DL +VSP++G AV R+    +A
Sbjct: 122 LAAPG-WPAAYLRWEMRLLEEAGFGLDLTRCAVTGSREDLAFVSPRTGRAVGRAAAGDWA 180

Query: 181 EKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLE 238
           +++  LP  L  +      + ++    +T +FL +  L          R   +  L  
Sbjct: 181 DRLFPLPLALLGQGPASGPE-VRQGLAITGHFLARE-LPLAGRPLPEARARLIDLLAR 236


>gi|260576291|ref|ZP_05844283.1| DNA repair protein RecO [Rhodobacter sp. SW2]
 gi|259021559|gb|EEW24863.1| DNA repair protein RecO [Rhodobacter sp. SW2]
          Length = 238

 Score =  278 bits (713), Expect = 4e-73,   Method: Composition-based stats.
 Identities = 86/240 (35%), Positives = 121/240 (50%), Gaps = 4/240 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D   +L VR +GE   I+EV T  +GRH G VR G S R+ P+LQ G  + V WR+
Sbjct: 1   MEWRDQGALLSVRPHGESAAIIEVFTAAHGRHAGVVRGGASRRIAPLLQPGAQLDVVWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLN 119
           RL  ++G F  E + S    +L   L L GL +I  + R  LPER P   LY      L+
Sbjct: 61  RLEGHIGAFTVEPVRSRAG-VLGDRLALAGLNAICAMVRVALPERAPHDLLYAATIAVLD 119

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
             +        +++ EL+LL+ +GFGLDL +C VTG   DL +VSPK+G AV R     +
Sbjct: 120 ALETAPDWPARYLRWELLLLEELGFGLDLGRCAVTGSRDDLAYVSPKTGRAVSRDGAGEW 179

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNII-HCHLLRENFLGKLLE 238
           A ++L LP  L   +       L +   +T +FL +       + H    R   L  L  
Sbjct: 180 AARLLPLPDCLLG-QGPASGADLAAGLAVTGHFLTREMASLRHVQHLPEARARLLELLAR 238


>gi|295690015|ref|YP_003593708.1| DNA repair protein RecO [Caulobacter segnis ATCC 21756]
 gi|295431918|gb|ADG11090.1| DNA repair protein RecO [Caulobacter segnis ATCC 21756]
          Length = 243

 Score =  278 bits (711), Expect = 5e-73,   Method: Composition-based stats.
 Identities = 76/240 (31%), Positives = 122/240 (50%), Gaps = 1/240 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D+A +L  RS+GE   I+E++T+  G+    V    S RM+P LQ G  V   +R+
Sbjct: 1   MEWEDEAYVLSARSHGETGAIVELLTQDRGKFAAHVAGAASRRMKPFLQPGARVIARYRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFL-PEREPCLELYDMLNIFLN 119
           R++  LG    E +    + L    L L GL +   +     PERE     +  L   + 
Sbjct: 61  RMSDQLGSASLEPMGEGPSSLFDDRLALAGLSAAAAVAAAALPEREAHPGAFHALEALIR 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
             ++  +   ++V+ E  LL+ +GFGLDL++C  TGV  DL++VSP++G AV R  G PY
Sbjct: 121 VLEVSEIWPAVYVRYEAGLLQELGFGLDLSRCAATGVFDDLVYVSPRTGRAVSREAGRPY 180

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLEL 239
            +K+L LP F+   +  +    +K+   +T +FL ++            R   L +L E 
Sbjct: 181 HDKLLPLPPFMLSSQGGLAEGDVKAGLDITGHFLEQFVFGPLNRPLPPARMWLLDRLTEA 240


>gi|254293710|ref|YP_003059733.1| DNA repair protein RecO [Hirschia baltica ATCC 49814]
 gi|254042241|gb|ACT59036.1| DNA repair protein RecO [Hirschia baltica ATCC 49814]
          Length = 290

 Score =  277 bits (708), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 80/239 (33%), Positives = 123/239 (51%), Gaps = 2/239 (0%)

Query: 2   YWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSR 61
            W D AI LG R++GE ++IL+V T   GR  G V  G S + +P+++AGN + V W+++
Sbjct: 3   EWSDTAISLGARTFGETDVILDVFTPSRGRTRGLVYGGISQKKRPMIEAGNTIDVQWKAK 62

Query: 62  LAQNLGEFRF-EVLESHCAKLLSSSLFLYGLQSIVPLFR-FLPEREPCLELYDMLNIFLN 119
              +LG F   + +    A+ +   L L GL ++  + R  LPE E    LY+     L+
Sbjct: 63  TESSLGHFSVADAINQRAARCMIDPLALAGLSAVTSILRDGLPEGEAKDGLYEATETLLD 122

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
               P +   IF++ EL  L+ +G+GL+L  CV++G    L  VSPKSG AV  S    Y
Sbjct: 123 VMGEPDIWPAIFIKWELGFLQQMGYGLNLETCVISGANDGLTHVSPKSGCAVRGSEAEEY 182

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLE 238
            +K+L LP+FL   +       + + F+LT YFL +             R   L +L +
Sbjct: 183 IDKLLSLPAFLTDAKAPPSPYDIGAGFKLTGYFLTRRLFADINRDAPEARYLMLERLEK 241


>gi|197105330|ref|YP_002130707.1| recombinational DNA repair protein (RecF pathway) [Phenylobacterium
           zucineum HLK1]
 gi|254764651|sp|B4RCU1|RECO_PHEZH RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|196478750|gb|ACG78278.1| recombinational DNA repair protein (RecF pathway) [Phenylobacterium
           zucineum HLK1]
          Length = 243

 Score =  276 bits (706), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 82/240 (34%), Positives = 123/240 (51%), Gaps = 1/240 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M ++DDA +L  R++GE   I+E++T  +GR+   V  G S +++P LQ G  V   +R+
Sbjct: 1   MEFEDDAFVLAARAHGETGAIVELLTSAHGRYAAHVAGGASRKVRPFLQPGARVIARYRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFL-PEREPCLELYDMLNIFLN 119
           R++  LG    E +    A L    L L GL +   +     PEREP    +        
Sbjct: 61  RVSDQLGSAAIEPVGEGPAALFDDPLALSGLSAAAAVAAGALPEREPHPGAFLAFEALTG 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
               P V   +FV+ E  LL+++GFGLDL+KC  TG+T DL+WVSP++G AV R  G PY
Sbjct: 121 ALTHPDVWPAVFVRFEAGLLQDLGFGLDLSKCAATGITDDLVWVSPRTGRAVSRQAGEPY 180

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLEL 239
            +++L LP FL   +  + A  + +   LT +FL  +            R   L +L E 
Sbjct: 181 KDRLLALPPFLLSAQGGLRAGDVAAGLALTGHFLEAFIFGPLNRPLPPARLWLLDRLSEA 240


>gi|16125811|ref|NP_420375.1| DNA repair protein RecO [Caulobacter crescentus CB15]
 gi|20139676|sp|Q9A802|RECO_CAUCR RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|13422953|gb|AAK23543.1| conserved hypothetical protein [Caulobacter crescentus CB15]
          Length = 250

 Score =  275 bits (703), Expect = 4e-72,   Method: Composition-based stats.
 Identities = 77/239 (32%), Positives = 120/239 (50%), Gaps = 1/239 (0%)

Query: 2   YWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSR 61
            W+D+A +L  RS+GE   I+E++T   G+    V    S RM+P LQ G  V V +R++
Sbjct: 9   EWEDEAYVLSARSHGETGAIVELLTEARGKVAAHVAGAASRRMKPFLQPGARVIVRYRAK 68

Query: 62  LAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFL-PEREPCLELYDMLNIFLNC 120
           +   LG    E +    + L    L L GL +   +     PERE     +  L   +  
Sbjct: 69  VEGQLGSATLEPMGEGPSSLFDDRLALAGLSAAAAVAAAALPEREAHPGAFHALEALIRV 128

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
            +IP +   ++V+ E  LL+ +GFGLDL+KC  TG   DL++VSP++G AV R  G PY 
Sbjct: 129 LEIPEIWPAVYVRYEAGLLQELGFGLDLSKCAATGAFDDLVYVSPRTGRAVSREAGKPYH 188

Query: 181 EKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLEL 239
           +K+L LP F+   +  +    +K+   +T +FL ++            R   L +L E 
Sbjct: 189 DKLLPLPPFMLSSQGGLAEGDVKAGLDITGHFLEQFVFGPLNRPLPPARLWLLDRLAEA 247


>gi|294678824|ref|YP_003579439.1| DNA repair protein RecO [Rhodobacter capsulatus SB 1003]
 gi|294477644|gb|ADE87032.1| DNA repair protein RecO [Rhodobacter capsulatus SB 1003]
          Length = 240

 Score =  274 bits (702), Expect = 6e-72,   Method: Composition-based stats.
 Identities = 84/240 (35%), Positives = 117/240 (48%), Gaps = 4/240 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M WQD   IL  R +GE + I+EV T  +GRHLG VR G S +M  +L  G+ V V WR+
Sbjct: 1   MDWQDSGTILSTRLHGESSAIVEVFTATHGRHLGVVRGGASRKMAAVLMPGSHVAVAWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLN 119
           RL   LG F  E L S     LS  L L GL ++  L  F L ER P   LY        
Sbjct: 61  RLEDQLGSFTVEPLASRAG-ALSDRLALMGLNAVCALLSFVLAERAPHPRLYAATEPLFT 119

Query: 120 CHKI-PSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
                       ++  E+ LL+++GFGLDL++C VTG   DL +VSP++G AV R+    
Sbjct: 120 VIGQAAEGWVVDYLIWEMALLEDLGFGLDLSRCAVTGTRDDLAFVSPRTGRAVSRAGAGD 179

Query: 179 YAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLE 238
           +A K+L L       +       +     LT +FL ++A +H+       R   +  +  
Sbjct: 180 WAPKLLPL-PLCLLGQGPATWTEIGQGLTLTGHFLTRFASEHSRKALPEARNRLIAAIAR 238


>gi|288958668|ref|YP_003449009.1| DNA repair protein RecO [Azospirillum sp. B510]
 gi|288910976|dbj|BAI72465.1| DNA repair protein RecO [Azospirillum sp. B510]
          Length = 240

 Score =  274 bits (701), Expect = 9e-72,   Method: Composition-based stats.
 Identities = 82/241 (34%), Positives = 117/241 (48%), Gaps = 6/241 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W D  I+L  R  GE + +  ++TR +GRH G V  G+S R +  L+ G LV   WR 
Sbjct: 1   MDWSDQGIVLSARPQGEGSAVATLLTRGHGRHAGMVMGGRSARQRGTLEPGTLVHARWRG 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLF-RFLPEREPCLELYDMLNIFLN 119
           RL ++LG F  E +  + A     +  L  L S   L    LPERE    L+D L +   
Sbjct: 61  RLPEHLGHFTLEPVRGYAAGFFDDAQALAALTSACALVEAALPEREAHPALFDGLLVLFG 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
               P    + +V+ E+ LL  +GFGLDL +C V+G    L +VSP++G AV  SVG PY
Sbjct: 121 LLDSP-AWAETYVRWEVGLLAELGFGLDLDRCAVSGANDYLAYVSPRTGRAVTASVGEPY 179

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLEL 239
            +++L LP FL        A       +LT +FL ++ L          RE    +    
Sbjct: 180 RDRLLPLPDFLAGRGGGGPAAV-ADGLRLTAHFLERHLL---NGPLPPARERLRERYANA 235

Query: 240 I 240
           +
Sbjct: 236 V 236


>gi|319898694|ref|YP_004158787.1| DNA repair protein RecO [Bartonella clarridgeiae 73]
 gi|319402658|emb|CBI76204.1| DNA repair protein RecO [Bartonella clarridgeiae 73]
          Length = 231

 Score =  273 bits (700), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 100/223 (44%), Positives = 139/223 (62%), Gaps = 1/223 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W++ AIILG R +GE ++ILE+MTRQ GR++G V+ G+S RM  +LQ GN V   W +
Sbjct: 1   MKWKEQAIILGTRQHGETSVILEIMTRQRGRYMGIVKGGRSRRMAFLLQPGNFVEAEWWA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG FR E L+ H ++L+     LY  Q +    R LPER+P   LYDML  F+  
Sbjct: 61  RLDEHLGLFRLEALDLHASRLIVLPEALYSFQLMASHLRLLPERDPHPVLYDMLYFFMQN 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P +  ++ V+ EL+LL+ +GFGLDL+ C VTG  + L +VSPKSG AVC  VG P+ 
Sbjct: 121 FDDPFINAELLVRFELLLLEELGFGLDLSCCAVTGRQEKLCYVSPKSGRAVCEEVGRPWK 180

Query: 181 EKMLVLPSFL-WKEEQTIDADSLKSAFQLTDYFLNKYALQHNI 222
           +K+L LP FL  K    +D + +K    LTD+F N   L+   
Sbjct: 181 DKLLFLPQFLARKTICPVDFNDIKKGLILTDFFFNTLCLERER 223


>gi|296116242|ref|ZP_06834859.1| putative DNA repair protein recO [Gluconacetobacter hansenii ATCC
           23769]
 gi|295977176|gb|EFG83937.1| putative DNA repair protein recO [Gluconacetobacter hansenii ATCC
           23769]
          Length = 265

 Score =  273 bits (699), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 78/246 (31%), Positives = 128/246 (52%), Gaps = 6/246 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+  A++L    YGE ++I  V+T ++G + G VR G + + +P+ QAGNL+   W +
Sbjct: 7   MEWEAPALVLSAVPYGESSMIAHVLTGEHGLYHGMVRGGGARQGRPVWQAGNLITARWNA 66

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLF-RFLPEREPCLELYDMLNIFLN 119
           RL + LG  R E++ +  A++L  +  L  L S+  L    LPEREP L +++ L   L 
Sbjct: 67  RLPEQLGSLRGELVHASAARVLEYAHPLAMLASLCALADSSLPEREPHLAVFEELTRLLA 126

Query: 120 CHKIPSVIGK-----IFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRS 174
              +     +       ++ E++LL ++GFGLDL+ C V+G   DL WVSP+SG AV   
Sbjct: 127 RISLEPAEAERSGMAALIRWEMLLLSDLGFGLDLSCCAVSGQADDLAWVSPRSGRAVSDG 186

Query: 175 VGLPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLG 234
               + +++L+LP FL    Q    +   +  +LT +FL + A           R   L 
Sbjct: 187 HAGQWRDRLLMLPPFLLDPTQDGTPEQWLAGLRLTGHFLARDAFGQRHRPLPAARIRLLD 246

Query: 235 KLLELI 240
            +  ++
Sbjct: 247 MVGRMV 252


>gi|239947680|ref|ZP_04699433.1| DNA repair protein RecO [Rickettsia endosymbiont of Ixodes
           scapularis]
 gi|239921956|gb|EER21980.1| DNA repair protein RecO [Rickettsia endosymbiont of Ixodes
           scapularis]
          Length = 234

 Score =  273 bits (698), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 79/238 (33%), Positives = 127/238 (53%), Gaps = 5/238 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M  +D  +I+  +   E   I+ V T+ +G + G V+   S + + I Q GN+V   W++
Sbjct: 1   MNIKDIGVIIAKKPLKENTFIITVFTKNHGLYSGVVKE-SSKKSKFIYQEGNIVDFLWQA 59

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFL-PEREPCLELYDMLNIFLN 119
           RL +++G  + E+++S+    + +   LY   S++ L + L  ERE     +  L  +L+
Sbjct: 60  RLHEHIGMAKCELIKSYTGYFIINKAKLYAFNSVISLIKELFHEREEHSNFFSFLINYLD 119

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                +   + ++  EL LL   G+ LDLTKC V+ VT DL +VSPKSG A+   VG PY
Sbjct: 120 NL-SKNFCFRDYINFELALLAETGYKLDLTKCDVSHVTTDLTYVSPKSGRALSYKVGKPY 178

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLL 237
            +K+L+LP FL  E   I  +  K A  LT+YF N+Y   +N       R+ F+  +L
Sbjct: 179 KDKLLILPRFLLSENSEITLEEKKQAITLTNYFFNRYLFHNNR--QAEARQAFMEYIL 234


>gi|157825871|ref|YP_001493591.1| DNA repair protein RecO [Rickettsia akari str. Hartford]
 gi|254764658|sp|A8GNV8|RECO_RICAH RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|157799829|gb|ABV75083.1| DNA repair protein RecO [Rickettsia akari str. Hartford]
          Length = 237

 Score =  272 bits (696), Expect = 3e-71,   Method: Composition-based stats.
 Identities = 80/238 (33%), Positives = 129/238 (54%), Gaps = 5/238 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M  +D  +I+  +   E   I+ V T+ +G + G V+   S + + I Q GN+V   W++
Sbjct: 1   MNIKDVGVIISKKPLKENTFIITVCTKNHGLYSGVVKE-SSKKSKFIYQEGNIVDFLWQA 59

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFL-PEREPCLELYDMLNIFLN 119
           RL +++G  + E+++S+   L+ +   LY   SI+ L + L  ERE     +  L  +L+
Sbjct: 60  RLHEHIGIAKCELIKSYTGYLIINKTKLYAFNSIISLIKELCHEREKHSNFFSFLLNYLD 119

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                +   + ++  EL LL   G+ LDLTKC VT VT DL +VSPKS  A+   VG PY
Sbjct: 120 NL-SKNFCFRDYINFELTLLAKTGYKLDLTKCGVTHVTTDLTYVSPKSARALSYEVGKPY 178

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLL 237
            +K+L+LP FL  ++  I  +  + A  LT+YF N+Y   +N       R+ F+G +L
Sbjct: 179 KDKLLILPKFLLSDDSEITLEEKRQALTLTNYFFNRYLFHNNR--QPEARQTFVGYIL 234


>gi|15892735|ref|NP_360449.1| DNA repair protein RecO [Rickettsia conorii str. Malish 7]
 gi|34581542|ref|ZP_00143022.1| hypothetical protein [Rickettsia sibirica 246]
 gi|81595557|sp|Q92HF9|RECO_RICCN RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|15619911|gb|AAL03350.1| unknown [Rickettsia conorii str. Malish 7]
 gi|28262927|gb|EAA26431.1| unknown [Rickettsia sibirica 246]
          Length = 237

 Score =  271 bits (694), Expect = 5e-71,   Method: Composition-based stats.
 Identities = 75/238 (31%), Positives = 128/238 (53%), Gaps = 5/238 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M  +D  +I+  +   E   I+ V T+ +G + G V+   S + + I Q GN++   W++
Sbjct: 1   MNIKDIGVIIAKKPLKENTFIITVFTKNHGLYSGVVKE-FSKKSKFIYQEGNIIDFLWQA 59

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFL-PEREPCLELYDMLNIFLN 119
           RL +++G  + E+++S+    +++   LY   S++ L + L  ERE   + +  L  +L+
Sbjct: 60  RLHEHIGMAKCELIKSYTGYFITNKAKLYAFNSVISLIKELFHEREEHSKFFSFLINYLD 119

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                +   + ++  EL LL   G+ LDLTKC V+ VT DL++VSPKS  A+   VG PY
Sbjct: 120 NL-SKNFCFRDYINFELALLAETGYKLDLTKCGVSHVTTDLIYVSPKSARALSYEVGKPY 178

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLL 237
            +K+L+LP FL  +   I  +  + A  LT+YF N+Y   +N       R+ F+   L
Sbjct: 179 KDKLLMLPRFLLSDNSEITLEEKRQALALTNYFFNRYLFHNNRQV--EARQTFIEYTL 234


>gi|238650314|ref|YP_002916166.1| DNA repair protein RecO [Rickettsia peacockii str. Rustic]
 gi|259563684|sp|C4K0L7|RECO_RICPU RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|238624412|gb|ACR47118.1| DNA repair protein RecO [Rickettsia peacockii str. Rustic]
          Length = 237

 Score =  270 bits (692), Expect = 9e-71,   Method: Composition-based stats.
 Identities = 75/238 (31%), Positives = 128/238 (53%), Gaps = 5/238 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M  +D  +I+  +   E   I+ V T+ +G + G V+   S + + I Q GN++   W++
Sbjct: 1   MNIKDIGVIIAKKPLKENTFIITVFTKNHGLYSGVVKE-FSKKSKFIYQEGNIIDFLWQA 59

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFL-PEREPCLELYDMLNIFLN 119
           RL +++G  + E+++S+    +++   LY   S++ L + L  ERE   + +  L  +L+
Sbjct: 60  RLHEHIGMAKCELIKSYTGYFITNKAKLYAFNSVISLIKELFHEREEHSKFFLFLINYLD 119

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                +   + ++  EL LL   G+ LDLTKC V+ VT DL++VSPKS  A+   VG PY
Sbjct: 120 NL-SKNFCFRDYINFELALLAETGYKLDLTKCGVSHVTTDLIYVSPKSARALSYEVGKPY 178

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLL 237
            +K+L+LP FL  +   I  +  + A  LT+YF N+Y   +N       R+ F+   L
Sbjct: 179 KDKLLMLPRFLLSDNSEITLEEKRQALALTNYFFNRYLFHNNRQV--EARQTFIEYTL 234


>gi|157803626|ref|YP_001492175.1| DNA repair protein RecO [Rickettsia canadensis str. McKiel]
 gi|254790734|sp|A8EYF7|RECO_RICCK RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|157784889|gb|ABV73390.1| DNA repair protein RecO [Rickettsia canadensis str. McKiel]
          Length = 241

 Score =  270 bits (691), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 78/238 (32%), Positives = 126/238 (52%), Gaps = 5/238 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M  +D  +I+  +   E   I+ V T+ YG + G V+   S + + I Q GN+V   W +
Sbjct: 1   MNIKDIGVIVAKKPLKENTFIITVFTKNYGLYSGVVK-ASSKKSKFIYQEGNIVDFLWMA 59

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFR-FLPEREPCLELYDMLNIFLN 119
           RL +++G  + E+++S+    +++   LY   SI+ L +  L ERE     +  L  +L+
Sbjct: 60  RLHEHIGIAKCELIKSYTGYFITNKTKLYAFNSIISLIKELLHEREEYSNFFSFLINYLD 119

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                    + ++  EL LL   G+ LDL+KC V+ V QDL +VSPKSG A+   VG PY
Sbjct: 120 NL-SKKFFFRDYINFELALLDIAGYKLDLSKCAVSNVKQDLYYVSPKSGRALSYEVGKPY 178

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLL 237
            +K+L+LP FL  +   I  +  + A  LT+YF N+Y   +N       R+ F+  +L
Sbjct: 179 KDKLLILPKFLLSDNSKITLEEKRQALTLTNYFFNRYLFHNNR--HAEARQAFMEYIL 234


>gi|330994746|ref|ZP_08318668.1| DNA repair protein recO [Gluconacetobacter sp. SXCC-1]
 gi|329758007|gb|EGG74529.1| DNA repair protein recO [Gluconacetobacter sp. SXCC-1]
          Length = 263

 Score =  270 bits (690), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 77/244 (31%), Positives = 115/244 (47%), Gaps = 6/244 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+  A++L    YGE + I+ V+T +YG + G  R G + R +   Q GNLVR  W +
Sbjct: 1   MEWEAPALVLSATPYGEGSAIVHVLTGEYGLYHGLARGGSASRGRATWQTGNLVRARWTA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFR-FLPEREPCLELYDMLNIFLN 119
           RL + LG    E + +  A+LL   L L  L S+  L    LPEREP   ++  L   L 
Sbjct: 61  RLPEQLGSITAETVHASAARLLDYPLPLAMLASLCALADDCLPEREPHPAIFQGLTSLLA 120

Query: 120 CHKIPSVIGKI-----FVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRS 174
              +     +       V+ ELMLL ++GFGLDL  C + G  +DL WVSP++G AV   
Sbjct: 121 RISLDPQWAETEAMPEIVRWELMLLSDLGFGLDLGGCALGGSREDLRWVSPRTGRAVSDE 180

Query: 175 VGLPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLG 234
               + +++L LP F+   +Q           +L+ +FL + A           R     
Sbjct: 181 KAGAWRDRLLPLPGFILHPQQVATPRDWHDGLRLSGHFLRRDAFGQRHRPVPEARGRLAD 240

Query: 235 KLLE 238
            +  
Sbjct: 241 MIAR 244


>gi|157828681|ref|YP_001494923.1| DNA repair protein RecO [Rickettsia rickettsii str. 'Sheila Smith']
 gi|165933400|ref|YP_001650189.1| DNA repair protein RecO [Rickettsia rickettsii str. Iowa]
 gi|254790735|sp|B0BY57|RECO_RICRO RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|254790736|sp|A8GSP0|RECO_RICRS RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|157801162|gb|ABV76415.1| DNA repair protein RecO [Rickettsia rickettsii str. 'Sheila Smith']
 gi|165908487|gb|ABY72783.1| DNA repair protein [Rickettsia rickettsii str. Iowa]
          Length = 237

 Score =  269 bits (688), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 75/238 (31%), Positives = 127/238 (53%), Gaps = 5/238 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M  +D  +I+  +   E   I+ V T+ +G + G V+   S + + I Q GN++   W++
Sbjct: 1   MNIKDIGVIIAKKPLKENTFIITVFTKNHGLYSGVVKE-FSKKSKFIYQEGNIIDFLWQA 59

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFL-PEREPCLELYDMLNIFLN 119
           RL +++G  + E+++S+    +++   LY   S++ L + L  ERE   + +  L  +L+
Sbjct: 60  RLHEHIGMAKCELIKSYTGYFITNKTKLYAFNSVISLIKELFHEREEHSKFFSFLINYLD 119

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                    + ++  EL LL   G+ LDLTKC V+ VT DL++VSPKS  A+   VG PY
Sbjct: 120 NL-SKHFCFRDYINFELALLAETGYKLDLTKCGVSHVTTDLIYVSPKSARALSYEVGKPY 178

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLL 237
            +K+L+LP FL  +   I  +  + A  LT+YF N+Y   +N       R+ F+   L
Sbjct: 179 KDKLLMLPRFLLSDNSEITLEEKRQALALTNYFFNRYLFHNNRQV--EARQTFIEYTL 234


>gi|229586870|ref|YP_002845371.1| DNA repair protein RecO [Rickettsia africae ESF-5]
 gi|259563683|sp|C3PNW8|RECO_RICAE RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|228021920|gb|ACP53628.1| DNA repair protein RecO [Rickettsia africae ESF-5]
          Length = 237

 Score =  268 bits (687), Expect = 3e-70,   Method: Composition-based stats.
 Identities = 75/238 (31%), Positives = 130/238 (54%), Gaps = 5/238 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M  +D  +I+  ++  E   I+ V T+ +G + G V+   S + + I Q GN++   W++
Sbjct: 1   MNIKDIGVIIAKKTLKENTFIITVFTKNHGLYSGVVKE-FSKKSKFIYQEGNIIDFLWQA 59

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFL-PEREPCLELYDMLNIFLN 119
           RL +++G  + E+++S+    +++   LY   S++ L + L  ERE   + +  L  +L+
Sbjct: 60  RLHEHIGMAKCELIKSYTGYFITNKAKLYAFNSVISLIKELFHEREEHSKFFSFLINYLD 119

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                +   + ++  EL LL   G+ LDLTKC V+ VT DL++VSPKS  A+  +VG PY
Sbjct: 120 NL-SKNFCFRDYINFELALLAETGYKLDLTKCGVSHVTTDLIYVSPKSARALSYAVGKPY 178

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLL 237
            +K+L+LP FL  +   I  +  + A  LT+YF N+Y   +N       R+ F+   L
Sbjct: 179 KDKLLMLPRFLLSDNSEITLEEKRQALALTNYFFNRYLFHNNRQV--EARQTFIEYTL 234


>gi|312115948|ref|YP_004013544.1| DNA repair protein RecO [Rhodomicrobium vannielii ATCC 17100]
 gi|311221077|gb|ADP72445.1| DNA repair protein RecO [Rhodomicrobium vannielii ATCC 17100]
          Length = 241

 Score =  268 bits (687), Expect = 3e-70,   Method: Composition-based stats.
 Identities = 84/240 (35%), Positives = 120/240 (50%), Gaps = 3/240 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W DD I L  R +GE ++I ++ TR  GR  G V+ G+S R++P+LQ GN + V WR+
Sbjct: 1   MRWADDGIFLAGRPHGETSVIADIFTRANGRAKGLVKGGRSRRLRPLLQTGNTLGVEWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL   LG +  E+  +  A  L     L G+ ++  L + L ER+P   LYD     L  
Sbjct: 61  RLDDQLGVYTVELARATAANALDDPSALAGMTALAALLQVLAERDPHPALYDAAQDCLAH 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
               S     F++ EL  L  +GFGL+L  C  TG   DL++VSPKSG AVCR  G PYA
Sbjct: 121 ASDASF-PAAFIRFELRFLNELGFGLNLATCAATGRADDLIYVSPKSGQAVCREAGEPYA 179

Query: 181 EKMLVLP--SFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLE 238
           +++L LP                +++   LT +FL  +    +       R+ F   L  
Sbjct: 180 DRLLPLPAFLANAASAAAPSDAEIEAGLLLTGHFLAVHVFAESGKPLPTARDEFARTLRR 239


>gi|67459260|ref|YP_246884.1| DNA repair protein RecO [Rickettsia felis URRWXCal2]
 gi|75536308|sp|Q4UL54|RECO_RICFE RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|67004793|gb|AAY61719.1| DNA repair protein RecO [Rickettsia felis URRWXCal2]
          Length = 237

 Score =  268 bits (687), Expect = 4e-70,   Method: Composition-based stats.
 Identities = 77/238 (32%), Positives = 127/238 (53%), Gaps = 5/238 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M  +D  +I+  +   E   I+ V T+ +G + G V+   S + + I Q GN+V   W++
Sbjct: 1   MNIKDVGVIIAKKPLKENTFIITVFTKNHGLYSGVVKE-SSKKSKFIYQEGNIVDFLWQA 59

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFL-PEREPCLELYDMLNIFLN 119
           RL +++G  + E+++S+    + +   LY   S++ L + L  ERE     +  L  +L+
Sbjct: 60  RLHEHIGMAKCELIKSYTGYFIINKAKLYAFNSVISLIKELFHEREEHSNFFSFLINYLD 119

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                +   + ++  EL LL   G+ LDLTKC VT VT DL +VSPKS  A+   VG PY
Sbjct: 120 NL-SKNFCFRDYINFELALLAETGYKLDLTKCGVTHVTTDLNYVSPKSARALSYEVGKPY 178

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLL 237
            +K+L+LP FL  ++  I  +  + A  LT+YF N+Y   +N       R+ F+  +L
Sbjct: 179 KDKLLILPKFLLSDDSEITLEEKRQASTLTNYFFNRYLFHNNR--QAEARQIFMEYIL 234


>gi|167645704|ref|YP_001683367.1| DNA repair protein RecO [Caulobacter sp. K31]
 gi|189039651|sp|B0T3I3|RECO_CAUSK RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|167348134|gb|ABZ70869.1| DNA repair protein RecO [Caulobacter sp. K31]
          Length = 243

 Score =  268 bits (686), Expect = 5e-70,   Method: Composition-based stats.
 Identities = 77/240 (32%), Positives = 126/240 (52%), Gaps = 1/240 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D+A +L  R +GE   I+E++T++ G+ +  V    S RM+P LQAG  V   +R+
Sbjct: 1   MEWEDEAFVLSARVHGETGAIVELLTQERGKFVAHVSGAASRRMKPFLQAGAKVIARYRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFL-PEREPCLELYDMLNIFLN 119
           R++  +G    E +    + L    L L GL +   +     PERE     +  L   + 
Sbjct: 61  RMSDQMGAATLEPMGEGPSSLFDEPLALSGLSAAASVAAGALPEREAHPGAFHALEALIA 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
              IP++   ++V+ E  LL+++GFGLDL+KC  TG   DL++VSP++G AV R+ G PY
Sbjct: 121 ALAIPAIWPAVYVRFEAGLLQDLGFGLDLSKCAATGSLDDLVYVSPRTGRAVSRAAGQPY 180

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLEL 239
            +K+L LP F+   +  +    +K+   +T +FL ++            R   L +L E 
Sbjct: 181 HDKLLPLPPFMLSAQGGLVEGDVKAGLDITGHFLEQFVFHPLNRPLPPARVWLLDRLGEA 240


>gi|157964679|ref|YP_001499503.1| DNA repair protein RecO [Rickettsia massiliae MTU5]
 gi|157844455|gb|ABV84956.1| DNA repair protein RecO [Rickettsia massiliae MTU5]
          Length = 274

 Score =  267 bits (683), Expect = 9e-70,   Method: Composition-based stats.
 Identities = 76/238 (31%), Positives = 126/238 (52%), Gaps = 5/238 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M  +D  +I+  +   E   I+ V T+ +G + G V+   S + +   Q GN+V   W++
Sbjct: 38  MNIKDIGVIIAKKPLKENTFIITVFTKNHGLYSGVVKE-FSRKSKFTYQEGNIVDFLWQA 96

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFL-PEREPCLELYDMLNIFLN 119
           RL ++LG  + E+++S+    +++   LY   S++ L + L  ERE   +    L  +L+
Sbjct: 97  RLHEHLGMAKCELIKSYTGYFITNKAKLYAFNSVISLIKELFHEREEHSKFCSFLINYLD 156

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                +   + ++  EL LL   G+ LDLTKC V+ VT DL++VSPKS  A+   VG PY
Sbjct: 157 NL-SKNFCFRDYINFELALLAETGYKLDLTKCGVSHVTTDLIYVSPKSARALSYEVGKPY 215

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLL 237
            +K+L+LP FL  +   I  +  + A  LT+YF N+Y   +N       R+ F+   L
Sbjct: 216 KDKLLMLPRFLLSDNIEITLEEKRQALALTNYFFNRYLFHNNRQV--EARQTFIEYTL 271


>gi|15604714|ref|NP_220921.1| DNA repair protein RecO [Rickettsia prowazekii str. Madrid E]
 gi|292572163|gb|ADE30078.1| DNA repair protein RecO [Rickettsia prowazekii Rp22]
          Length = 236

 Score =  267 bits (683), Expect = 9e-70,   Method: Composition-based stats.
 Identities = 76/237 (32%), Positives = 126/237 (53%), Gaps = 5/237 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M  +D  +I+  +   E   I+ V T+ +G + G ++   S + + I Q GN+V   W++
Sbjct: 1   MNIKDIGVIISKKPLKENTFIIRVFTKNHGLYSGVIKE-SSKKNKFIYQEGNIVDFLWKA 59

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFL-PEREPCLELYDMLNIFLN 119
           RL +++G  + E+++S+    + +   LY   S++ L + L  ERE     +  L  +L+
Sbjct: 60  RLHEHIGIAKCELIKSYTGYFIINKAKLYAFNSVISLIQELFHEREEHSIFFSFLINYLD 119

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                +   + ++  EL LL   G+ LDLTKC V+ VT DL +VSPKS  A+   VG PY
Sbjct: 120 NL-SKNFCFRDYISFELNLLAETGYKLDLTKCCVSHVTTDLTYVSPKSARALSYKVGKPY 178

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKL 236
            +K+L+LP FL  ++  I  +  K A  LT+YF N+Y   +N       RE F+  +
Sbjct: 179 RDKLLILPKFLLAKDSEITLEEKKQALTLTNYFFNRYLFHNNRQV--KAREEFIEYI 233


>gi|294084098|ref|YP_003550856.1| DNA repair protein RecO [Candidatus Puniceispirillum marinum
           IMCC1322]
 gi|292663671|gb|ADE38772.1| DNA repair protein RecO [Candidatus Puniceispirillum marinum
           IMCC1322]
          Length = 250

 Score =  264 bits (676), Expect = 6e-69,   Method: Composition-based stats.
 Identities = 85/240 (35%), Positives = 123/240 (51%), Gaps = 6/240 (2%)

Query: 2   YWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSR 61
            W  DA+I+  + +GE + ++ V+T + GRH G VR G S +M+ ILQ GN VRV+WR+R
Sbjct: 3   EWVADAVIISAKPHGEGSAVVIVLTAENGRHAGLVRGGSSSKMRGILQPGNRVRVSWRAR 62

Query: 62  LAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFR-FLPEREPCLELYDMLNIFLN- 119
           L   LG+ + E++ +  A +L  +L L G+ S   L    LPERE    LYD  N   + 
Sbjct: 63  LIDQLGQMQIELINAIPALMLDDALRLAGIASACALLDGTLPEREAQHALYDGTNALFDL 122

Query: 120 -CHKIPSV-IGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGL 177
            C   P     + +++ EL LL   G+ LDLT+C  +G  + L +VSPKSG A+      
Sbjct: 123 MCLDDPDHRWIEGYIRWELGLLNAAGYQLDLTRCAASGAREKLAYVSPKSGCAIALDQAG 182

Query: 178 PYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLL 237
            Y ++ML LP FL        A    S   LT +FL K     +     + R      +L
Sbjct: 183 EYVQRMLTLPVFLGGITNV--ASDHVSGLNLTGHFLEKRVFAAHNQDLPIQRRRLADMVL 240


>gi|51473730|ref|YP_067487.1| DNA repair protein RecO [Rickettsia typhi str. Wilmington]
 gi|81610783|sp|Q68WI7|RECO_RICTY RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|51460042|gb|AAU04005.1| possible RecO-like recombinational DNA repair protein [Rickettsia
           typhi str. Wilmington]
          Length = 236

 Score =  263 bits (674), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 75/237 (31%), Positives = 125/237 (52%), Gaps = 5/237 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M  +D  +I+  +   E   I+ V T+ +G + G ++   S + + I Q GN+V   W++
Sbjct: 1   MNIKDIGVIISKKPLKENTFIIRVFTKNHGLYSGVIK-ASSKKNKFIYQEGNIVDFLWQA 59

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFL-PEREPCLELYDMLNIFLN 119
           RL +++G  + E+++S+    + +   LY   S+  L + L  ERE     +  L  +L+
Sbjct: 60  RLHEHIGIAKCELIKSYTGYFIINKAKLYAFNSVKFLIQELFHEREEHSIFFAFLINYLD 119

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                +   + ++  EL LL   G+ +DLTKC V+ VT DL +VSPKS  A+   VG PY
Sbjct: 120 NL-SKNFCFRDYINFELNLLAETGYKIDLTKCCVSHVTTDLTYVSPKSARALSYKVGKPY 178

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKL 236
            +K+L+LP FL  E+  I  +  K A  LT+YF N+Y   +N       R+ F+  +
Sbjct: 179 RDKLLILPKFLLSEDSKITLEEKKQALTLTNYFFNRYLFHNNRQV--EARKEFIEYI 233


>gi|119385562|ref|YP_916617.1| DNA repair protein RecO [Paracoccus denitrificans PD1222]
 gi|254764650|sp|A1B5X7|RECO_PARDP RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|119376157|gb|ABL70921.1| DNA repair protein RecO [Paracoccus denitrificans PD1222]
          Length = 242

 Score =  263 bits (672), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 78/238 (32%), Positives = 117/238 (49%), Gaps = 7/238 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W  +A ++ ++ +GE  +IL V++R+ G   G V  G S +   +LQ GN V + WR+
Sbjct: 1   MEWSGEASVMALQRHGESAVILTVLSRETGLIRGLVPGGASAKRAAMLQPGNRVSLRWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLN 119
           RL + LG F  E   +    LL S   L G+ ++  L  F LPER+P   L D     L+
Sbjct: 61  RLEEQLGTFAVEPARARPG-LLGSGDALAGVNAVTALLTFALPERDPHPRLADATEALLD 119

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                    + ++  E+ LL  +GFGLDLT C VTG  + L +VSP+SG AV       +
Sbjct: 120 LMDAGEGWAEAYLHWEMRLLDELGFGLDLTSCAVTGAREGLAYVSPRSGRAVSAQAAGEW 179

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLN-KYALQHNIIHCHLLRENFLGKL 236
           A ++L LP+ L           ++ A  LT +FL  + A  H        R   + +L
Sbjct: 180 APRLLPLPAMLGGRGNGG----IEDALALTGHFLQVRLAEAHAGKPLPPARARLVARL 233


>gi|114799258|ref|YP_759606.1| DNA repair protein RecO [Hyphomonas neptunium ATCC 15444]
 gi|122942647|sp|Q0C3T7|RECO_HYPNA RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|114739432|gb|ABI77557.1| DNA repair protein RecO [Hyphomonas neptunium ATCC 15444]
          Length = 243

 Score =  259 bits (663), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 82/239 (34%), Positives = 120/239 (50%), Gaps = 3/239 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W DD I+LG R +GE  +IL+V+TR+ GR  G V  G S R +   +AGN + ++W  
Sbjct: 1   MNWSDDGIVLGGRRFGEGGLILDVLTREKGRRSGLVYGGASRRKRAQFEAGNTIALSWTG 60

Query: 61  RLAQNLGEFRF-EVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREP-CLELYDMLNIF 117
           RL   LG F   E  +   ++LL     L  L +I  L R  L E +     LY+   + 
Sbjct: 61  RLDDQLGRFDVAEARKDRASRLLDDPAALAALSAITSLLRGGLNEGDAAGSSLYEATTLL 120

Query: 118 LNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGL 177
           L+    P+V   ++V+ EL LL  +GFGLDL +C V+G    L  VSP++G AV  S   
Sbjct: 121 LDQLTEPNVWPALYVRWELGLLSALGFGLDLDECAVSGANDGLTHVSPRTGRAVRGSEAE 180

Query: 178 PYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKL 236
           PY +++  LPSFL      +    + +  +LT YF+               RE  L ++
Sbjct: 181 PYVDRLFALPSFLIDPRADVLPGDIAAGLRLTGYFIEGRLFGSVHRGLPPERERLLKRI 239


>gi|114327658|ref|YP_744815.1| DNA repair protein recO [Granulibacter bethesdensis CGDNIH1]
 gi|122327371|sp|Q0BTG0|RECO_GRABC RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|114315832|gb|ABI61892.1| DNA repair protein recO [Granulibacter bethesdensis CGDNIH1]
          Length = 250

 Score =  258 bits (660), Expect = 5e-67,   Method: Composition-based stats.
 Identities = 72/242 (29%), Positives = 116/242 (47%), Gaps = 3/242 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W    I+L  + YGE + +  V +   G + G VR G S +   I Q GNLV   W +
Sbjct: 1   MEWTAPCIVLSAQPYGEADCLAAVFSEDQGLYRGLVRGGTSRQRGGIWQPGNLVMARWTA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFR-FLPEREPCLELYDMLNIFLN 119
           RLA  LG    E++    A  +   L L  L+S+  +    LP+RE     +  L   L 
Sbjct: 61  RLADQLGSLTAELIHPAAALAMDDPLNLAVLRSLCTVAEGALPDREAHPAAFIPLPGLLT 120

Query: 120 CHKIPSV-IGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
              +    + +  ++ E +LL+ +G+GLDL +C VTG    L +VSP++G AV      P
Sbjct: 121 RLSLGGGQVVEDAIRWEAILLRELGYGLDLQRCAVTGQVSGLHYVSPRTGRAVSSDAAEP 180

Query: 179 YAEKMLVLPSFLWKEEQT-IDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLL 237
           + +++L LP+FL  + +T  D  + +   +LT YFL++             R +   ++ 
Sbjct: 181 WLDRLLPLPAFLLHQAETDSDPVAWRDGLRLTGYFLSRDVFGTRHRPLPPARMSLYDRIA 240

Query: 238 EL 239
            L
Sbjct: 241 AL 242


>gi|218670194|ref|ZP_03519865.1| DNA repair protein RecO [Rhizobium etli GR56]
          Length = 190

 Score =  255 bits (652), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 86/180 (47%), Positives = 119/180 (66%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M WQD AIILGV+ +GE ++I EVMTR  GRHLG VR+G+S  MQP+LQ GN V V WR+
Sbjct: 1   MQWQDHAIILGVKRHGETSVIAEVMTRDRGRHLGLVRSGRSRAMQPVLQPGNAVEVIWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LGEFR E +    A+L+ ++  +YG+Q++  L R LPER+P   L+D L + L+ 
Sbjct: 61  RLDEHLGEFRVEPVTLRAARLMETATAVYGVQAMGALLRLLPERDPHPHLFDALEVILDH 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P+  G++FV+ EL +L ++GFGLDL +C  TG   DL +VSPKS          P+ 
Sbjct: 121 LHNPADAGELFVRFELAVLNDLGFGLDLAECAATGDRSDLAYVSPKSRPRRQPQRRAPWR 180


>gi|94498593|ref|ZP_01305147.1| Recombinational DNA repair protein (RecF pathway)-like
           [Sphingomonas sp. SKA58]
 gi|94421957|gb|EAT07004.1| Recombinational DNA repair protein (RecF pathway)-like
           [Sphingomonas sp. SKA58]
          Length = 244

 Score =  255 bits (652), Expect = 4e-66,   Method: Composition-based stats.
 Identities = 74/238 (31%), Positives = 114/238 (47%), Gaps = 6/238 (2%)

Query: 7   AIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQNL 66
           AI+  VR++GE   I  ++T  +G   G+VR G+S  M+P+L  GN+V+ ++R+R    L
Sbjct: 8   AIVCAVRAHGEHGAIARLLTPDHGLMAGYVRGGRSRAMRPVLLPGNVVKADFRARTEDQL 67

Query: 67  GEFRFEVLESHCAKLLSSSLFLYGLQSIVPL-FRFLPEREPCLELYDMLNIFLNCHKIPS 125
                E+  S  A LL+  L    +     L    LPE  P   LY  L   L+  +   
Sbjct: 68  AGLAVELAHSR-APLLAEPLPAAAIDWSCALTAAALPEATPYPALYQALAGLLDAVEAAP 126

Query: 126 V---IGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEK 182
                    V+ EL+LL  +GFGLDL++C   G   DL +VSP+S  AV R+  L Y ++
Sbjct: 127 AARGWAVALVRYELLLLTELGFGLDLSRCAALGDVNDLAFVSPRSAAAVSRAGALGYEQR 186

Query: 183 MLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLELI 240
           +L LP FL       D   +    +LT +FL +  +          R+  + +L   +
Sbjct: 187 LLPLPPFLVG-GGAGDWADIMDGLRLTGFFLERSVMTERRTDVLAARDRLVERLKRAV 243


>gi|148557387|ref|YP_001264969.1| DNA repair protein RecO [Sphingomonas wittichii RW1]
 gi|254790737|sp|A5VEW5|RECO_SPHWW RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|148502577|gb|ABQ70831.1| DNA repair protein RecO [Sphingomonas wittichii RW1]
          Length = 243

 Score =  255 bits (651), Expect = 5e-66,   Method: Composition-based stats.
 Identities = 80/243 (32%), Positives = 122/243 (50%), Gaps = 5/243 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M  +  AII  +R++GE   I+  +T  +G   G+VR G+S R++P+L AGNLV   +R+
Sbjct: 1   MQVRTPAIICAMRAHGEHGAIVRALTPDHGLLAGYVRGGRSRRLRPVLVAGNLVEAEFRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLN 119
           R A+ L     E+  S    L +  L    +  +  L    L E +P   LY+ L+  L 
Sbjct: 61  RTAEQLPGLTVELSHSRAGLL-AEPLAAAAIDWLSSLTAASLAEGQPHARLYEALDAVLA 119

Query: 120 CHK---IPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVG 176
             +            V+ ELML+ ++G+ LDL+ C  TG   DL +VSPKSGGAV R+ G
Sbjct: 120 AIEYAPSARGWAAAAVRYELMLMADLGYALDLSACAATGARDDLAYVSPKSGGAVSRAAG 179

Query: 177 LPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKL 236
            PYA ++L LP+FL       D   +    +LT +FL +  L          R+  + ++
Sbjct: 180 EPYAARLLPLPAFLVDPSADSDWSDIVDGMRLTGHFLARDILVDRRADALDARQRLVDRI 239

Query: 237 LEL 239
             L
Sbjct: 240 GRL 242


>gi|162148788|ref|YP_001603249.1| DNA repair protein recO [Gluconacetobacter diazotrophicus PAl 5]
 gi|189039658|sp|A9HRQ4|RECO_GLUDA RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|161787365|emb|CAP56960.1| putative DNA repair protein recO [Gluconacetobacter diazotrophicus
           PAl 5]
          Length = 254

 Score =  254 bits (650), Expect = 6e-66,   Method: Composition-based stats.
 Identities = 71/240 (29%), Positives = 114/240 (47%), Gaps = 6/240 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+  A++L    YGE + I+ ++T   G   G  R G +   + + Q GNL+R +WR 
Sbjct: 1   MEWEAPALVLSASPYGESSAIVHLLTEDLGLVHGLARGGTARANRALWQPGNLIRASWRG 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFR-FLPEREPCLELYDMLNIFLN 119
           RL   LG    E++    A+L+S+ L L  L S   +    LPEREP   ++ +L  F +
Sbjct: 61  RLPDQLGNLSGELVHGSAARLMSAPLALAMLASACAVADGTLPEREPHPRIFHLLTRFFS 120

Query: 120 CHK-IPSVIG----KIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRS 174
                P + G       ++ E  LL ++G+G+DL+ C VTG + +L WVSP++G AV  +
Sbjct: 121 LLSLDPDMAGWGGMAALLRWEACLLGDLGYGMDLSACAVTGGSAELAWVSPRTGRAVSDA 180

Query: 175 VGLPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLG 234
               +  ++L LP     E         +   +LT +FL + A           R   + 
Sbjct: 181 AAGEWRPRLLRLPPLFLDESDPGTVQDWRDGLRLTGHFLARDAFGQRHRPLPPARLRLVD 240


>gi|209545462|ref|YP_002277691.1| DNA repair protein RecO [Gluconacetobacter diazotrophicus PAl 5]
 gi|209533139|gb|ACI53076.1| DNA repair protein RecO [Gluconacetobacter diazotrophicus PAl 5]
          Length = 254

 Score =  253 bits (648), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 71/240 (29%), Positives = 114/240 (47%), Gaps = 6/240 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+  A++L    YGE + I+ ++T   G   G  R G +   + + Q GNL+R +WR 
Sbjct: 1   MEWEAPALVLSASPYGESSAIVHLLTEDLGLVHGLARGGTARANRALWQPGNLIRASWRG 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFR-FLPEREPCLELYDMLNIFLN 119
           RL   LG    E++    A+L+S+ L L  L S   +    LPEREP   ++ +L  F +
Sbjct: 61  RLPDQLGNLSGELVHGSAARLMSAPLALAMLASACAVADGTLPEREPHPRIFHLLTRFFS 120

Query: 120 CHK-IPSVIG----KIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRS 174
                P + G       ++ E  LL ++G+G+DL+ C VTG + +L WVSP++G AV  +
Sbjct: 121 LLSLDPDMAGWGGMAALLRWEACLLGDLGYGMDLSACAVTGGSAELAWVSPRTGRAVSDA 180

Query: 175 VGLPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLG 234
               +  ++L LP     E         +   +LT +FL + A           R   + 
Sbjct: 181 AAGEWRPRLLRLPPLFLNESDPGTVQDWRDGLRLTGHFLARDAFGQRHRPLPPARLRLVD 240


>gi|258543012|ref|YP_003188445.1| DNA repair protein RecO [Acetobacter pasteurianus IFO 3283-01]
 gi|256634090|dbj|BAI00066.1| DNA repair protein RecO [Acetobacter pasteurianus IFO 3283-01]
 gi|256637150|dbj|BAI03119.1| DNA repair protein RecO [Acetobacter pasteurianus IFO 3283-03]
 gi|256640202|dbj|BAI06164.1| DNA repair protein RecO [Acetobacter pasteurianus IFO 3283-07]
 gi|256643259|dbj|BAI09214.1| DNA repair protein RecO [Acetobacter pasteurianus IFO 3283-22]
 gi|256646314|dbj|BAI12262.1| DNA repair protein RecO [Acetobacter pasteurianus IFO 3283-26]
 gi|256649367|dbj|BAI15308.1| DNA repair protein RecO [Acetobacter pasteurianus IFO 3283-32]
 gi|256652353|dbj|BAI18287.1| DNA repair protein RecO [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256655411|dbj|BAI21338.1| DNA repair protein RecO [Acetobacter pasteurianus IFO 3283-12]
          Length = 263

 Score =  252 bits (644), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 75/239 (31%), Positives = 117/239 (48%), Gaps = 6/239 (2%)

Query: 4   QDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLA 63
           +  A++L     GE +  + V+T  YG   G    G S   + + Q GN+V+ +   R A
Sbjct: 12  EAPALVLFAGVQGETSARVHVLTEDYGPLRGIAYGGASKAGRALWQPGNVVKTSLHKRSA 71

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLNCHK 122
               +   E+L +  A+LL + L L  +QS+  L    LPE +PC  L+      L    
Sbjct: 72  AAPLQISAELLYACAARLLDAPLALSMVQSVCVLADVTLPEADPCPFLFAETVRLLTFLG 131

Query: 123 IPSVIGK-----IFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGL 177
              VI +       V+ E+ LL  +GFGLDL+ C VTG T++L +VSP++G AV      
Sbjct: 132 YDPVIAEREGMPHVVRWEMALLATLGFGLDLSACAVTGSTENLHYVSPRTGRAVSEEGAG 191

Query: 178 PYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKL 236
            + +++L LPSFL   EQT +A    +  +LT +FL + A     +     R+    +L
Sbjct: 192 EWKDRLLPLPSFLQDTEQTGNAADWLAGLRLTGHFLARDAFGQRHLPLPAARQRLYDRL 250


>gi|294012225|ref|YP_003545685.1| DNA repair protein RecO [Sphingobium japonicum UT26S]
 gi|292675555|dbj|BAI97073.1| DNA repair protein RecO [Sphingobium japonicum UT26S]
          Length = 244

 Score =  251 bits (641), Expect = 7e-65,   Method: Composition-based stats.
 Identities = 72/239 (30%), Positives = 117/239 (48%), Gaps = 6/239 (2%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQN 65
            A++  +R +GE   I  ++T  +G   G+VR G+S R++P+L  GN V+  +R+R  + 
Sbjct: 7   PALVCALRPHGEHGAIARLLTPGHGLLAGYVRGGRSRRLRPVLLPGNAVKAEFRARTEEQ 66

Query: 66  LGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLNCHKIP 124
           L     E+  S  A LL+  L    +     L    LPE  P   L+  L+  L   +  
Sbjct: 67  LAGLTVELEHSR-APLLAEPLPAAAIDWACALTAVALPEATPYPALHQALDGVLGAVEAA 125

Query: 125 SV---IGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAE 181
                     ++ EL+LL  +GFGLDL +C  TG   DL +VSP+S  AV R+  + Y +
Sbjct: 126 PAARGWATALIRYELLLLAELGFGLDLGRCAATGGNDDLAYVSPRSAAAVSRAGAVGYED 185

Query: 182 KMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLELI 240
           ++L LP+FL  E    +  ++    +LT +FL +  L    +     RE  + +L   +
Sbjct: 186 RLLPLPAFLL-EGGAGEWPAILDGLRLTGFFLERSVLTDWRVDVLAARERLVDRLKRAV 243


>gi|329115619|ref|ZP_08244341.1| DNA repair protein RecO [Acetobacter pomorum DM001]
 gi|326695047|gb|EGE46766.1| DNA repair protein RecO [Acetobacter pomorum DM001]
          Length = 263

 Score =  251 bits (641), Expect = 7e-65,   Method: Composition-based stats.
 Identities = 74/239 (30%), Positives = 117/239 (48%), Gaps = 6/239 (2%)

Query: 4   QDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLA 63
           +  A++L     GE +  + V+T  YG   G    G S   + + Q GN+V+ ++  R A
Sbjct: 12  EAPALVLFAGVQGETSARIHVLTEDYGPLRGIAYGGASKAGRALWQPGNVVKTSFHKRSA 71

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLNCHK 122
               +   E+L +  A+LL + L L  +QS+  L    LPE +PC  L+      L    
Sbjct: 72  AAPLQISGELLYACAARLLDAPLALGMVQSVCVLADVTLPEADPCPFLFAETVRLLTFLG 131

Query: 123 IPSVIGK-----IFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGL 177
              V+ +       V+ E+ LL  +GFGLDL+ C VTG T++L +VSP++G AV      
Sbjct: 132 YDPVVAEREGMPHVVRWEMALLVTLGFGLDLSACAVTGSTENLHYVSPRTGRAVSEEGAG 191

Query: 178 PYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKL 236
            + +++L LPSFL   EQT  A    +  +LT +FL + A     +     R+    +L
Sbjct: 192 EWKDRLLPLPSFLRDTEQTGHAADWLAGLRLTGHFLARDAFGQRHLPLPAARQRLYDRL 250


>gi|310815097|ref|YP_003963061.1| DNA repair protein RecO [Ketogulonicigenium vulgare Y25]
 gi|308753832|gb|ADO41761.1| DNA repair protein RecO [Ketogulonicigenium vulgare Y25]
          Length = 241

 Score =  250 bits (639), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 78/216 (36%), Positives = 113/216 (52%), Gaps = 5/216 (2%)

Query: 2   YWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSR 61
            WQD+ I+L    +GE  +I +V T++ G+  G VR G   RMQP+L  GN + + WR+R
Sbjct: 3   DWQDEGILLTTHRHGEAGVIAQVFTQERGKISGLVRGGAGSRMQPVLIPGNQLSLRWRAR 62

Query: 62  LAQNLGEFRFEVLESHCAKLLSSSLF-LYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           L  +LG  + E++ S    L+   L    G      L   +PER P    Y      L+ 
Sbjct: 63  LDDHLGSLQPELIRSRAGFLMQDRLSLAAGAAVTALLAATMPERVPHTAFYAQSTALLDL 122

Query: 121 ---HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGL 177
                  S+    ++Q E++LL+  GFGLDLT C VTG   DL +VSPKSG AV +S   
Sbjct: 123 VGVEDWQSLWPLAYLQWEMVLLREGGFGLDLTTCAVTGAADDLCYVSPKSGRAVSKSGAG 182

Query: 178 PYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFL 213
            +AE++L LP+ +  E    D   +  A   T++FL
Sbjct: 183 AWAERLLPLPAVMRGEGDA-DTSDILQALATTEWFL 217


>gi|304321235|ref|YP_003854878.1| DNA repair protein RecO [Parvularcula bermudensis HTCC2503]
 gi|303300137|gb|ADM09736.1| DNA repair protein RecO [Parvularcula bermudensis HTCC2503]
          Length = 243

 Score =  250 bits (639), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 82/242 (33%), Positives = 120/242 (49%), Gaps = 6/242 (2%)

Query: 2   YWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSR 61
            W D   ++     GE ++++ + TR  G   G V  GQ  R  P+LQ GNLV  +W SR
Sbjct: 3   EWTDRGFVIKTIPRGENHLVVTLFTRCRGAVTGLVHGGQGTRKAPLLQRGNLVSADWSSR 62

Query: 62  LAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLF-RFLPEREPCLELYDMLNIFLNC 120
            A   G +R E+ E+  A+ L S L L  LQS+  L    LPE      L+D   +F + 
Sbjct: 63  QADGYGTYRLELAEAIAARALDSRLSLLALQSVTDLLCEILPEGVAYEGLFDATEVFFSA 122

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVT----QDLLWVSPKSGGAVCRSVG 176
               +++  + V+ EL LL  +G+GL L +C  TG T     DL++VSPKSGGAV    G
Sbjct: 123 LGEKAIMATLLVKWELGLLAALGYGLSLERCAATGRTLEDGADLVFVSPKSGGAVTAEAG 182

Query: 177 LPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKL 236
            PYA+++L LP FL    +      + +  +LT  FL++  L          R   + +L
Sbjct: 183 APYADRLLPLPPFLIDRGE-PTWPDIAAGLRLTGTFLDERLLAPVGKSLPEARGQLIRRL 241

Query: 237 LE 238
             
Sbjct: 242 TR 243


>gi|68171672|ref|ZP_00545033.1| recO-related protein [Ehrlichia chaffeensis str. Sapulpa]
 gi|88658325|ref|YP_507349.1| DNA repair protein RecO [Ehrlichia chaffeensis str. Arkansas]
 gi|123493398|sp|Q2GGT4|RECO_EHRCR RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|67998907|gb|EAM85598.1| recO-related protein [Ehrlichia chaffeensis str. Sapulpa]
 gi|88599782|gb|ABD45251.1| putative DNA repair protein RecO [Ehrlichia chaffeensis str.
           Arkansas]
          Length = 244

 Score =  250 bits (638), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 81/245 (33%), Positives = 134/245 (54%), Gaps = 9/245 (3%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M WQD  I++ +R YG+  II+ + T+++G   G  +  +    +  LQ G+ V V W S
Sbjct: 1   MRWQDQGIVIAIRKYGDDQIIISIFTQKHGLKKGLAKYSKKATHR--LQIGDYVNVTWSS 58

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQ-SIVPLFRFLPEREPCLELYDMLNIFLN 119
           RL  NLG F++E+++S     +  +L    +  S V L + LPE E    +Y+ L+IF+N
Sbjct: 59  RLISNLGCFKYELIKSTLYHYIQDNLKTMCIAFSTVILDQVLPENEENYIIYNCLDIFIN 118

Query: 120 CHKIPSVIGKI-FVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
             +   +  KI ++++EL LL  +GFGLDL++C V    ++L ++SPK+G AV ++VGLP
Sbjct: 119 SIQFQDINWKIKYLRLELTLLSELGFGLDLSRCAVNNTNENLTFISPKTGKAVSKTVGLP 178

Query: 179 YAEKMLVLPSFLWKEEQTIDA----DSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLG 234
           Y++ +L LP  L+      +        K +  +  YF  K+ L          RE  + 
Sbjct: 179 YSKSLLPLPQLLYDVYNNYEYKYSKTDFKLSLNVLGYFFKKHFLTEKNTILIKYREEII- 237

Query: 235 KLLEL 239
           KL++L
Sbjct: 238 KLIDL 242


>gi|91205107|ref|YP_537462.1| DNA repair protein RecO [Rickettsia bellii RML369-C]
 gi|157827560|ref|YP_001496624.1| DNA repair protein RecO [Rickettsia bellii OSU 85-389]
 gi|122425954|sp|Q1RJU1|RECO_RICBR RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|254790733|sp|A8GXI7|RECO_RICB8 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|91068651|gb|ABE04373.1| DNA repair protein RecO [Rickettsia bellii RML369-C]
 gi|157802864|gb|ABV79587.1| DNA repair protein RecO [Rickettsia bellii OSU 85-389]
          Length = 241

 Score =  249 bits (637), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 75/239 (31%), Positives = 123/239 (51%), Gaps = 5/239 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M  +D  +I+  +   E   I+ V T+ +G + G  +   S + + I Q GN+V   W++
Sbjct: 1   MNIKDIGVIIAKKPLKENTFIITVFTKNHGLYSGVAKE-SSKKSKFIYQEGNVVDFLWQA 59

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFL-PEREPCLELYDMLNIFLN 119
           RL +++G  + E+++S+    + +   LY   S++ L + L  ERE     + +L  +L+
Sbjct: 60  RLHEHIGIAKCELVKSYIGHFIINKAKLYAFNSVISLIKELFHEREEHYNFFSLLINYLD 119

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                +     ++  EL LL  +G+ LD TKC V+  TQDL ++SPKSG AV   VG PY
Sbjct: 120 NL-AKNFCFHDYINFELALLAEMGYELDFTKCGVSNTTQDLAYLSPKSGRAVSYEVGAPY 178

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLE 238
            +K+L LP FL      I  +  + A  LT YF N+Y           +R+ F+  +LE
Sbjct: 179 KDKLLPLPKFLLSGNDKITLEEKRQALNLTSYFFNRYLFH--NHRQPEIRQVFVEYILE 235


>gi|83593184|ref|YP_426936.1| DNA repair protein RecO [Rhodospirillum rubrum ATCC 11170]
 gi|119361481|sp|Q2RT96|RECO_RHORT RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|83576098|gb|ABC22649.1| Recombination protein O, RecO [Rhodospirillum rubrum ATCC 11170]
          Length = 252

 Score =  242 bits (618), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 83/244 (34%), Positives = 124/244 (50%), Gaps = 7/244 (2%)

Query: 2   YWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSR 61
            W D  I+L  R +GE  +I+ +++  +GRH G VR G+  R++  LQ G+LV+  W++R
Sbjct: 3   EWSDRGIVLAARPHGEDGVIVSLLSAGHGRHSGIVRGGRGKRLRAALQPGSLVQATWKAR 62

Query: 62  LAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFR-FLPEREPCLELYDMLNIFL-- 118
           L  +LG    E+L      LL     L  L +   L    LPER P  ++YD     L  
Sbjct: 63  LEDHLGSLVVELLAGVAGGLLDDRDRLAALAAACALAETVLPERAPQADVYDATLALLDA 122

Query: 119 ---NCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSV 175
                   P V    FV+ E+ LL  +GFGLDL+ C V+G   DL +VSP+SG AV R  
Sbjct: 123 LAEGGEGTPLVWAGAFVRWEIGLLAALGFGLDLSCCAVSGECGDLAYVSPRSGRAVGREA 182

Query: 176 GLPYAEKMLVLPSFLWKEEQ-TIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLG 234
           G P+  ++L LP+FL    +   +A ++    +L+ YFL  + L          R+ F+ 
Sbjct: 183 GAPWQARLLALPAFLLSPAEVPANAQAVGDGLRLSGYFLEGHVLAPQGRGLPASRQRFVE 242

Query: 235 KLLE 238
           +L  
Sbjct: 243 RLRR 246


>gi|58697108|ref|ZP_00372549.1| DNA repair protein RecO [Wolbachia endosymbiont of Drosophila
           simulans]
 gi|58698226|ref|ZP_00373146.1| DNA repair protein RecO [Wolbachia endosymbiont of Drosophila
           ananassae]
 gi|225630040|ref|YP_002726831.1| DNA repair protein RecO [Wolbachia sp. wRi]
 gi|254790743|sp|C0R5J8|RECO_WOLWR RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|58535253|gb|EAL59332.1| DNA repair protein RecO [Wolbachia endosymbiont of Drosophila
           ananassae]
 gi|58536603|gb|EAL59934.1| DNA repair protein RecO [Wolbachia endosymbiont of Drosophila
           simulans]
 gi|225592021|gb|ACN95040.1| DNA repair protein RecO [Wolbachia sp. wRi]
          Length = 240

 Score =  241 bits (615), Expect = 8e-62,   Method: Composition-based stats.
 Identities = 79/243 (32%), Positives = 126/243 (51%), Gaps = 13/243 (5%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVR--NGQSHRMQPILQAGNLVRVNW 58
           M W+D+ II+  + YG+KN+IL + T+ +G+  G  +  N  +++     Q  NL+   W
Sbjct: 1   MRWKDEGIIIAAKKYGDKNLILSLFTKNHGKRRGLTKLTNNSNYK----FQISNLLHAEW 56

Query: 59  RSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLF-RFLPEREPCLELYDMLNIF 117
            ++L +NLG F+ E++ES         L    + S   +  + LPE EPC  LYD    F
Sbjct: 57  SAKLPENLGFFKCELIESSFHHFFQDRLKSITIVSFSSILEKVLPESEPCAVLYDNFRYF 116

Query: 118 LNCHKIPSV-IGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVG 176
           ++  K  +      ++ +EL+LL  +GF LDL+KC VTGV ++L ++SPK+G AV +  G
Sbjct: 117 IDVIKHNNQSWQSHYLNLELLLLTQLGFKLDLSKCAVTGVKENLQFISPKTGRAVSKKAG 176

Query: 177 LPYAEKMLVLPSFLWKE-----EQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLREN 231
             YA+K+L  P  L        + +      +   ++T YFLNKY      +    LR  
Sbjct: 177 DYYADKLLPFPQMLHDVYNNNLQNSYSFQEFQLGLKVTGYFLNKYLFLQLNVKFPELRNL 236

Query: 232 FLG 234
            L 
Sbjct: 237 MLS 239


>gi|148284965|ref|YP_001249055.1| DNA repair protein RecO [Orientia tsutsugamushi str. Boryong]
 gi|254764648|sp|A5CF17|RECO_ORITB RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|146740404|emb|CAM80867.1| DNA repair protein [Orientia tsutsugamushi str. Boryong]
          Length = 241

 Score =  240 bits (614), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 82/239 (34%), Positives = 131/239 (54%), Gaps = 4/239 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M ++D AIIL  R+  E   I+ V+T+ YG + G +++  S +   I Q GN+V   W +
Sbjct: 1   MNFRDKAIILKKRNIKENLAIVTVLTQSYGIYSGIIKDLHSKKNTIIYQIGNIVDFCWSA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPL-FRFLPEREPCLELYDMLNIFLN 119
           RL ++LG    E+++S+   ++S+   L+   S++ L      ERE    L++     L 
Sbjct: 61  RLDKHLGTINCELVKSYSYLIMSNKRNLFYTHSLIELTLMSFKERELHANLFEKWLGNLE 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
              + ++  K ++  EL++LK  G+ L L +C VT  TQ+L++VSPKSG A+  +VG PY
Sbjct: 121 SINVGNINIKNYINFELLILKEAGYQLTLDRCGVTNCTQNLIYVSPKSGQAISAAVGEPY 180

Query: 180 AEKMLVLPSFLWKEE-QTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLL 237
             K+L+LP FL     +  D   +++AF LT YF NKY L        + RE  L  +L
Sbjct: 181 KHKLLLLPKFLVHNNCEPEDIYEIQAAFNLTAYFFNKYVLIKK--KLPIARELLLKSIL 237


>gi|99035892|ref|ZP_01314943.1| hypothetical protein Wendoof_01000221 [Wolbachia endosymbiont of
           Drosophila willistoni TSC#14030-0811.24]
          Length = 240

 Score =  240 bits (613), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 80/243 (32%), Positives = 127/243 (52%), Gaps = 13/243 (5%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVR--NGQSHRMQPILQAGNLVRVNW 58
           M W+D+ II+  + YG+KN+IL + T+ +G+  G  +  N  +++     Q  NL+   W
Sbjct: 1   MRWKDEGIIIAAKKYGDKNLILSLFTKNHGKRRGLTKLTNNSNYK----FQISNLLHAEW 56

Query: 59  RSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLF-RFLPEREPCLELYDMLNIF 117
            ++L +NLG F+ E++ES         L    + S   +  + LPE EPC  LYD    F
Sbjct: 57  SAKLPENLGFFKCELIESPFHHFFQDRLKSITIVSFSSILEKVLPESEPCAMLYDNFRYF 116

Query: 118 LNCHKIPSV-IGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVG 176
           ++  K  +      ++ +EL+LL  +GF LDL+KC VTGV ++L ++SPK+G AV + VG
Sbjct: 117 IDVIKHNNQSWQSHYLNLELLLLTQLGFKLDLSKCAVTGVKENLQFISPKTGRAVSKKVG 176

Query: 177 LPYAEKMLVLPSFLWKE-----EQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLREN 231
             YA+K+L  P  L        + +      +   ++T YFLNKY      +    LR  
Sbjct: 177 DYYADKLLPFPQMLHDVYNNNLQNSYSFQEFQLGLKVTGYFLNKYLFLQLNVKFPELRNL 236

Query: 232 FLG 234
            L 
Sbjct: 237 MLS 239


>gi|58418862|gb|AAW70877.1| Recombinational DNA repair protein RecO [Wolbachia endosymbiont
           strain TRS of Brugia malayi]
          Length = 245

 Score =  239 bits (611), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 81/243 (33%), Positives = 126/243 (51%), Gaps = 13/243 (5%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVR--NGQSHRMQPILQAGNLVRVNW 58
           M W+D+ II+  + YG+K++IL +  + +G+  G  R  N  S++     Q  NL+   W
Sbjct: 6   MRWKDEGIIIAAKKYGDKSLILSLFMKNHGKCRGLTRLTNDSSYK----FQVSNLLHAEW 61

Query: 59  RSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLF-RFLPEREPCLELYDMLNIF 117
            ++L +NLG F+ E++ES        SL    + S   +  + LPE EPC  LYD    F
Sbjct: 62  SAKLPENLGFFKCELIESPFHHFFQDSLKSITIVSFSSILEKVLPESEPCAVLYDNFQYF 121

Query: 118 LNCHKIPSV-IGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVG 176
           ++  K  S      ++ +EL+LL  +GF LDL+KC VTGV ++L ++SPK+G AV + VG
Sbjct: 122 IDVIKHGSEPWQGHYLNLELLLLAQLGFKLDLSKCAVTGVKENLQFISPKTGRAVSKKVG 181

Query: 177 LPYAEKMLVLPSFLWKE-----EQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLREN 231
             YA+K+L  P  L        + +      +   ++T YFLNKY      +     R  
Sbjct: 182 DYYADKLLPFPQMLHDVYNNNLQNSYSYQEFQLGLKVTGYFLNKYLFSQLNMRFPESRNL 241

Query: 232 FLG 234
            L 
Sbjct: 242 ILS 244


>gi|161899045|ref|YP_198119.2| DNA repair protein RecO [Wolbachia endosymbiont strain TRS of
           Brugia malayi]
          Length = 240

 Score =  239 bits (611), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 81/243 (33%), Positives = 126/243 (51%), Gaps = 13/243 (5%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVR--NGQSHRMQPILQAGNLVRVNW 58
           M W+D+ II+  + YG+K++IL +  + +G+  G  R  N  S++     Q  NL+   W
Sbjct: 1   MRWKDEGIIIAAKKYGDKSLILSLFMKNHGKCRGLTRLTNDSSYK----FQVSNLLHAEW 56

Query: 59  RSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLF-RFLPEREPCLELYDMLNIF 117
            ++L +NLG F+ E++ES        SL    + S   +  + LPE EPC  LYD    F
Sbjct: 57  SAKLPENLGFFKCELIESPFHHFFQDSLKSITIVSFSSILEKVLPESEPCAVLYDNFQYF 116

Query: 118 LNCHKIPSV-IGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVG 176
           ++  K  S      ++ +EL+LL  +GF LDL+KC VTGV ++L ++SPK+G AV + VG
Sbjct: 117 IDVIKHGSEPWQGHYLNLELLLLAQLGFKLDLSKCAVTGVKENLQFISPKTGRAVSKKVG 176

Query: 177 LPYAEKMLVLPSFLWKE-----EQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLREN 231
             YA+K+L  P  L        + +      +   ++T YFLNKY      +     R  
Sbjct: 177 DYYADKLLPFPQMLHDVYNNNLQNSYSYQEFQLGLKVTGYFLNKYLFSQLNMRFPESRNL 236

Query: 232 FLG 234
            L 
Sbjct: 237 ILS 239


>gi|296535950|ref|ZP_06898099.1| recombination protein O [Roseomonas cervicalis ATCC 49957]
 gi|296263723|gb|EFH10199.1| recombination protein O [Roseomonas cervicalis ATCC 49957]
          Length = 250

 Score =  239 bits (611), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 81/238 (34%), Positives = 117/238 (49%), Gaps = 2/238 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M WQ  AI+L  R +GE   ++ V+T  +GRH G V  G S     + Q GNLV V WR 
Sbjct: 1   MEWQAPAIVLEARPHGEGAAVVSVLTEDHGRHAGLVHGGASRAQSGLWQPGNLVEVRWRG 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFR-FLPEREPCLELYDMLNIFLN 119
           RLA+ LG    E++    A  L   L L  LQS   L    LPERE    ++  L   + 
Sbjct: 61  RLAEQLGSLSGEMVHPTAALALDEPLTLALLQSACALATDALPEREAQPRIFSGLLALMA 120

Query: 120 CHKIPS-VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
                +  +   +++ E +LL+ +G+GLDL+ C VTG  ++L  VSP+SG AV      P
Sbjct: 121 QLGRGAPALLADYIRWEALLLEGLGYGLDLSVCAVTGAAENLTHVSPRSGRAVSAEAAAP 180

Query: 179 YAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKL 236
           Y +++L LP FL   +   D        +LT +FL + A           RE  + ++
Sbjct: 181 YRDRLLPLPLFLLGGQDERDPAEWLKGLRLTGHFLERDAFGARHRAVPPARERLVSRI 238


>gi|189184083|ref|YP_001937868.1| DNA repair protein RecO [Orientia tsutsugamushi str. Ikeda]
 gi|254764649|sp|B3CTD7|RECO_ORITI RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|189180854|dbj|BAG40634.1| DNA repair protein RecO [Orientia tsutsugamushi str. Ikeda]
          Length = 241

 Score =  239 bits (611), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 83/240 (34%), Positives = 131/240 (54%), Gaps = 4/240 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M ++D AIIL  R+  E   I+ V+T+ YG + G +++  S +   I Q GN+V   W +
Sbjct: 1   MNFRDKAIILKKRNIKENLAIVTVLTQSYGIYSGIIKDLHSKKNTIIYQIGNIVDFCWSA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPL-FRFLPEREPCLELYDMLNIFLN 119
           RL ++LG    E+++S+   ++S+   L    S++ L      ERE    L++     L 
Sbjct: 61  RLDEHLGTINCELVKSYSYLIMSNKRNLLYTHSLIELTLMSFKERELHANLFEKWLENLE 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                ++  K ++  EL++LK  G+ L+L +C VT  TQ+L++VSPKSG A+  +VG PY
Sbjct: 121 SINTGNINVKNYINFELLILKEAGYRLNLDRCGVTNCTQNLIYVSPKSGQAISATVGEPY 180

Query: 180 AEKMLVLPSFLWKEE-QTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLE 238
             K+L+LP FL     +  D   +++AF LT YF NKY L        + RE  L  +LE
Sbjct: 181 KHKLLLLPKFLVHNNCEPEDIYEIQAAFNLTAYFFNKYILIKK--KLPITRELLLKSILE 238


>gi|225631179|ref|ZP_03787882.1| DNA repair protein RecO [Wolbachia endosymbiont of Muscidifurax
           uniraptor]
 gi|225591127|gb|EEH12306.1| DNA repair protein RecO [Wolbachia endosymbiont of Muscidifurax
           uniraptor]
          Length = 240

 Score =  238 bits (609), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 80/243 (32%), Positives = 126/243 (51%), Gaps = 13/243 (5%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVR--NGQSHRMQPILQAGNLVRVNW 58
           M W+D+ II+  + YG+KN+IL + T+ +G+  G  +  N  +++     Q  NL+   W
Sbjct: 1   MRWKDEGIIIAAKKYGDKNLILSLFTKNHGKRRGLTKLTNNSNYK----FQISNLLHAEW 56

Query: 59  RSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLF-RFLPEREPCLELYDMLNIF 117
            ++L +NLG F  E++ES         L    + S   +  + LPE EPC  LYD    F
Sbjct: 57  SAKLPENLGFFECELIESPFHHFFQDRLKSITIVSFSSILEKVLPESEPCAMLYDNFRYF 116

Query: 118 LNCHKIPSV-IGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVG 176
           ++  K  +      ++ +EL+LL  +GF LDL+KC VTGV ++L ++SPK+G AV + VG
Sbjct: 117 IDVIKHNNQSWQSHYLNLELLLLTQLGFKLDLSKCAVTGVKENLQFISPKTGRAVSKKVG 176

Query: 177 LPYAEKMLVLPSFLWKE-----EQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLREN 231
             YA+K+L  P  L        + +      +   ++T YFLNKY      +    LR  
Sbjct: 177 DYYADKLLPFPQMLHDVYNNTLQNSYSFQEFQLGLKVTGYFLNKYLFLQLNVKFPELRNL 236

Query: 232 FLG 234
            L 
Sbjct: 237 MLS 239


>gi|307294438|ref|ZP_07574282.1| DNA repair protein RecO [Sphingobium chlorophenolicum L-1]
 gi|306880589|gb|EFN11806.1| DNA repair protein RecO [Sphingobium chlorophenolicum L-1]
          Length = 244

 Score =  238 bits (609), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 73/239 (30%), Positives = 117/239 (48%), Gaps = 6/239 (2%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQN 65
            A++  +R +GE   I  ++T  +G   G+VR G+S RM+P+L   N V+  +R+R  + 
Sbjct: 7   PALVCALRPHGEHGAIARLLTPDHGLLAGYVRGGRSRRMRPVLLPANAVKAEFRARTEEQ 66

Query: 66  LGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLNCHK-- 122
           L     E+  S  A LL+  L    +     L    LPE  P   LY  L+  L   +  
Sbjct: 67  LAGLTVELDHSR-APLLAEPLPAAAIDWACALTAVALPEGTPYPALYQALDGVLGAVEAA 125

Query: 123 -IPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAE 181
                     ++ EL++L  +GFGLDLT+C  TG   DL ++SP+S  AV R+    Y +
Sbjct: 126 PAARGWAAALIRYELLMLAELGFGLDLTRCAATGGRDDLAYISPRSAAAVSRAGAAGYED 185

Query: 182 KMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLELI 240
           ++L LP+FL  E    D  ++    +LT +FL +  L    +     RE  + +L  ++
Sbjct: 186 RLLPLPAFLL-EGGAGDWPAILDGLRLTGFFLERSVLTDWRVDVLAARERLVDRLKRVV 243


>gi|42520114|ref|NP_966029.1| DNA repair protein RecO [Wolbachia endosymbiont of Drosophila
           melanogaster]
 gi|81652824|sp|Q73IE9|RECO_WOLPM RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|42409851|gb|AAS13963.1| recO-related protein [Wolbachia endosymbiont of Drosophila
           melanogaster]
          Length = 240

 Score =  238 bits (609), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 80/243 (32%), Positives = 127/243 (52%), Gaps = 13/243 (5%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVR--NGQSHRMQPILQAGNLVRVNW 58
           M W+D+ II+  + YG+KN+IL + T+ +G+  G  +  N  +++     Q  NL+   W
Sbjct: 1   MRWKDEGIIIAAKKYGDKNLILSLFTKNHGKRRGLTKLTNNSNYK----FQISNLLHAEW 56

Query: 59  RSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLF-RFLPEREPCLELYDMLNIF 117
            ++L +NLG  + E++ES         L    + S   +  + LPE EPC  LYD L  F
Sbjct: 57  SAKLPENLGFLKCELIESPFHHFFQDRLKSITIVSFSSILEKVLPESEPCAMLYDNLRYF 116

Query: 118 LNCHKIPSV-IGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVG 176
           ++  K  +      ++ +EL+LL  +GF LDL+KC VTGV ++L ++SPK+G AV + VG
Sbjct: 117 IDVIKHNNQSWQSHYLNLELLLLTQLGFKLDLSKCAVTGVKENLQFISPKTGRAVSKKVG 176

Query: 177 LPYAEKMLVLPSFLWKE-----EQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLREN 231
             YA+K+L  P  L        + +      +   ++T YFLNKY      +    LR  
Sbjct: 177 DYYADKLLPFPQMLHDVYNNNLQNSYSFQEFQLGLKVTGYFLNKYLFLQLNVKFPELRNL 236

Query: 232 FLG 234
            L 
Sbjct: 237 MLS 239


>gi|218660067|ref|ZP_03515997.1| DNA repair protein RecO [Rhizobium etli IE4771]
          Length = 174

 Score =  237 bits (606), Expect = 8e-61,   Method: Composition-based stats.
 Identities = 77/156 (49%), Positives = 110/156 (70%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M WQD AIILGV+ +GE ++I+EVMTR  GRHLG VR+G+S  MQP+LQ GN V V WR+
Sbjct: 19  MQWQDHAIILGVKRHGETSVIVEVMTRDRGRHLGLVRSGRSRAMQPVLQPGNAVEVIWRA 78

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LGEFR E +    A+++ ++  +YG+Q++  L R LPER+P   L+D L + L+ 
Sbjct: 79  RLDEHLGEFRVEPVTLRAARMMETATAVYGVQAMGALLRLLPERDPHPHLFDALEVILDH 138

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGV 156
              P+  G++FV+ EL +L ++GFGLDL +C  TG 
Sbjct: 139 LHNPADAGELFVRFELAVLNDLGFGLDLAECAATGA 174


>gi|190570798|ref|YP_001975156.1| recO-related protein [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|213019675|ref|ZP_03335480.1| recO-related protein [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
 gi|254790742|sp|B3CPG9|RECO_WOLPP RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|190357070|emb|CAQ54467.1| recO-related protein [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|212994716|gb|EEB55359.1| recO-related protein [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
          Length = 242

 Score =  237 bits (605), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 79/238 (33%), Positives = 126/238 (52%), Gaps = 13/238 (5%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVR--NGQSHRMQPILQAGNLVRVNW 58
           M W+D+ +I+ V+ YG+KN+IL + T+ +G+  G  R  N  +++     Q  NL+   W
Sbjct: 1   MRWKDEGVIIAVKKYGDKNLILSLFTKNHGKCRGLTRLTNNSNYK----FQISNLLHAEW 56

Query: 59  RSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLF-RFLPEREPCLELYDMLNIF 117
            ++L +NLG  + E++ES         L    + S   +  + LPE E C++LYD    F
Sbjct: 57  SAKLPENLGFLKCELIESPFHHFFQDRLKSIAIVSFSSILEKVLPESESCIKLYDNFRHF 116

Query: 118 LNCHKIPS-VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVG 176
           ++  K  S      ++ +EL+LL  +GF LDL+KC VTGV ++L ++SPK+G AV + VG
Sbjct: 117 IDVIKHNSQFWQSHYLNLELLLLTQLGFKLDLSKCAVTGVKENLQFISPKTGRAVSKKVG 176

Query: 177 LPYAEKMLVLPSFLWKE-----EQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLR 229
             YA+K+L  P  L        + +      +   ++T YFLNKY           LR
Sbjct: 177 DCYADKLLPFPQMLHDVYNNNLQNSYSYQEFRLGLKITGYFLNKYLFLQLNAKFPELR 234


>gi|56416838|ref|YP_153912.1| DNA repair protein RecO [Anaplasma marginale str. St. Maries]
 gi|81599148|sp|Q5PAM3|RECO_ANAMM RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|56388070|gb|AAV86657.1| hypothetical protein AM680 [Anaplasma marginale str. St. Maries]
          Length = 238

 Score =  234 bits (597), Expect = 9e-60,   Method: Composition-based stats.
 Identities = 73/228 (32%), Positives = 121/228 (53%), Gaps = 10/228 (4%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W++  +++G R YG+++++L ++TR  G   G  R     + +P LQ G+L+   WR+
Sbjct: 1   MQWREMGVVMGTRPYGDEHLLLSILTRNRGLRRGLTRF---TKKRP-LQIGDLIDATWRA 56

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFR-FLPEREPCLELYDMLNIFLN 119
           +L  NLG F  EV+ S         + L  L SI  +    LPE EP   LYD    F  
Sbjct: 57  KLPTNLGHFTCEVIASAFYSYFRDRIKLMCLSSITHIMSTALPENEPHPTLYDSFQDFAA 116

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
             +  +     ++++EL++L  +GF LDL+KC V+    +LL++SPK+G A+  +VG  Y
Sbjct: 117 AAEAEAPWYNHYLKLELLVLSQLGFALDLSKCAVSNSKDNLLFISPKTGRALSEAVGCAY 176

Query: 180 AEKMLVLPSFLWK-----EEQTIDADSLKSAFQLTDYFLNKYALQHNI 222
            +K+L LP  L       E +   AD    + ++  +FL ++ LQ + 
Sbjct: 177 RDKLLPLPKVLRSISCGVETECCSADEFALSLRILGFFLRRHLLQESH 224


>gi|269958745|ref|YP_003328532.1| DNA repair protein RecO [Anaplasma centrale str. Israel]
 gi|269848574|gb|ACZ49218.1| DNA repair protein RecO [Anaplasma centrale str. Israel]
          Length = 238

 Score =  234 bits (597), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 73/228 (32%), Positives = 123/228 (53%), Gaps = 10/228 (4%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W++  +++G R YG+++++L ++TR  G   G  R     + +P LQ G+L+   WR+
Sbjct: 1   MQWREMGVVMGTRPYGDEHLLLSILTRNRGLRRGLTRF---TKKRP-LQIGDLIDATWRA 56

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFR-FLPEREPCLELYDMLNIFLN 119
           +L  NLG F +EV+ S         + L  L SI  +    LPE EP   LYD    F  
Sbjct: 57  KLPTNLGHFTYEVITSAFYSYFRDRIKLMCLSSITHIMSTALPENEPHPTLYDSFQDFAA 116

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
             +  +     ++++EL++L  +GF LDL+KC V+    +LL++SPK+G A+  +VG  Y
Sbjct: 117 AAEAEAPWYNHYLKLELLVLSQLGFALDLSKCAVSNSKDNLLFISPKTGRALSEAVGCAY 176

Query: 180 AEKMLVLPSFLWK-----EEQTIDADSLKSAFQLTDYFLNKYALQHNI 222
            +K+L LP  L       E +   AD    + ++  +FL+++ LQ + 
Sbjct: 177 RDKLLPLPKVLRSISCGVETECCSADEFALSLKILGFFLHRHLLQESH 224


>gi|222475203|ref|YP_002563619.1| DNA repair protein RecO [Anaplasma marginale str. Florida]
 gi|254790506|sp|B9KIQ1|RECO_ANAMF RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|222419340|gb|ACM49363.1| DNA repair protein RecO [Anaplasma marginale str. Florida]
          Length = 238

 Score =  232 bits (592), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 73/228 (32%), Positives = 121/228 (53%), Gaps = 10/228 (4%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W++  +++G R YG+++++L ++TR  G   G  R     + +P LQ G+L+   WR+
Sbjct: 1   MQWREMGVVMGTRPYGDEHLLLSILTRNRGLRRGLTR---LTKKRP-LQIGDLIDATWRA 56

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFR-FLPEREPCLELYDMLNIFLN 119
           +L  NLG F  EV+ S         + L  L SI  +    LPE EP   LYD    F  
Sbjct: 57  KLPTNLGHFTCEVIASAFYSYFRDRIKLMCLSSITHIMSTALPENEPHPTLYDSFQDFAA 116

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
             +  +     ++++EL++L  +GF LDL+KC V+    +LL++SPK+G A+  +VG  Y
Sbjct: 117 AAEAEAPWYNHYLKLELLVLSQLGFALDLSKCAVSNSKDNLLFISPKTGRALSEAVGHAY 176

Query: 180 AEKMLVLPSFLWK-----EEQTIDADSLKSAFQLTDYFLNKYALQHNI 222
             K+L LP  L       E +   AD    + ++  +FL+++ LQ + 
Sbjct: 177 RNKLLPLPKVLRSISCGVETECCSADEFALSLKILGFFLHRHLLQESH 224


>gi|88607051|ref|YP_505316.1| DNA repair protein RecO [Anaplasma phagocytophilum HZ]
 gi|123494993|sp|Q2GJY5|RECO_ANAPZ RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|88598114|gb|ABD43584.1| DNA repair protein RecO [Anaplasma phagocytophilum HZ]
          Length = 245

 Score =  227 bits (580), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 66/228 (28%), Positives = 106/228 (46%), Gaps = 10/228 (4%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M WQD  +I+ +  YG+   IL V TR +G     +R  +  +    LQ G+ V V WR+
Sbjct: 1   MQWQDHGMIVSMTPYGDTRSILSVFTRNHGICNAMIRLNKKKQS---LQIGDRVCVTWRA 57

Query: 61  RLAQNLGEF-RFEVLESHCAKLLSSSLFLYGLQSIVP-LFRFLPEREPCLELYDMLNIFL 118
           RLA NLG F   E++ S           L  L S+   +++ +P  +    LYD L  F 
Sbjct: 58  RLANNLGYFNSCEIISSAFYAYFQDHSKLLCLSSVTSTIYKSVPTNDAHPILYDYLIEFA 117

Query: 119 NCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
              +        ++++EL +L  +GF LDL++C V     +LL++SPK+G A+    G+ 
Sbjct: 118 EAAECGGHWYNEYLKLELEILSQLGFALDLSRCAVYHCEDNLLYISPKTGRAISERAGVS 177

Query: 179 YAEKMLVLPSFLWKEEQTIDAD-----SLKSAFQLTDYFLNKYALQHN 221
           Y   +  LP  L         +           Q+  YFL+++ L  +
Sbjct: 178 YRHLLFPLPQILRDLHNGTHTEQCSRKEFLLCLQILGYFLHRHLLSDD 225


>gi|329890071|ref|ZP_08268414.1| recombinational DNA repair protein RecF pathway [Brevundimonas
           diminuta ATCC 11568]
 gi|328845372|gb|EGF94936.1| recombinational DNA repair protein RecF pathway [Brevundimonas
           diminuta ATCC 11568]
          Length = 200

 Score =  227 bits (579), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 70/197 (35%), Positives = 101/197 (51%), Gaps = 1/197 (0%)

Query: 44  MQPILQAGNLVRVNWRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LP 102
           M+P LQ G  V  + RSR +  LG  R E +    A L    L L GL +   + +  LP
Sbjct: 1   MRPFLQPGARVVADLRSRTSDQLGSARLEPVGEGPAALFDDPLALTGLSAAAAVAQGALP 60

Query: 103 EREPCLELYDMLNIFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLW 162
           EREP    +      +    +P V   IFV+ E  LL+++GFGLDL++C  TG   DL+W
Sbjct: 61  EREPHPGAFYAFEALMGAFAVPEVWPAIFVRFEAGLLEDLGFGLDLSRCASTGSMDDLVW 120

Query: 163 VSPKSGGAVCRSVGLPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNI 222
           VSP++G AV R  G PYA+K+L LP F+   +  +    +K+  +LT +FL ++      
Sbjct: 121 VSPRTGRAVSREAGAPYADKLLALPPFMLGAQAGLGEGDVKAGLELTGHFLEQFVFHALN 180

Query: 223 IHCHLLRENFLGKLLEL 239
                 R   + KL E 
Sbjct: 181 RPLPPARVWMIDKLGEA 197


>gi|58617232|ref|YP_196431.1| DNA repair protein RecO [Ehrlichia ruminantium str. Gardel]
 gi|58416844|emb|CAI27957.1| Putative DNA repair protein recO [Ehrlichia ruminantium str.
           Gardel]
          Length = 244

 Score =  222 bits (567), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 73/242 (30%), Positives = 130/242 (53%), Gaps = 8/242 (3%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M WQD  I++ +R Y +  +I+ V+T+++G   G  +     +    LQ G+ + V W +
Sbjct: 1   MRWQDQGIVIAIRKYCDNQVIISVLTKKHGLKKGLTKY--YKKTINRLQIGDYINVTWSA 58

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVP-LFRFLPEREPCLELYDMLNIFLN 119
           RL  NLG F++E+++S     ++++L    L      L + LPE E    +Y   +IF+N
Sbjct: 59  RLISNLGYFKYELIKSTIYYYMTNNLQTLCLAFFTFILDQVLPENEENYVIYHYFDIFIN 118

Query: 120 CHKIPSVIGKI-FVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
             +  ++  +I ++++E++LL  +GFGLDL+KC V    + L+++SPK+G A+ +++GLP
Sbjct: 119 SIQSKNINWQIKYLKLEMVLLSELGFGLDLSKCAVNQTQESLIFISPKTGKAISKNIGLP 178

Query: 179 YAEKMLVLPSFLWKEEQTIDAD----SLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLG 234
           Y +K+L LP  L+        +      K +  +  YF  K+ L    I     RE  + 
Sbjct: 179 YKKKLLPLPQLLYNIYNNYTYEFSNTEFKLSLNVLGYFFKKHFLTDKNITFLKYREEIIK 238

Query: 235 KL 236
            L
Sbjct: 239 LL 240


>gi|255003183|ref|ZP_05278147.1| DNA repair protein RecO [Anaplasma marginale str. Puerto Rico]
 gi|255004314|ref|ZP_05279115.1| DNA repair protein RecO [Anaplasma marginale str. Virginia]
          Length = 233

 Score =  221 bits (563), Expect = 9e-56,   Method: Composition-based stats.
 Identities = 71/222 (31%), Positives = 117/222 (52%), Gaps = 10/222 (4%)

Query: 7   AIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQNL 66
            +++G R YG+++++L ++TR  G   G  R     + +P LQ G+L+   WR++L  NL
Sbjct: 2   GVVMGTRPYGDEHLLLSILTRNRGLRRGLTR---LTKKRP-LQIGDLIDATWRAKLPTNL 57

Query: 67  GEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFR-FLPEREPCLELYDMLNIFLNCHKIPS 125
           G F  EV+ S         + L  L SI  +    LPE EP   LYD    F    +  +
Sbjct: 58  GHFTCEVIASAFYSYFRDRIKLMCLSSITHIMSTALPENEPHPTLYDSFQDFAAAAEAEA 117

Query: 126 VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKMLV 185
                ++++EL++L  +GF LDL+KC V+    +LL++SPK+G A+  +VG  Y  K+L 
Sbjct: 118 PWYNHYLKLELLVLSQLGFALDLSKCAVSNSKDNLLFISPKTGRALSEAVGHAYRNKLLP 177

Query: 186 LPSFLWK-----EEQTIDADSLKSAFQLTDYFLNKYALQHNI 222
           LP  L       E +   AD    + ++  +FL+++ LQ + 
Sbjct: 178 LPKVLRSISCGVETECCSADEFALSLKILGFFLHRHLLQESH 219


>gi|332188696|ref|ZP_08390410.1| DNA repair protein RecO [Sphingomonas sp. S17]
 gi|332011260|gb|EGI53351.1| DNA repair protein RecO [Sphingomonas sp. S17]
          Length = 243

 Score =  220 bits (562), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 82/244 (33%), Positives = 115/244 (47%), Gaps = 6/244 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M+    AIIL VR +GE   I+  +TR  G   G+VR G+S  ++P+LQ GN +   WR+
Sbjct: 1   MHRVAPAIILSVRPHGEHGAIVRALTRDDGVQPGYVRGGRSRALRPVLQPGNAIIGEWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPL-FRFLPEREPCLELYDMLNIFLN 119
           R A+ L     E   S    L    L   G++ +  L    LPE +P   LYD L+  L 
Sbjct: 61  RTAEQLPALTLEPGHSRAG-LHGEPLAAAGIEWLCALTAAALPEEQPYPILYDALDAVLT 119

Query: 120 CHK---IPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVG 176
             +            V+ EL+LL  +GFGLDL +C VTG T DL +VSPKSG AV     
Sbjct: 120 AIESAPSARGWAGALVRYELLLLGQLGFGLDLERCTVTGGTDDLAFVSPKSGAAVSVGAA 179

Query: 177 LPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKL 236
             Y  ++  LP FL  E    D   + +A ++T +FL +  L          R     + 
Sbjct: 180 FGYEARLFSLPLFLR-EGGAADWPDIFAAGRITAHFLARDILAGLRHDPMPARARLFDRF 238

Query: 237 LELI 240
              +
Sbjct: 239 KRAV 242


>gi|57239220|ref|YP_180356.1| DNA repair protein RecO [Ehrlichia ruminantium str. Welgevonden]
 gi|58579178|ref|YP_197390.1| DNA repair protein RecO [Ehrlichia ruminantium str. Welgevonden]
 gi|57161299|emb|CAH58220.1| putative DNA repair protein RecO [Ehrlichia ruminantium str.
           Welgevonden]
 gi|58417804|emb|CAI27008.1| Putative DNA repair protein recO [Ehrlichia ruminantium str.
           Welgevonden]
          Length = 244

 Score =  220 bits (562), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 73/242 (30%), Positives = 129/242 (53%), Gaps = 8/242 (3%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M WQD  I++ +R Y +  +I+ V+T+++G   G  +     +    LQ G+ + V W +
Sbjct: 1   MRWQDQGIVIAIRKYCDNQVIISVLTKKHGLKKGLTKY--YKKTINRLQIGDYINVTWSA 58

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVP-LFRFLPEREPCLELYDMLNIFLN 119
           RL  NLG F++E+++S     ++++L    L      L + LPE E    +Y   +IF+N
Sbjct: 59  RLISNLGYFKYELIKSTIYYYITNNLQTLCLAFFTFILDQVLPENEENYVIYHYFDIFIN 118

Query: 120 CHKIPSVIGKI-FVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
             +  ++  +I ++++E++LL  +GFGLDL+KC V    + L+++SPK+G A+  ++GLP
Sbjct: 119 SIQSKNINWQIKYLKLEMVLLSELGFGLDLSKCAVNQTQESLIFISPKTGKAISENIGLP 178

Query: 179 YAEKMLVLPSFLWKEEQTIDAD----SLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLG 234
           Y +K+L LP  L+        +      K +  +  YF  K+ L    I     RE  + 
Sbjct: 179 YKKKLLPLPQLLYNIYNDYTYEFSNTEFKLSLNVLGYFFKKHFLTDKNITFLKYREEIIK 238

Query: 235 KL 236
            L
Sbjct: 239 LL 240


>gi|88608141|ref|YP_506346.1| putative DNA repair protein RecO [Neorickettsia sennetsu str.
           Miyayama]
 gi|88600310|gb|ABD45778.1| putative DNA repair protein RecO [Neorickettsia sennetsu str.
           Miyayama]
          Length = 237

 Score =  220 bits (561), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 65/206 (31%), Positives = 108/206 (52%), Gaps = 8/206 (3%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+++ I+L  +   E   +  + T+ YG   G      S +    +  GN+V   W  
Sbjct: 1   MQWENEGIVLSNKGLVENKAVTTLFTKDYGLKRGL----CSRKT--TIDVGNVVYCRWSG 54

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVP-LFRFLPEREPCLELYDMLNIFLN 119
           RL   LG FR EV E     L +    L  L +++  L + LPE EP  E+Y      L 
Sbjct: 55  RLEVQLGYFRVEVKEIISPFLFTDYKKLKLLNAVLSILLKVLPENEPQKEIYKTFIQLLQ 114

Query: 120 CHKIPSVIG-KIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
             K  ++   + +++++L +L+ +GF LDL++C VTG T+DL ++SPK+G AV ++VG  
Sbjct: 115 AFKSNTLCYYRQYIEMDLSILQYLGFQLDLSRCAVTGETKDLFYISPKTGRAVTKAVGEA 174

Query: 179 YAEKMLVLPSFLWKEEQTIDADSLKS 204
           Y +K+L+LP  L+K    +  + +  
Sbjct: 175 YKDKLLLLPPSLYKIANGLSIEEISQ 200


>gi|254995034|ref|ZP_05277224.1| DNA repair protein RecO [Anaplasma marginale str. Mississippi]
          Length = 233

 Score =  219 bits (558), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 71/222 (31%), Positives = 118/222 (53%), Gaps = 10/222 (4%)

Query: 7   AIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQNL 66
            +++G R YG+++++L ++TR  G   G  R     + +P LQ G+L+   WR++L  NL
Sbjct: 2   GVVMGTRPYGDEHLLLSILTRNRGLRRGLTR---LTKKRP-LQIGDLIDATWRAKLPTNL 57

Query: 67  GEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFR-FLPEREPCLELYDMLNIFLNCHKIPS 125
           G F +EV+ S         + L  L SI  +    LPE EP   LYD    F    +  +
Sbjct: 58  GHFTYEVIASAFYSYFRDRIKLMCLSSITHIMSTALPENEPHPTLYDSFQDFAAAAEAEA 117

Query: 126 VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKMLV 185
                ++++EL++L  +GF LDL+KC V+    +LL++SPK+G A+  +VG  Y  K+L 
Sbjct: 118 PWYNHYLKLELLVLSQLGFALDLSKCAVSNSKDNLLFISPKTGRALSEAVGHAYRNKLLP 177

Query: 186 LPSFLWK-----EEQTIDADSLKSAFQLTDYFLNKYALQHNI 222
           LP  L       E +   AD    + ++  +FL+++ LQ + 
Sbjct: 178 LPKVLRSISCGVETECCSADEFALSLKILGFFLHRHLLQESH 219


>gi|254796817|ref|YP_003081654.1| DNA repair protein RecO [Neorickettsia risticii str. Illinois]
 gi|254590066|gb|ACT69428.1| DNA repair protein RecO [Neorickettsia risticii str. Illinois]
          Length = 238

 Score =  218 bits (556), Expect = 5e-55,   Method: Composition-based stats.
 Identities = 64/203 (31%), Positives = 109/203 (53%), Gaps = 8/203 (3%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+++ I+L  +   E   +  + T+ YG   G      S +    +  GN+V   W +
Sbjct: 1   MQWENEGIVLSNKGLVENKAVTTLFTKDYGLKRGL----CSRK--ATIDVGNVVYCKWSA 54

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVP-LFRFLPEREPCLELYDMLNIFLN 119
           RL   LG FR EV E     L +    L  L +++  L + LPE EP  E+Y +    L 
Sbjct: 55  RLESQLGYFRVEVKEIISPFLFTDYKKLKLLNAVLSILLKVLPENEPQKEIYKIFIQLLQ 114

Query: 120 CHKIPSVIG-KIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
             K  +    + +++++L +L+++GF LDL++C VTG T++L ++SPK+G AV ++VG  
Sbjct: 115 AFKSETSCYYRQYIEMDLSILRHLGFQLDLSRCTVTGETKNLFYISPKTGRAVTKAVGEA 174

Query: 179 YAEKMLVLPSFLWKEEQTIDADS 201
           Y +K+L+LP  L+K    +  + 
Sbjct: 175 YKDKLLLLPPSLYKIANGLSLED 197


>gi|306837524|ref|ZP_07470399.1| DNA repair protein RecO [Brucella sp. NF 2653]
 gi|306407416|gb|EFM63620.1| DNA repair protein RecO [Brucella sp. NF 2653]
          Length = 182

 Score =  217 bits (553), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 66/176 (37%), Positives = 97/176 (55%), Gaps = 1/176 (0%)

Query: 66  LGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPS 125
           +G F  E L    A+L+ + + LYG+Q      R LPER+P   LY+ L + +     P 
Sbjct: 1   MGTFTIEPLGFAAARLIETPVALYGIQLAAAHLRLLPERDPHRGLYETLRLIIEHFDDPL 60

Query: 126 VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKMLV 185
             G++ ++ E+M+L+ +GFGLDL +C  TG   DL++VSPKSG AVCR  G P+A+K+L 
Sbjct: 61  AAGELLLRFEVMMLEELGFGLDLKECAATGRKDDLIYVSPKSGRAVCREAGAPWADKLLA 120

Query: 186 LPSFLWKEE-QTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLELI 240
           LPSF+     +    D L  AF +T YFL ++  +         R  FL  +   I
Sbjct: 121 LPSFVNDTALRASCYDDLDRAFTMTGYFLMRHVWEPRAQTPPDSRSGFLNAVGRAI 176


>gi|306845265|ref|ZP_07477841.1| DNA repair protein RecO [Brucella sp. BO1]
 gi|306274424|gb|EFM56231.1| DNA repair protein RecO [Brucella sp. BO1]
          Length = 182

 Score =  216 bits (550), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 67/176 (38%), Positives = 97/176 (55%), Gaps = 1/176 (0%)

Query: 66  LGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPS 125
           +G F  E L    A+L+ + + LYG+Q      R LPER+P   LY+ L + +     P 
Sbjct: 1   MGTFTIEPLSFAAARLIETPVALYGIQLAAAHLRLLPERDPHRGLYETLRLIIEHFDDPL 60

Query: 126 VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKMLV 185
             G++ ++ E+M+L+ +GFGLDL +C  TG   DL++VSPKSG AVCR  G P+AEK+L 
Sbjct: 61  AAGELLLRFEVMMLEELGFGLDLKECAATGRKDDLIYVSPKSGRAVCREAGAPWAEKLLS 120

Query: 186 LPSFLWKEE-QTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLELI 240
           LPSF+     +    D L  AF +T YFL ++  +         R  FL  +   I
Sbjct: 121 LPSFVNDTALRASCYDDLDRAFTMTGYFLMRHVWEPRAQTPPDSRSGFLNAVGRAI 176


>gi|148260213|ref|YP_001234340.1| DNA repair protein RecO [Acidiphilium cryptum JF-5]
 gi|254790500|sp|A5FXT9|RECO_ACICJ RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|146401894|gb|ABQ30421.1| DNA repair protein RecO [Acidiphilium cryptum JF-5]
          Length = 251

 Score =  213 bits (542), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 72/244 (29%), Positives = 112/244 (45%), Gaps = 4/244 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W + AI+L V ++GE ++   V+   +G   G  R G   R  PI Q GNL+   W +
Sbjct: 1   MEWSEPAIVLSVAAFGESDLRTIVLAETHGAWHGLARGGAGRRGAPIWQEGNLINARWVA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGL-QSIVPLFRFLPEREPCLELYDMLNIFLN 119
           RL + LG    E++    A  ++  L L  L  +       LPERE     +  L   L 
Sbjct: 61  RLPEQLGSISGELVHPAAAIAMADPLALAVLRAACAVAAGALPEREAHRGAFIRLARLLG 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
              I        V+ EL LL+ +G+GLDL+ C ++G  +DL +VSP++G AV R     +
Sbjct: 121 GIGIAGTALPALVRFELELLRELGYGLDLSSCALSGAAEDLAFVSPRTGRAVARGAAGDW 180

Query: 180 AEKMLVLPSFLW---KEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKL 236
             ++L LP+FL      +   D  + +    LT +FL + A           R +   +L
Sbjct: 181 VPRLLKLPAFLLDEDAADDKADLAACRDGLALTGHFLARDAFGARHAPLPTARLDLYDRL 240

Query: 237 LELI 240
              +
Sbjct: 241 TRRL 244


>gi|326402842|ref|YP_004282923.1| DNA repair protein RecO [Acidiphilium multivorum AIU301]
 gi|325049703|dbj|BAJ80041.1| DNA repair protein RecO [Acidiphilium multivorum AIU301]
          Length = 251

 Score =  212 bits (541), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 72/244 (29%), Positives = 111/244 (45%), Gaps = 4/244 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W + AI+L V ++GE ++   V+   +G   G  R G   R  PI Q GNL+   W +
Sbjct: 1   MEWSEPAIVLSVAAFGESDLRTIVLAETHGAWHGLARGGAGRRGAPIWQEGNLINARWVA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGL-QSIVPLFRFLPEREPCLELYDMLNIFLN 119
           RL + LG    E++    A  ++  L L  L  +       LPERE     +  L   L 
Sbjct: 61  RLPEQLGSISGELVHPAAAIAMADPLALAVLRAACAVAAGALPEREAHRGAFIRLARLLG 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
              I        V+ EL LL+ +G+GLDL+ C ++G  +DL +VSP++G AV R     +
Sbjct: 121 GIGIAGTALPALVRFELELLRELGYGLDLSSCALSGAAEDLAFVSPRTGRAVARGAAGDW 180

Query: 180 AEKMLVLPSF---LWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKL 236
           A ++L LP+F       +   D  + +    LT +FL + A           R     +L
Sbjct: 181 APRLLKLPAFLLDEDAADDEADLAACRDGLALTGHFLARDAFGARHAPLPTARLGLYDRL 240

Query: 237 LELI 240
              +
Sbjct: 241 TRRL 244


>gi|161702946|ref|YP_303133.2| DNA repair protein RecO [Ehrlichia canis str. Jake]
          Length = 244

 Score =  211 bits (537), Expect = 9e-53,   Method: Composition-based stats.
 Identities = 79/245 (32%), Positives = 134/245 (54%), Gaps = 9/245 (3%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M WQD  I++ +R YG+  II+ + T+++G   G  R  +    +  LQ G+ V V W +
Sbjct: 1   MRWQDQGIVIAIRKYGDDQIIISIFTQKHGLKKGLARYQKKTIHR--LQIGDHVNVTWSA 58

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVP-LFRFLPEREPCLELYDMLNIFLN 119
           +L  NLG F++E+++S     + ++L    +      L + LPE E    +Y+ L+IF+N
Sbjct: 59  KLISNLGYFKYEIIKSTLHHYIHNNLKTMCIAFFTSILDQVLPENEENYTIYNHLDIFMN 118

Query: 120 CHKIPSVIGKI-FVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
             +   V  +I ++ +EL LL  +GFGLDL++C V    ++L+++SPK+G A+ ++VGLP
Sbjct: 119 SVQNKDVNWQIKYLTLELTLLSELGFGLDLSQCAVNNTNENLIFISPKTGKAISQTVGLP 178

Query: 179 YAEKMLVLPSFLWKEEQTIDA----DSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLG 234
           Y + +L LP  L+               K +  +T YFL K+ L    I     R+  + 
Sbjct: 179 YKKSLLPLPPLLYNVYNNYTYKYSKTDFKVSLNVTGYFLKKHFLTEKNITLIKYRDEII- 237

Query: 235 KLLEL 239
           KL++L
Sbjct: 238 KLIDL 242


>gi|330814140|ref|YP_004358379.1| GTP-binding protein Era [Candidatus Pelagibacter sp. IMCC9063]
 gi|327487235|gb|AEA81640.1| GTP-binding protein Era [Candidatus Pelagibacter sp. IMCC9063]
          Length = 228

 Score =  207 bits (527), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 59/240 (24%), Positives = 101/240 (42%), Gaps = 16/240 (6%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D   +L + +Y E + I   +T ++G H G +    S + +  LQ GN   +NW+S
Sbjct: 1   MNWKDIGYLLKISNYSENSSIATFVTCEHGLHKGVIYGATSKKKKNYLQIGNKFSLNWKS 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPL-FRFLPEREPCLELYDMLNIFLN 119
           +    LG +  E+  +  AK     + L  +QS+  L  + L ER    EL+D  + F+N
Sbjct: 61  KSEDALGYYDLELKNAVTAKFFDEPIKLSFIQSLSELCCKTLAERYDYSELFDYTDFFIN 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDL-LWVSPKSGGAVCRSVGLP 178
                +   K+++  E  LL  IGF L+           +L  W+             L 
Sbjct: 121 NISKAN-ALKLYILWEKELLTAIGFELNPDNKNFNFYKNNLSQWI-------------LE 166

Query: 179 YAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLE 238
             ++  + P+FL       +   L     +  + L ++  + N I    +RE    KL E
Sbjct: 167 IDKQKFLYPNFLIDSNSVYEDTDLYEGLVINKFILKRFVFEPNRIRFPEVRERIEKKLNE 226


>gi|72394258|gb|AAZ68535.1| recO-related protein [Ehrlichia canis str. Jake]
          Length = 248

 Score =  206 bits (526), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 78/244 (31%), Positives = 133/244 (54%), Gaps = 9/244 (3%)

Query: 2   YWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSR 61
            WQD  I++ +R YG+  II+ + T+++G   G  R  +    +  LQ G+ V V W ++
Sbjct: 6   RWQDQGIVIAIRKYGDDQIIISIFTQKHGLKKGLARYQKKTIHR--LQIGDHVNVTWSAK 63

Query: 62  LAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVP-LFRFLPEREPCLELYDMLNIFLNC 120
           L  NLG F++E+++S     + ++L    +      L + LPE E    +Y+ L+IF+N 
Sbjct: 64  LISNLGYFKYEIIKSTLHHYIHNNLKTMCIAFFTSILDQVLPENEENYTIYNHLDIFMNS 123

Query: 121 HKIPSVIGKI-FVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
            +   V  +I ++ +EL LL  +GFGLDL++C V    ++L+++SPK+G A+ ++VGLPY
Sbjct: 124 VQNKDVNWQIKYLTLELTLLSELGFGLDLSQCAVNNTNENLIFISPKTGKAISQTVGLPY 183

Query: 180 AEKMLVLPSFLWKEEQTIDA----DSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGK 235
            + +L LP  L+               K +  +T YFL K+ L    I     R+  + K
Sbjct: 184 KKSLLPLPPLLYNVYNNYTYKYSKTDFKVSLNVTGYFLKKHFLTEKNITLIKYRDEII-K 242

Query: 236 LLEL 239
           L++L
Sbjct: 243 LIDL 246


>gi|241761300|ref|ZP_04759388.1| DNA repair protein RecO [Zymomonas mobilis subsp. mobilis ATCC
           10988]
 gi|241374207|gb|EER63704.1| DNA repair protein RecO [Zymomonas mobilis subsp. mobilis ATCC
           10988]
          Length = 254

 Score =  203 bits (516), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 67/240 (27%), Positives = 111/240 (46%), Gaps = 11/240 (4%)

Query: 4   QDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLA 63
            + A++L  R + E   I+ ++T Q G   G+++   S   +P+L  GN V+ +WR ++ 
Sbjct: 5   SEPALLLTSRFHSENGAIIRLLTEQ-GLLTGYIQGAHSRYRRPLLFVGNYVQASWRDKVG 63

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPL-FRFLPEREPCLELYDMLNIFLNCH- 121
           ++L     E+  S    ++   L    L  I P     LPE +P   L+  L   L    
Sbjct: 64  RSLPSINIELRHSR-GLIMEHPLAALFLSWICPFTASVLPEGQPEPYLFQNLKRLLAIIE 122

Query: 122 --KIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
               P +     V+ EL+LL  +G+GL L++C++TG    L WVSPK   AV R     +
Sbjct: 123 KTDEPVLWMTELVRFELLLLSELGYGLHLSRCIITGQEACLDWVSPKHHAAVSRQAAQGH 182

Query: 180 AEKMLVLPSFLWKEEQT-----IDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLG 234
            +K+LVLP FL            D +SL+   +L+ +FL  +           +R+  + 
Sbjct: 183 EKKLLVLPDFLKAPFSVSCLDLPDQESLQQGLKLSGFFLRFHFEAAYYHRFFWVRQRLIK 242


>gi|260752832|ref|YP_003225725.1| DNA repair protein RecO [Zymomonas mobilis subsp. mobilis NCIMB
           11163]
 gi|283856306|ref|YP_162408.2| DNA repair protein RecO [Zymomonas mobilis subsp. mobilis ZM4]
 gi|258552195|gb|ACV75141.1| DNA repair protein RecO [Zymomonas mobilis subsp. mobilis NCIMB
           11163]
 gi|283775302|gb|AAV89297.2| DNA repair protein RecO [Zymomonas mobilis subsp. mobilis ZM4]
          Length = 254

 Score =  202 bits (515), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 66/240 (27%), Positives = 111/240 (46%), Gaps = 11/240 (4%)

Query: 4   QDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLA 63
            + A++L  R + E   I+ ++T Q G   G+++   S   +P+L  GN V+ +WR ++ 
Sbjct: 5   SEPALLLTSRFHSENGAIIRLLTEQ-GLLTGYIQGAHSRYRRPLLFVGNYVQASWRDKVG 63

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPL-FRFLPEREPCLELYDMLNIFLNCH- 121
           ++L     E+  S    ++   L    L  I P     LPE +P   L+  L   L    
Sbjct: 64  RSLPSINIELRHSR-GLIMEHPLAALFLSWICPFTASVLPEGQPEPYLFQNLKRLLAIIE 122

Query: 122 --KIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
               P +     V+ EL+LL  +G+GL L++C++TG    L WVSPK   AV R     +
Sbjct: 123 KTDEPVLWMTELVRFELLLLSELGYGLHLSRCIITGQEACLDWVSPKHHAAVSRQAAQGH 182

Query: 180 AEKMLVLPSFLWKEEQT-----IDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLG 234
            +K+LVLP FL            D ++L+   +L+ +FL  +           +R+  + 
Sbjct: 183 EKKLLVLPDFLKAPFSVSCLDLPDQEALQQGLKLSGFFLRFHFEAAYYHRFFGVRQRLIK 242


>gi|71083742|ref|YP_266462.1| recombination protein O [Candidatus Pelagibacter ubique HTCC1062]
 gi|91763222|ref|ZP_01265186.1| Recombination protein O [Candidatus Pelagibacter ubique HTCC1002]
 gi|71062855|gb|AAZ21858.1| Recombination protein O [Candidatus Pelagibacter ubique HTCC1062]
 gi|91717635|gb|EAS84286.1| Recombination protein O [Candidatus Pelagibacter ubique HTCC1002]
          Length = 226

 Score =  154 bits (390), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 58/241 (24%), Positives = 106/241 (43%), Gaps = 21/241 (8%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W D A ++    Y E +II EV T  +G+  G +  G S +++  LQ GN + VN+ S
Sbjct: 1   MNWDDSAYLVSKNRYSENSIIAEVFTENHGKISGIIFGGTSKKIKNYLQIGNKIYVNYNS 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFL-PEREPCLELYDMLNIFLN 119
           +    +G F+ E+L++        +  L  + S + L + L  E +   E++ +++ F  
Sbjct: 61  KSVTRIGYFKIEILKALTPLYFDQNQKLSCITSAMHLIKLLTAEAQSNKEIFKLIDKFFE 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQD--LLWVSPKSGGAVCRSVGL 177
                +   + ++  EL LLK +G+ L+L       +       +V   +          
Sbjct: 121 ILNSEN-WIQKYIFWELELLKLLGYDLELKTMAEKEIVDSEVNYYVKSST---------- 169

Query: 178 PYAEKMLVLPSFLWKEEQ--TIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGK 235
              +K   +P+FL  E        + LK    ++DY L K  L+ N ++    R +F+  
Sbjct: 170 --EKK--SIPNFLIDENNMDVNLKNLLKGLKLVSDY-LEKSILKPNNLNLPTSRTHFINL 224

Query: 236 L 236
           L
Sbjct: 225 L 225


>gi|83311360|ref|YP_421624.1| recombinational DNA repair protein [Magnetospirillum magneticum
           AMB-1]
 gi|82946201|dbj|BAE51065.1| Recombinational DNA repair protein [Magnetospirillum magneticum
           AMB-1]
          Length = 206

 Score =  152 bits (385), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 43/100 (43%), Positives = 55/100 (55%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W DD ++L VR +GE   +  ++TR +GRH G V  GQ    +PILQ GNLVR  W  
Sbjct: 1   MEWDDDGVVLAVRRHGETGAVASLLTRSHGRHAGLVHGGQGRANRPILQPGNLVRARWTG 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF 100
           RL + LG FR E+L +H A  L  +  L  L S   L   
Sbjct: 61  RLPEQLGNFRLEMLHAHAAAFLDDAARLAALGSACALAEA 100


>gi|85709082|ref|ZP_01040148.1| DNA repair protein RecO [Erythrobacter sp. NAP1]
 gi|85690616|gb|EAQ30619.1| DNA repair protein RecO [Erythrobacter sp. NAP1]
          Length = 200

 Score =  152 bits (385), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 40/149 (26%), Positives = 65/149 (43%), Gaps = 5/149 (3%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M     AI++  R++GE  +I  +MT ++G    +V  G+  +++P++  GN +    RS
Sbjct: 1   MNISVPAILVAARAHGETAVIARLMTEEHGLVAAYVAGGRGRQLRPVVIPGNSLEAEIRS 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPL-FRFLPEREPCLELYDMLNIFLN 119
           +    L   R E+  S  A  ++  L    +     L    LPER P   L+      L 
Sbjct: 61  KSDSQLPFARIELAVSR-APWMTEPLPAAAIGWACALTASTLPERNPYPSLFSAFEALLE 119

Query: 120 CH-KIPSV--IGKIFVQIELMLLKNIGFG 145
                PS        V  E MLL+ +G+G
Sbjct: 120 AICHAPSARGWLAAMVAYEAMLLRELGYG 148


>gi|103486573|ref|YP_616134.1| recombinational DNA repair protein (RecF pathway)-like protein
           [Sphingopyxis alaskensis RB2256]
 gi|98976650|gb|ABF52801.1| Recombinational DNA repair protein (RecF pathway)-like protein
           [Sphingopyxis alaskensis RB2256]
          Length = 192

 Score =  149 bits (378), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 55/233 (23%), Positives = 90/233 (38%), Gaps = 46/233 (19%)

Query: 12  VRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQNLGEFRF 71
           +R++GE   IL  +T + G   G+VR G+S R++PIL  GN V +  RSR  + LG    
Sbjct: 1   MRAHGEHGAILRALTHEAGLVAGYVRGGRSRRLRPILMPGNRVALELRSRTEEQLGGATV 60

Query: 72  EVLESHCAKLLSSSLFLYGLQSIVPL-FRFLPEREPCLELYDMLNIFLNCHK---IPSVI 127
           E+LES  A LL   L    +  +  L    LPE +P   LY  L+  L            
Sbjct: 61  ELLESR-APLLGEPLAAAAIDWVTSLTVAVLPEGQPFPALYIALSAVLEAIGVAPSARQW 119

Query: 128 GKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKMLVLP 187
                + EL+LL  +GFGL+                                 +K     
Sbjct: 120 ALALGRYELLLLAELGFGLE---------------------------------DK----- 141

Query: 188 SFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLELI 240
               +   +     +     +T +F+++  L         +R+  + +L  ++
Sbjct: 142 ---PRAASSPSMAEMLDFLSVTGHFIDRDLLDGRNRALAGVRQRLIDRLGRVV 191


>gi|296282559|ref|ZP_06860557.1| hypothetical protein CbatJ_03005 [Citromicrobium bathyomarinum
           JL354]
          Length = 198

 Score =  147 bits (373), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 45/149 (30%), Positives = 72/149 (48%), Gaps = 5/149 (3%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M  +  AI+L  R +GE  +I  ++T + G    +V  GQ  R++P++  GN V  + R+
Sbjct: 1   MQLKAPAIVLAARPHGENAVIARMLTHEAGMVAAYVAGGQGRRLRPVVIPGNSVEADIRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPL-FRFLPEREPCLELYDMLNIFLN 119
           R A  L   + E++ S  A  L+  L    +  +  L    LPER P   LYD L   L+
Sbjct: 61  RSASQLPFGKVELVASR-APWLNEPLPAAAILWVTALTASTLPERNPYPSLYDALGGLLD 119

Query: 120 CH-KIPSV--IGKIFVQIELMLLKNIGFG 145
                PS        +  E++LL+ +G+G
Sbjct: 120 AICHAPSARGWAPALLSYEVLLLRELGYG 148


>gi|149186742|ref|ZP_01865053.1| hypothetical protein ED21_29626 [Erythrobacter sp. SD-21]
 gi|148829650|gb|EDL48090.1| hypothetical protein ED21_29626 [Erythrobacter sp. SD-21]
          Length = 198

 Score =  147 bits (373), Expect = 9e-34,   Method: Composition-based stats.
 Identities = 47/164 (28%), Positives = 75/164 (45%), Gaps = 7/164 (4%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M+ +  AI+L  R +GE  +I  ++T + G    +V  G+  +++P++  GNLV    R+
Sbjct: 1   MHLRAPAILLAARPHGETAVIARLLTEESGVVAAYVAGGRGRQLRPVVIPGNLVEAEIRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPL-FRFLPEREPCLELYDMLNIFLN 119
           +    L   R E+ +S     L+  L    +     L    LPER P   LY  L   L 
Sbjct: 61  KSDSQLPFARLELAQSR-GPWLTEPLPAAAIAWTCALTASALPERNPYPSLYSALAALLE 119

Query: 120 CH-KIPSV--IGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDL 160
                PS           E++LL+ +G+G   TK V+ G+ Q L
Sbjct: 120 AICNAPSARGWAGALATYEVLLLRELGYG--GTKPVIEGLEQAL 161


>gi|85374495|ref|YP_458557.1| hypothetical protein ELI_08340 [Erythrobacter litoralis HTCC2594]
 gi|84787578|gb|ABC63760.1| hypothetical protein ELI_08340 [Erythrobacter litoralis HTCC2594]
          Length = 200

 Score =  146 bits (370), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 42/146 (28%), Positives = 71/146 (48%), Gaps = 5/146 (3%)

Query: 4   QDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLA 63
           +  AI+L  R +GE  +I  ++T ++G   G+V  G+  +++P++  GNLV +  R++  
Sbjct: 6   RAPAILLAARPHGETAVIARLLTEEFGMVAGYVAGGRGRQLRPVVIPGNLVELELRAKSD 65

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPL-FRFLPEREPCLELYDMLNIFLNCH- 121
             L   + E++ES     LS  L    +Q    L    LPER     LY  L   L+   
Sbjct: 66  SQLPFAKLELVESR-GPWLSEPLPAAAIQWATALTATALPERNAYPNLYSALVALLDAVC 124

Query: 122 KIPSV--IGKIFVQIELMLLKNIGFG 145
           + PS        +  E +LL+ +G+G
Sbjct: 125 QAPSARGWAPALLSYEALLLRELGYG 150


>gi|6647943|sp|Q9ZD01|Y549_RICPR RecName: Full=Uncharacterized protein RP549
 gi|3861098|emb|CAA14998.1| unknown [Rickettsia prowazekii]
          Length = 135

 Score =  144 bits (363), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 47/127 (37%), Positives = 69/127 (54%), Gaps = 3/127 (2%)

Query: 110 LYDMLNIFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGG 169
            +  L  +L+     +   + ++  EL LL   G+ LDLTKC V+ VT DL +VSPKS  
Sbjct: 9   FFSFLINYLDNL-SKNFCFRDYISFELNLLAETGYKLDLTKCCVSHVTTDLTYVSPKSAR 67

Query: 170 AVCRSVGLPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLR 229
           A+   VG PY +K+L+LP FL  ++  I  +  K A  LT+YF N+Y   +N       R
Sbjct: 68  ALSYKVGKPYRDKLLILPKFLLAKDSEITLEEKKQALTLTNYFFNRYLFHNNRQV--KAR 125

Query: 230 ENFLGKL 236
           E F+  +
Sbjct: 126 EEFIEYI 132


>gi|87200674|ref|YP_497931.1| recombinational DNA repair protein (RecF pathway)-like
           [Novosphingobium aromaticivorans DSM 12444]
 gi|87136355|gb|ABD27097.1| Recombinational DNA repair protein (RecF pathway)-like protein
           [Novosphingobium aromaticivorans DSM 12444]
          Length = 202

 Score =  143 bits (362), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 41/149 (27%), Positives = 67/149 (44%), Gaps = 5/149 (3%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M  +  AI+  VR +GE   ++ +MT ++G    +V   +   ++P+L  GNL+    R 
Sbjct: 1   MQIRAPAILCSVRPHGEHGAVVRLMTEEHGLAAAYVAGARGRELRPLLIPGNLLEAEVRG 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPL-FRFLPEREPCLELYDMLNIFLN 119
           R A  L   R E++ S     L+  L   G+     L    LPE  P   LYD L   L+
Sbjct: 61  RAASQLPSARLELVASR-GPWLTEPLPSAGIGWACALTAATLPEGHPYPLLYDSLGALLD 119

Query: 120 CH---KIPSVIGKIFVQIELMLLKNIGFG 145
                       ++    E++LL+ +G+G
Sbjct: 120 AICLAPSARGWARVLAGYEVLLLREVGYG 148


>gi|23011689|ref|ZP_00051976.1| COG1381: Recombinational DNA repair protein (RecF pathway)
           [Magnetospirillum magnetotacticum MS-1]
          Length = 117

 Score =  142 bits (360), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 42/110 (38%), Positives = 59/110 (53%), Gaps = 6/110 (5%)

Query: 131 FVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKMLVLPSFL 190
            V+ EL LL  +GFGLDL+ C  TG    L++VSPKSG AV  S G PY +++L LP FL
Sbjct: 1   MVRFELALLAGLGFGLDLSHCAATGANDALVYVSPKSGRAVSASAGEPYRDRLLPLPPFL 60

Query: 191 WKEEQT------IDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLG 234
              +Q        D  +++  F LT YFL+++  +         R  F+ 
Sbjct: 61  RDRDQPGSGWQTPDEHAVREGFTLTGYFLDQHVWRPRAQVMPEERARFVA 110


>gi|253576084|ref|ZP_04853416.1| DNA repair protein RecO [Paenibacillus sp. oral taxon 786 str. D14]
 gi|251844427|gb|EES72443.1| DNA repair protein RecO [Paenibacillus sp. oral taxon 786 str. D14]
          Length = 249

 Score =  142 bits (358), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 47/196 (23%), Positives = 76/196 (38%), Gaps = 10/196 (5%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQ--PILQA---GNLVR 55
           M ++ + I++    YGE N I+ + T   G+    VR  +  + +   + Q    G  V 
Sbjct: 1   MLYRVEGIVIRSMDYGEGNKIITLCTETSGKIGVLVRGAKKVKSRHGALTQPFTHGEYVF 60

Query: 56  VNWRSRLAQNLGEF-RFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDML 114
                     LG   + E++ESH +      L  Y   +   L + L + E     +  L
Sbjct: 61  FRQNG----GLGTLNQGEMIESHFSLREDLFLAAYASYACELLDKTLQDEEVGSFWFTQL 116

Query: 115 NIFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRS 174
              L+          +    E+ +L+  G+G     CV  G   D  +VSP+ GG +CRS
Sbjct: 117 KACLDGLSSGKDPQIVTHLFEMKILQAAGYGPSFESCVSCGRVDDSPYVSPRLGGRLCRS 176

Query: 175 VGLPYAEKMLVLPSFL 190
                   M V P  L
Sbjct: 177 CRHQDPAAMQVTPGVL 192


>gi|218515340|ref|ZP_03512180.1| DNA repair protein RecO [Rhizobium etli 8C-3]
          Length = 84

 Score =  141 bits (355), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 47/83 (56%), Positives = 61/83 (73%)

Query: 1  MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
          M WQD AIILG++ +GE ++I EVMTR  GRHLG VR+G+S  MQP+LQ GN V V WR+
Sbjct: 1  MQWQDHAIILGIKRHGETSVIAEVMTRDRGRHLGLVRSGRSRAMQPVLQPGNAVEVIWRA 60

Query: 61 RLAQNLGEFRFEVLESHCAKLLS 83
          RL ++LGEFR E +    A+L+ 
Sbjct: 61 RLDEHLGEFRVEPVTLRAARLME 83


>gi|262277164|ref|ZP_06054957.1| DNA repair protein RecO [alpha proteobacterium HIMB114]
 gi|262224267|gb|EEY74726.1| DNA repair protein RecO [alpha proteobacterium HIMB114]
          Length = 208

 Score =  137 bits (346), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 45/162 (27%), Positives = 83/162 (51%), Gaps = 3/162 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W D   +L V +  E + +++V +R++G   G V    S + +P LQ GN +++N+ S
Sbjct: 1   MRWSDIGYLLSVSATKENSSLVKVFSREHGCVTGVVYGSSSKKKKPDLQIGNKIKLNFNS 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFL-YGLQSIVPLFRFLPEREPCLELYDMLNIFLN 119
           +    LG F  E++E+   K  +    L   + SI  + + +PE++   E +D  +  + 
Sbjct: 61  KNEDALGYFSIELMENISIKFFNDLKKLNLLIISIEVISKIMPEQQKYTECFDEYDQLIK 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLL 161
             +  S+  K ++  E   LKNIG+G+DL +     V + +L
Sbjct: 121 SLEGDSL--KSYLIWEFNFLKNIGYGVDLNEEGFNPVIKSIL 160


>gi|172056863|ref|YP_001813323.1| DNA repair protein RecO [Exiguobacterium sibiricum 255-15]
 gi|229485534|sp|B1YL74|RECO_EXIS2 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|171989384|gb|ACB60306.1| DNA repair protein RecO [Exiguobacterium sibiricum 255-15]
          Length = 249

 Score =  137 bits (345), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 53/233 (22%), Positives = 94/233 (40%), Gaps = 19/233 (8%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQ--SHRMQPILQAGNL-VRVN 57
           M  + + ++L    YGE N I+ ++TR+YG+     R  +    R     Q     + V 
Sbjct: 1   MIDKAEGLVLRTVVYGESNKIITLLTREYGKLAVMARGAKKPGSRFNAASQPFVRAIYVY 60

Query: 58  WRSRLAQNLGEFR-FEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNI 116
            RSR    LG+ +  +V+  +        L  Y +  +    + L ER P   LYD+   
Sbjct: 61  PRSR---GLGQLKSADVITGYSKIRQDVFLMAYAMYLLELADKALDERVPQPALYDLFVD 117

Query: 117 FLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCR--- 173
            L           +   +EL LL+++G    L  C V G  +     S   GG +CR   
Sbjct: 118 GLEAMDEGLDPDVVSFIVELRLLRHLGIAPHLNGCTVCGSVEAPFAFSLNHGGLLCRRHR 177

Query: 174 -------SVGLPYAEKMLVLPSFLWKEEQTID--ADSLKSAFQLTDYFLNKYA 217
                  S+    A+ + V   + +    T+D   ++ +   Q+ D ++ +Y+
Sbjct: 178 QEDEHAVSLTESVAKMLYVFSVYDFSRIGTVDVKPETKRLLRQIMDAYMERYS 230


>gi|326386768|ref|ZP_08208389.1| recombinational DNA repair protein (RecF pathway)-like protein
           [Novosphingobium nitrogenifigens DSM 19370]
 gi|326208821|gb|EGD59617.1| recombinational DNA repair protein (RecF pathway)-like protein
           [Novosphingobium nitrogenifigens DSM 19370]
          Length = 202

 Score =  136 bits (344), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 39/149 (26%), Positives = 65/149 (43%), Gaps = 5/149 (3%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M  + +AI+  +R +GE   I+  +T  +G    +V   +   ++P+L  GN + V  R+
Sbjct: 1   MLIRVEAILCAMRPHGEHGGIIRALTGDHGMVAAYVSGARGRTLRPVLIPGNTLAVEIRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPL-FRFLPEREPCLELYDMLNIFLN 119
           R    L   R E++ S  A  L   L    +     L    LPE  P   L+  L   L+
Sbjct: 61  RGGSQLPGARTELVASR-APWLGEPLPAAAIDWATALTAATLPEGHPYPALHTALGALLD 119

Query: 120 CH-KIPSV--IGKIFVQIELMLLKNIGFG 145
                PS     ++    E +LL+ +G+G
Sbjct: 120 AICHAPSARGWARVLAGYEALLLREVGYG 148


>gi|6647944|sp|Q9ZD02|Y548_RICPR RecName: Full=Uncharacterized protein RP548
 gi|3861097|emb|CAA14997.1| unknown [Rickettsia prowazekii]
          Length = 115

 Score =  130 bits (328), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 29/112 (25%), Positives = 58/112 (51%), Gaps = 2/112 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M  +D  +I+  +   E   I+ V T+ +G + G ++   S + + I Q GN+V   W++
Sbjct: 1   MNIKDIGVIISKKPLKENTFIIRVFTKNHGLYSGVIKE-SSKKNKFIYQEGNIVDFLWKA 59

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFL-PEREPCLELY 111
           RL +++G  + E+++S+    + +   LY   S++ L + L  ERE     +
Sbjct: 60  RLHEHIGIAKCELIKSYTGYFIINKAKLYAFNSVISLIQELFHEREEHSIFF 111


>gi|188585832|ref|YP_001917377.1| DNA repair protein RecO [Natranaerobius thermophilus JW/NM-WN-LF]
 gi|179350519|gb|ACB84789.1| DNA repair protein RecO [Natranaerobius thermophilus JW/NM-WN-LF]
          Length = 257

 Score =  119 bits (300), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 42/185 (22%), Positives = 82/185 (44%), Gaps = 16/185 (8%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQS--HRMQPILQA---GNLVRVN 57
           +  DA+++  R Y + + I+ + T  YGR    V+  +    ++  I+Q+   GN    +
Sbjct: 5   YNSDAVVIRSRDYRDYDKIINLFTPYYGRVSAVVKGVKKPKSKLAGIVQSFTYGNYQLYS 64

Query: 58  WRS--RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLN 115
            +S  RL Q      F+ L +    L+S+ + +  L     + + +PE E    L+ +  
Sbjct: 65  GKSLGRLVQGKVLHGFQELRTDLV-LMSAGMCILEL-----IDKAIPEGEEYPALFGVTL 118

Query: 116 IFLNCHKIPSVIGKIFVQ-IELMLLKNIGFGLDLTKCVVTGV-TQDLLWVSPKSGGAVCR 173
                    S    + ++  E  L+ N+G   +L+ C+  G  TQ  L+  P++GG +C 
Sbjct: 119 SCF-HLLEKSYPPSLVLRIFEAKLIHNLGVSPELSGCINHGSITQGNLYFDPETGGLICE 177

Query: 174 SVGLP 178
           +    
Sbjct: 178 TCFEQ 182


>gi|308069927|ref|YP_003871532.1| DNA repair protein RecO [Paenibacillus polymyxa E681]
 gi|305859206|gb|ADM70994.1| DNA repair protein recO (Recombination protein O) [Paenibacillus
           polymyxa E681]
          Length = 250

 Score =  116 bits (290), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 43/198 (21%), Positives = 75/198 (37%), Gaps = 13/198 (6%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQ--PILQA---GNLVR 55
           M ++ + I++    YGE N I+ + T   G+    VR  +  + +   + Q    G  V 
Sbjct: 1   MLYRVEGIVIRSMDYGEGNKIITLCTESGGKAGVLVRGAKKSKSRHAALTQPFTYGEFVF 60

Query: 56  VNWRSRLAQNLGEFRF-EVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDML 114
                     LG     E+++SH       +   Y   +   L R L + E     +  L
Sbjct: 61  FR-----NTGLGTLNAGEIIQSHHTLREDITKAAYASYACELLDRVLQDEETGAFWFKQL 115

Query: 115 NIFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVT--QDLLWVSPKSGGAVC 172
              L   +       +    E  +L+  G+   L  C+ +G     + ++VSP+ GG +C
Sbjct: 116 KACLEALESGKDPLIVMSIYEFKILQAAGYAPQLDACISSGQQCADEDMFVSPRLGGVLC 175

Query: 173 RSVGLPYAEKMLVLPSFL 190
           RS        + V P  L
Sbjct: 176 RSYKHFDPAALSVTPRTL 193


>gi|315645985|ref|ZP_07899106.1| DNA repair protein RecO [Paenibacillus vortex V453]
 gi|315278746|gb|EFU42060.1| DNA repair protein RecO [Paenibacillus vortex V453]
          Length = 262

 Score =  115 bits (289), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 50/200 (25%), Positives = 81/200 (40%), Gaps = 16/200 (8%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQ--SHRMQPILQA---GNLVR 55
           M ++ + I++    YGE N I+ + T++ G+    VR  +    R   + Q    G  V 
Sbjct: 12  MLYRAEGIVIRSMDYGEGNKIITLCTKESGKVGVLVRGAKKVKSRHAALTQLFTYGEYVF 71

Query: 56  VNWRSRLAQNLGEFRF-EVLESHCAKLLSSSL-FLYGLQSIVPLFRFLPEREPCLELYDM 113
                R    LG     E++ESH  +L    +   Y   +   L R L + E     +  
Sbjct: 72  F----RNGTGLGNLNAGEIMESH-HRLREDLVKAAYASYACELLDRVLQDEETGAFWFHQ 126

Query: 114 LNIFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVT---QDLLWVSPKSGGA 170
           L   +   +       I    E+ +L+  G+G +L  C+    T   +D+L VSP+ GG 
Sbjct: 127 LKACMEALQEDKDPQIIINLYEMKILQAAGYGPELDVCISCNQTRKDEDML-VSPRLGGV 185

Query: 171 VCRSVGLPYAEKMLVLPSFL 190
           +CR         M V P  L
Sbjct: 186 LCRYCKHLDPPAMSVTPRTL 205


>gi|329924075|ref|ZP_08279338.1| DNA repair protein RecO [Paenibacillus sp. HGF5]
 gi|328940914|gb|EGG37222.1| DNA repair protein RecO [Paenibacillus sp. HGF5]
          Length = 251

 Score =  114 bits (287), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 46/198 (23%), Positives = 75/198 (37%), Gaps = 12/198 (6%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQ--SHRMQPILQA---GNLVR 55
           M ++ + I++    YGE N I+ + T++ G+    VR  +    R   + Q    G  V 
Sbjct: 1   MLYRAEGIVIRSMDYGEGNKIITLCTKESGKVGVLVRGAKKVKSRHAALTQLFTYGEYVF 60

Query: 56  VNWRSRLAQNLGEFRF-EVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDML 114
                R    LG     E++ESH           Y   +   L R L + E     +  L
Sbjct: 61  F----RNGTGLGNLNAGEIMESHHGLREDLVKAAYASYACELLDRVLQDEETGAFWFHQL 116

Query: 115 NIFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTG--VTQDLLWVSPKSGGAVC 172
              L   +       I    E+ +L+  G+G +L  C+        + + VSP+ GG +C
Sbjct: 117 KACLEALQEDKDPQIIINLYEMKILQAAGYGPELDVCISCNQSRKDEDMLVSPRLGGVLC 176

Query: 173 RSVGLPYAEKMLVLPSFL 190
           R         M + P  L
Sbjct: 177 RYCKHLDPPAMAISPRTL 194


>gi|261405618|ref|YP_003241859.1| DNA repair protein RecO [Paenibacillus sp. Y412MC10]
 gi|261282081|gb|ACX64052.1| DNA repair protein RecO [Paenibacillus sp. Y412MC10]
          Length = 251

 Score =  114 bits (286), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 43/181 (23%), Positives = 71/181 (39%), Gaps = 12/181 (6%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQ--SHRMQPILQA---GNLVR 55
           M ++ + I++    YGE N I+ + T++ G+    VR  +    R   + Q    G  V 
Sbjct: 1   MLYRAEGIVIRSMDYGEGNKIITLCTKESGKVGVLVRGAKKVKSRHAALTQLFTYGEYVF 60

Query: 56  VNWRSRLAQNLGEFRF-EVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDML 114
                R    LG     E++ESH           Y   +   L R L + E     +  L
Sbjct: 61  F----RNGTGLGNLNAGEIMESHHGLREDLVKAAYASYACELLDRVLQDEETGAFWFHQL 116

Query: 115 NIFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTG--VTQDLLWVSPKSGGAVC 172
              L   +       I    E+ +L+  G+G +L  C+        + + VSP+ GG +C
Sbjct: 117 KACLEALQEDKDPQIIINLYEMKILQAAGYGPELDVCISCNQSRKDEDMLVSPRLGGVLC 176

Query: 173 R 173
           R
Sbjct: 177 R 177


>gi|310643036|ref|YP_003947794.1| DNA repair protein reco [Paenibacillus polymyxa SC2]
 gi|309247986|gb|ADO57553.1| DNA repair protein RecO [Paenibacillus polymyxa SC2]
          Length = 246

 Score =  110 bits (276), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 41/195 (21%), Positives = 72/195 (36%), Gaps = 19/195 (9%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQ--PILQA---GNLVRVNWRS 60
           + I++    YGE N I+ + T   G+    VR  +  + +   + Q    G  V      
Sbjct: 2   EGIVIRSMDYGEGNKIITLCTESGGKVGVLVRGAKKSKSRHAALTQPFTYGEFVFFR--- 58

Query: 61  RLAQNLGEFRF-EVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLN 119
                LG     E+++SH       +   Y   +   L R L + E     +  L   L 
Sbjct: 59  --NTGLGTLNAGEIIQSHHTLREDITKAAYASYACELLDRVLQDEETGAFWFKQLKACLE 116

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVT--QDLLWVSPKSGGAVCRS--- 174
             +       +    E  +L+  G+   L  C+ +G     + +++SP+ GG +CR    
Sbjct: 117 ALESGKDPLIVMSIYEFKILQAAGYAPQLDACISSGQQCADEDMFISPRLGGVLCRGYKH 176

Query: 175 ---VGLPYAEKMLVL 186
                L  A + L L
Sbjct: 177 FDPAALSVAPRTLKL 191


>gi|194017652|ref|ZP_03056262.1| DNA repair protein RecO [Bacillus pumilus ATCC 7061]
 gi|194010552|gb|EDW20124.1| DNA repair protein RecO [Bacillus pumilus ATCC 7061]
          Length = 256

 Score =  109 bits (274), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 48/235 (20%), Positives = 92/235 (39%), Gaps = 23/235 (9%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQS--HRMQPILQAGNLVRVNW 58
           M  + + I+L    YGE N I+ ++TR++G+     R  +    R+  I Q    +   +
Sbjct: 1   MLIKSEGIVLRTTDYGETNKIVTLLTREHGKIGVMARGAKKSNSRLSAISQP--FLYGTF 58

Query: 59  RSRLAQNLGEF-RFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
             + +  LG   + E++ES         L  Y       L +   E++P   L+++L   
Sbjct: 59  LIQSSTGLGTLQQGEMIESMRTIREDLFLTAYAAYMTELLDKGTEEKKPNPYLFELLLQS 118

Query: 118 LNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSV-- 175
           L      +    I   +E+ +L  +G   +L +CV  G  +     S +  G +C++   
Sbjct: 119 LRHLNEGTDADVILFIVEVKMLSVMGMKPELDQCVHCGQKEGQFHFSIRDNGFICQNCFS 178

Query: 176 GLPYAEKMLVLPS-----------FLWKEEQTID--ADSLKSAFQLTDYFLNKYA 217
             PY    L L             F       +D    + +   Q+ D++  +Y+
Sbjct: 179 KDPYK---LPLSPAAARLLRLFHYFDLSRLGQVDVKPQTKQEIRQVLDHYYEEYS 230


>gi|157693027|ref|YP_001487489.1| DNA repair protein RecO [Bacillus pumilus SAFR-032]
 gi|166918728|sp|A8FFB2|RECO_BACP2 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|157681785|gb|ABV62929.1| DNA repair protein RecO [Bacillus pumilus SAFR-032]
          Length = 256

 Score =  109 bits (272), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 48/235 (20%), Positives = 93/235 (39%), Gaps = 23/235 (9%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQS--HRMQPILQAGNLVRVNW 58
           M  + + I+L    YGE N I+ ++TR++G+     R  +    R+  I Q    +   +
Sbjct: 1   MLIKSEGIVLRTTDYGETNKIVTLLTREHGKIGVMARGAKKSNSRLSAISQP--FLYGTF 58

Query: 59  RSRLAQNLGEF-RFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
             + +  LG   + E++ES         L  Y       L +   E++P   L+++L   
Sbjct: 59  LIQSSTGLGTLQQGEMIESMRTIREDLFLTAYAAYMTELLDKGTEEKKPNPYLFELLLQS 118

Query: 118 LNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSV-- 175
           L      +    I   +E+ +L  +G   +L +CV  G  +     S +  G +C++   
Sbjct: 119 LRHLNEGTDADIILFIVEVKMLSVMGMKPELDQCVHCGQKEGQFHFSIRDNGFICQNCFS 178

Query: 176 GLPYAEKMLVLPS-----------FLWKEEQTID--ADSLKSAFQLTDYFLNKYA 217
             PY    L L             F       +D    + +   Q+ D++ ++Y+
Sbjct: 179 KDPYK---LPLSPAAARLLRLFHYFDLSRLGQVDVKPQTKQEIRQVLDHYYDEYS 230


>gi|117924217|ref|YP_864834.1| DNA replication and repair protein RecO [Magnetococcus sp. MC-1]
 gi|117607973|gb|ABK43428.1| DNA replication and repair protein RecO [Magnetococcus sp. MC-1]
          Length = 242

 Score =  106 bits (265), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 48/222 (21%), Positives = 83/222 (37%), Gaps = 16/222 (7%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQN 65
            AIIL    + + ++++ + T+ +G      R     +    L  G+L   +    L   
Sbjct: 8   PAIILRRIPFRDSSLVVSLFTQDHGVRAVMARGA--RKGSKTLPRGDLAGYH---TLGVQ 62

Query: 66  LGEFRFE-VLESHCAKLLSSSLFLY----GLQSIVPLF----RFLPEREPCLELYDMLNI 116
           LG    + +L    A++L     L     G  +   +     R LP  +   +L+  L  
Sbjct: 63  LGGREGQNMLTLRSAEILQPRHGLLHQRVGSSAAQLMLEQVYRLLPVEDANPKLFGALQE 122

Query: 117 FLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVG 176
            L+  +      ++    +  LL N+GFG  +  C   G   DL + S K    VC   G
Sbjct: 123 ALDRLEAGEAALEVVGLWQGFLLHNLGFGWQVAHCAGCGGETDLRFFSTKRNQTVCAPCG 182

Query: 177 LPYAEKMLVLPSFLWK--EEQTIDADSLKSAFQLTDYFLNKY 216
            P+  ++L LP  +      Q   A        LT   L ++
Sbjct: 183 TPHRHRLLPLPEGVLAVMRGQPGGAADQAELVMLTTALLAQH 224


>gi|300311262|ref|YP_003775354.1| DNA repair protein [Herbaspirillum seropedicae SmR1]
 gi|300074047|gb|ADJ63446.1| DNA repair protein [Herbaspirillum seropedicae SmR1]
          Length = 286

 Score =  105 bits (264), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 51/244 (20%), Positives = 87/244 (35%), Gaps = 34/244 (13%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQ--SHRMQPILQAGNLVRVNWRSRLA 63
              +L    Y E ++I++V +R +GR     +  +    +++  LQ    + ++W  +  
Sbjct: 58  PGFVLHSYPYKETSLIIDVFSRDHGRVALVAKGAKRPHSKLRGALQTFQPLSLSWSGKS- 116

Query: 64  QNLGEFRFEVLESHCAKL------LSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
                   EV     A+       L  S  L G      L + L   +    L+D     
Sbjct: 117 --------EVRTLTDAEWVGGLLPLEKSALLCGFYLNELLVKLLAREDAHPALFDHYVAT 168

Query: 118 LNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTG--VTQDLLW-VSPKSG---GAV 171
           LN          +  Q E +LLK  G   + + CVV+G  V  DL++ V P+ G     +
Sbjct: 169 LNKLAHGENAPIVLRQFERILLKQTGVAGNWSHCVVSGKTVRPDLIYVVDPEQGTRPERL 228

Query: 172 CRSVGLPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYAL-QHNIIHCHLLRE 230
                    + +L       + E   D  +     QL   FL +Y L  H        R+
Sbjct: 229 SDRAPKVSGKTLL-----DMEREDYSDPTT-----QLQSKFLMRYLLAHHLGGAQLNTRQ 278

Query: 231 NFLG 234
             + 
Sbjct: 279 ILID 282


>gi|212638695|ref|YP_002315215.1| DNA repair protein RecO [Anoxybacillus flavithermus WK1]
 gi|212560175|gb|ACJ33230.1| Recombinational DNA repair protein (RecF pathway) [Anoxybacillus
           flavithermus WK1]
          Length = 268

 Score =  103 bits (257), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 41/188 (21%), Positives = 71/188 (37%), Gaps = 5/188 (2%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQ--SHRMQPILQAGNL-VRVNWRSRL 62
           + I++    YGE N I+ + TR++G+     R  +  S R+  + Q     + +  +SR 
Sbjct: 21  EGIVIRTIDYGETNKIVTIFTREWGKVAAMARGAKKPSSRLSSVTQIFTYGIFLIQKSRG 80

Query: 63  AQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHK 122
             +L   + E+L +         L  Y    I    +   ER P   L+++L   L    
Sbjct: 81  VGSL--HQGELLSTMRHIREDIFLTAYASYIIELTDKATEERRPNPYLFELLLQTLTYMN 138

Query: 123 IPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEK 182
                  +    E+ LL   G    L  C + G  +     S   GG +C         +
Sbjct: 139 EGLDAEVLTYIYEMKLLPAFGLYPKLDGCAICGEKEGTFAFSIAQGGFLCHRCFEHDPHR 198

Query: 183 MLVLPSFL 190
           + + PS L
Sbjct: 199 IPMTPSVL 206


>gi|152980172|ref|YP_001353062.1| DNA repair protein RecO [Janthinobacterium sp. Marseille]
 gi|151280249|gb|ABR88659.1| RecO DNA repair protein [Janthinobacterium sp. Marseille]
          Length = 287

 Score =  102 bits (256), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 52/246 (21%), Positives = 85/246 (34%), Gaps = 29/246 (11%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQ--SHRMQPILQAGNLVRVNWRSRLA 63
              +L    Y E ++I++V +R +GR     +  +    +++ +LQ    + V W  +  
Sbjct: 59  PGFVLHSYPYKETSLIVDVFSRDHGRIALVAKGAKRPHSKLRGVLQTFQPLSVGWSGK-- 116

Query: 64  QNLGEFRFEVLESHCAKL------LSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
                   EV     A+       L  S  L G      L + L   +P   L+D     
Sbjct: 117 -------AEVRTLTAAEWVGGLLPLEKSALLCGFYLNELLVKLLARDDPHPALFDHYVSA 169

Query: 118 LNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDL--LWV-SPKSGGAVCRS 174
           LN          +  + E  LLK  G   D   C  +G    L  ++V  P+ G    R 
Sbjct: 170 LNQLAHDEPAPIVLRKFERALLKETGVASDWRVCTASGKAIVLEQIYVLDPERGPRPARP 229

Query: 175 VGLPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLT-DYFLNKYALQHNIIHCHLLRENFL 233
                     V P    K    ++ +        T   FL ++ L H++    L     L
Sbjct: 230 AD--------VWPRVSGKTLLDMENEDYTDTQTQTQSKFLMRFLLAHHLNGAPLNTRQIL 281

Query: 234 GKLLEL 239
             LL+L
Sbjct: 282 IDLLQL 287


>gi|329912352|ref|ZP_08275733.1| DNA recombination and repair protein RecO [Oxalobacteraceae
           bacterium IMCC9480]
 gi|327545639|gb|EGF30797.1| DNA recombination and repair protein RecO [Oxalobacteraceae
           bacterium IMCC9480]
          Length = 264

 Score =  102 bits (254), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 32/157 (20%), Positives = 59/157 (37%), Gaps = 17/157 (10%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQ--SHRMQPILQAGNLVRVNWRSRLA 63
              +L    + E ++I++V TR++GR     +  +     ++ +LQ    + ++W  +  
Sbjct: 36  PGFVLHSYPHKETSLIIDVFTREHGRIALVAKGAKRPHSALRGVLQTFQPLSLSWTGKS- 94

Query: 64  QNLGEFRFEVLESHCAKL------LSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
                   E+     A+       L  S  L G      L + +   +P   L+D     
Sbjct: 95  --------EIRTLTAAEWVGGLLPLEKSALLCGFYLNELLVKLIARDDPHPGLFDHYVSA 146

Query: 118 LNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVT 154
           LN          +  + EL L+K  G   DL+ C  T
Sbjct: 147 LNQLAHGEAATIVLRKFELSLMKQTGVAADLSLCSGT 183


>gi|145588595|ref|YP_001155192.1| DNA repair protein RecO [Polynucleobacter necessarius subsp.
           asymbioticus QLW-P1DMWA-1]
 gi|254764653|sp|A4SVW4|RECO_POLSQ RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|145047001|gb|ABP33628.1| DNA replication and repair protein RecO [Polynucleobacter
           necessarius subsp. asymbioticus QLW-P1DMWA-1]
          Length = 244

 Score =  100 bits (249), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 50/227 (22%), Positives = 85/227 (37%), Gaps = 22/227 (9%)

Query: 5   DDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQ--SHRMQPILQAGNLVRVNWRSRL 62
           + A +L    Y E ++IL+V TRQ+GR     +  +     ++P+LQ    + V+W  + 
Sbjct: 9   EPAFVLHSIPYKETSLILDVFTRQHGRMALIAKGAKRPHSVLRPVLQRFQPLLVSWSGKS 68

Query: 63  AQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDM----LNIFL 118
              L              L+  +L L G      L +FL   +    LYD     +N   
Sbjct: 69  E--LRTLTKSEWVGGMPSLVGDAL-LCGFYLNELLVKFLAREDDYERLYDRYSETINALS 125

Query: 119 NCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTG---VTQDLLWVSPKSG-GAVCRS 174
           N       + +I    EL LL+  G+   L +CV T    V + L    P+ G   +   
Sbjct: 126 NLEFESKGLEEILRPFELSLLQETGYAAALDRCVETNDSPVFEALYVYQPERGVRPIQVD 185

Query: 175 VGLPYA----EKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYA 217
               +     + +L             D ++L  + QL  + L  + 
Sbjct: 186 DPGHWPVLRGKSLLA-----IAAGDFSDPETLSESKQLMRFLLGLHL 227


>gi|251796249|ref|YP_003010980.1| DNA repair protein RecO [Paenibacillus sp. JDR-2]
 gi|247543875|gb|ACT00894.1| DNA repair protein RecO [Paenibacillus sp. JDR-2]
          Length = 249

 Score = 99.8 bits (248), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 41/182 (22%), Positives = 69/182 (37%), Gaps = 11/182 (6%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQ--SHRMQPILQA---GNLVR 55
           M ++ + I++    YGE N I+ ++T+  G+    VR  +    R   + Q    G  V 
Sbjct: 1   MLYRVEGIVIRSMDYGEGNKIITLLTKTNGKLGVMVRGAKKVKSRHASLAQPFTYGEFVF 60

Query: 56  VNWRSRLAQNLGEFRF-EVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDML 114
                   + LG     E+LESH        L  Y         + L E E    L++ L
Sbjct: 61  FR-----NKGLGTLNAGEILESHHLLREQLDLAAYASYLAELTDKMLQEDESGAMLFEQL 115

Query: 115 NIFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRS 174
              L   +       +    E+ +L+  G+  +L  CV     Q    ++P +GG +C  
Sbjct: 116 KAGLAAMEEGKDPQIVSHLFEMRILEAAGYAPELEICVNCSSEQGPFRLNPHAGGVLCTR 175

Query: 175 VG 176
             
Sbjct: 176 CA 177


>gi|304398618|ref|ZP_07380490.1| DNA repair protein RecO [Pantoea sp. aB]
 gi|304353829|gb|EFM18204.1| DNA repair protein RecO [Pantoea sp. aB]
          Length = 242

 Score = 99.8 bits (248), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 42/174 (24%), Positives = 72/174 (41%), Gaps = 22/174 (12%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVN 57
           M  WQ  A +L  R + E +++L++ +   GR     +  +S R  ++  LQ    + V 
Sbjct: 1   MEGWQ-RAFVLHSRPFSETSLLLDLFSESEGRVRVLAKGARSRRSNLKGALQPFTPLLVR 59

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLF------RFLPEREPCLELY 111
           W  R          EV     A+ +S +L L G+     L+      R L +  P  EL+
Sbjct: 60  WSGR---------GEVKTLRNAEAVSLALPLSGITLYCGLYVNELVSRVLQQESPFPELF 110

Query: 112 DMLNIFLNCHKIPSVIGK-IFVQIELMLLKNIGFGLDLTKCVVTG--VTQDLLW 162
                 L          +    + EL LL ++G+G+D   C  +G  V+ D+ +
Sbjct: 111 FDYLNCLQALASTHGKPEPALRRFELALLGHLGYGVDFLHCAGSGEPVSDDMTY 164


>gi|171463194|ref|YP_001797307.1| DNA repair protein RecO [Polynucleobacter necessarius subsp.
           necessarius STIR1]
 gi|254764652|sp|B1XTL6|RECO_POLNS RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|171192732|gb|ACB43693.1| DNA repair protein RecO [Polynucleobacter necessarius subsp.
           necessarius STIR1]
          Length = 244

 Score = 99.1 bits (246), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 41/154 (26%), Positives = 65/154 (42%), Gaps = 9/154 (5%)

Query: 5   DDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQ--SHRMQPILQAGNLVRVNWRSRL 62
           + A +L    Y E ++IL+V TRQYGR     +  +     ++P+LQ    + V+W  + 
Sbjct: 9   EPAFVLHSIPYKETSLILDVFTRQYGRMALIAKGAKRQHSTLRPVLQRFQPLLVSWSGKS 68

Query: 63  AQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDM----LNIFL 118
              L              L+  +L L G      L +FL   +   +LYD     +N   
Sbjct: 69  E--LRTLTKSEWVGGMPSLVGDAL-LCGFYLNELLVKFLAREDDYEKLYDRYAETINALS 125

Query: 119 NCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCV 152
           N       + +I  Q EL LL+  G+   L +CV
Sbjct: 126 NLEFESKGLEEILRQFELSLLQETGYAAALDRCV 159


>gi|52081074|ref|YP_079865.1| DNA repair protein RecO [Bacillus licheniformis ATCC 14580]
 gi|52786454|ref|YP_092283.1| DNA repair protein RecO [Bacillus licheniformis ATCC 14580]
 gi|319644967|ref|ZP_07999200.1| DNA repair protein recO [Bacillus sp. BT1B_CT2]
 gi|81609046|sp|Q65H74|RECO_BACLD RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|52004285|gb|AAU24227.1| RecO [Bacillus licheniformis ATCC 14580]
 gi|52348956|gb|AAU41590.1| RecO [Bacillus licheniformis ATCC 14580]
 gi|317392776|gb|EFV73570.1| DNA repair protein recO [Bacillus sp. BT1B_CT2]
          Length = 256

 Score = 97.9 bits (243), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 42/198 (21%), Positives = 78/198 (39%), Gaps = 14/198 (7%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQS--HRMQPILQAGNLVRVNW 58
           M  + + I+L    YGE N I+ ++TR++G+     R  +    R+  I Q    +  ++
Sbjct: 1   MLTKCEGIVLRTNDYGETNKIITLLTREHGKIGVLARGAKKPNSRLSAISQP--FLYASF 58

Query: 59  RSRLAQNLGEF-RFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
             R +  LG   + E++ES         L  Y       + +   E++P   L+++L   
Sbjct: 59  LFRKSSGLGTLEQGEMIESMRNIREDLFLTAYAAYIAELIDKGTEEKKPNPFLFELLLQS 118

Query: 118 LNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRS--V 175
           +      +    I   IE+ +L  +G   +L +CV           S +  G +C     
Sbjct: 119 MRRLNDGTDPDIIANLIEVKMLSVMGLYPELDECVHCKSKDGTFHFSIRDNGFICHRCFA 178

Query: 176 GLPYA-------EKMLVL 186
             PY         ++L L
Sbjct: 179 KDPYRIPLSPASARLLRL 196


>gi|308187804|ref|YP_003931935.1| DNA repair protein recO (Recombination protein O) [Pantoea vagans
           C9-1]
 gi|308058314|gb|ADO10486.1| DNA repair protein recO (Recombination protein O) [Pantoea vagans
           C9-1]
          Length = 259

 Score = 97.5 bits (242), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 42/174 (24%), Positives = 70/174 (40%), Gaps = 22/174 (12%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVN 57
           M  WQ  A +L  R + E +++L++ +   GR     +  +S R  ++  LQ    + V 
Sbjct: 18  MEGWQ-RAFVLHSRPFSETSLLLDLFSENEGRVRVLAKGARSRRSQLKGALQPFTPLLVR 76

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLF------RFL-PEREPCLEL 110
           W  R           V     A+ +S +L L G+     L+      R L PE       
Sbjct: 77  WSGRGD---------VKTLRNAEAVSLALPLSGITLYCGLYVNELVSRVLQPESPFQELF 127

Query: 111 YDMLNIFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTG--VTQDLLW 162
           +D LN                 + EL LL ++G+G+D   C  +G  V+ D+ +
Sbjct: 128 FDYLNCLQALASTHGKPEPALRRFELALLGHLGYGVDFLHCAGSGEPVSDDMTY 181


>gi|157371902|ref|YP_001479891.1| DNA repair protein RecO [Serratia proteamaculans 568]
 gi|166918732|sp|A8GI23|RECO_SERP5 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|157323666|gb|ABV42763.1| DNA repair protein RecO [Serratia proteamaculans 568]
          Length = 243

 Score = 97.5 bits (242), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 41/164 (25%), Positives = 65/164 (39%), Gaps = 18/164 (10%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNW 58
           M   + A +L  R Y E +++L++ T  +GR     +  +S R  ++  LQ    + V W
Sbjct: 1   MDGWERAFVLHGRPYSETSLMLDMFTEGHGRVRLLAKGARSRRSNLKGCLQPFTPLLVRW 60

Query: 59  RSRLAQNLGEFRFEVLESHCAKLLSSSLFL------YGLQSIVPLFRFLPEREPCLELYD 112
             R          EV     A+ +S  L L       GL     L R L +      L+ 
Sbjct: 61  GGR---------GEVKTLRSAEAVSLGLPLSGMMLYSGLYVNELLSRVLEQEANYSVLFF 111

Query: 113 MLNIFLNCHKIPSVIGKIFVQ-IELMLLKNIGFGLDLTKCVVTG 155
                L       V  +  ++  EL LL ++G+GLD   C  +G
Sbjct: 112 DYLQCLQALAAEDVSPEQALRQFELALLNHLGYGLDFLHCAGSG 155


>gi|56421021|ref|YP_148339.1| DNA repair protein RecO [Geobacillus kaustophilus HTA426]
 gi|261418496|ref|YP_003252178.1| DNA repair protein RecO [Geobacillus sp. Y412MC61]
 gi|319767543|ref|YP_004133044.1| DNA repair protein RecO [Geobacillus sp. Y412MC52]
 gi|61214670|sp|Q5KX15|RECO_GEOKA RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|56380863|dbj|BAD76771.1| DNA repair protein (recombination protein O) [Geobacillus
           kaustophilus HTA426]
 gi|261374953|gb|ACX77696.1| DNA repair protein RecO [Geobacillus sp. Y412MC61]
 gi|317112409|gb|ADU94901.1| DNA repair protein RecO [Geobacillus sp. Y412MC52]
          Length = 262

 Score = 97.1 bits (241), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 38/187 (20%), Positives = 71/187 (37%), Gaps = 10/187 (5%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQ--SHRMQPILQA---GNLVRVNWRS 60
           +AI++    YGE N I+ + TR++G+     R  +  S R+  + Q    G+ V    R 
Sbjct: 6   EAIVMRTVDYGETNKIVTLFTREWGKVAAMARGAKKPSSRLSAVTQPLSYGHYVIRRSRG 65

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
               + G    E+++S  A         Y +  +    +   E++    L+++L   L  
Sbjct: 66  VGVLHQG----ELIDSMRALREDLFAAAYAVYIVELTDKSTEEQKRNPYLFELLLQTLQY 121

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
                 +  +    E+ +L  +G    L +C   G T+     S K  G +C        
Sbjct: 122 MSEGRDLEILTFIYEMKMLAVLGIPPVLDRCARCGATEGRFSFSVKEAGFLCHRCEASDP 181

Query: 181 EKMLVLP 187
            +   L 
Sbjct: 182 HR-FPLS 187


>gi|270265298|ref|ZP_06193559.1| hypothetical protein SOD_m00300 [Serratia odorifera 4Rx13]
 gi|270040702|gb|EFA13805.1| hypothetical protein SOD_m00300 [Serratia odorifera 4Rx13]
          Length = 243

 Score = 97.1 bits (241), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 40/165 (24%), Positives = 65/165 (39%), Gaps = 18/165 (10%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNW 58
           M   + A +L  R Y E +++L++ T  +GR     +  +S R  ++  LQ    + V W
Sbjct: 1   MDGWERAFVLHGRPYSETSLMLDMFTEGHGRVRLLAKGARSRRSNLKGCLQPFTPLLVRW 60

Query: 59  RSRLAQNLGEFRFEVLESHCAKLLSSSLFL------YGLQSIVPLFRFLPEREPCLELYD 112
             R          EV     A+ +S  L L       GL     L R L +      L+ 
Sbjct: 61  GGR---------GEVKTLRNAEAVSLGLPLSGMMLYSGLYVNELLSRVLEQEANYSVLFF 111

Query: 113 MLNIFLNCHKIPSVIGKIFVQ-IELMLLKNIGFGLDLTKCVVTGV 156
                L       +  +  ++  EL LL ++G+GLD   C  +G 
Sbjct: 112 DYLQCLQALAAEDISPEQALRQFELALLNHLGYGLDFLHCAGSGQ 156


>gi|332975859|gb|EGK12737.1| recombination protein O [Desmospora sp. 8437]
          Length = 250

 Score = 96.7 bits (240), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 43/198 (21%), Positives = 77/198 (38%), Gaps = 19/198 (9%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQS--HRMQPILQA---GNLVR 55
           M  + + +++  R YGE + ++ + T+ +G++    R  +    R+  + Q    G  + 
Sbjct: 1   MLEKLEGVVIRTRDYGESHKVVILFTKAHGKYAVMARGAKKPKSRLAAVTQPFTSGEYLC 60

Query: 56  VNWRSRLAQNLGEFRF---EVLESHCAKLLSSSL--FLYGLQSIVPLFRFLPEREPCLEL 110
                      G       ++LES    LL S L    Y       L +   E+EP L +
Sbjct: 61  FTGS-------GMATLSQGDILESR--HLLRSDLVRASYAAYWTELLDKLKEEKEPDLPV 111

Query: 111 YDMLNIFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGA 170
           Y  L   LN  +       +    EL +L++ G+   L  CV  G     +  S + GG 
Sbjct: 112 YIWLETVLNLLEEGVDPEILSRIFELKVLESAGYRPRLQGCVQCGGADTPVKFSIRQGGF 171

Query: 171 VCRSVGLPYAEKMLVLPS 188
           +C        E + + P+
Sbjct: 172 LCSGCSHRDPEALFLSPA 189


>gi|73541937|ref|YP_296457.1| DNA repair protein RecO [Ralstonia eutropha JMP134]
 gi|119361473|sp|Q46Z20|RECO_RALEJ RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|72119350|gb|AAZ61613.1| DNA replication and repair protein RecO [Ralstonia eutropha JMP134]
          Length = 291

 Score = 96.7 bits (240), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 34/154 (22%), Positives = 61/154 (39%), Gaps = 5/154 (3%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQ--SHRMQPILQAGNLVRVNWRSRLA 63
              +L    Y E ++IL+V TR +GR     +  +     ++P+LQ  + + ++W  R  
Sbjct: 61  PGFVLHAWPYRETSLILDVFTRDHGRLSMVAKGAKRPHSALRPVLQHFHPISLSWSGR-G 119

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKI 123
           +     R E +         + L  + L  +  L RF P  +    L+      L     
Sbjct: 120 EVKTLTRAEWVGGMPPLAGDALLSAFYLNEL--LMRFCPREDGHPALFRHYMATLTRLAH 177

Query: 124 PSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVT 157
               G +    E +LL+  GF +   +C+ TG  
Sbjct: 178 GEAAGLVLRSFERVLLQETGFAVAFDQCLSTGER 211


>gi|134095251|ref|YP_001100326.1| DNA repair protein RecO [Herminiimonas arsenicoxydans]
 gi|133739154|emb|CAL62203.1| DNA repair protein recO (Recombination protein O) [Herminiimonas
           arsenicoxydans]
          Length = 284

 Score = 96.7 bits (240), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 50/246 (20%), Positives = 86/246 (34%), Gaps = 29/246 (11%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQ--SHRMQPILQAGNLVRVNWRSRLA 63
              +L    Y E ++I++V TR +GR     +  +    +++ +LQ    + V+W  +  
Sbjct: 56  PGFVLHSYPYKETSLIVDVFTRDHGRIALVAKGAKRPHSKLRGVLQTFQPLSVSWSGK-- 113

Query: 64  QNLGEFRFEVLESHCAKL------LSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
                   EV     A+       L  S  L G      L + L   +    L++     
Sbjct: 114 -------AEVRTLTSAEWVGGLLPLEKSALLCGFYLNELLVKLLARDDSHPALFNHYVSA 166

Query: 118 LNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVT--GVTQDLLW-VSPKSGGAVCRS 174
           LN          +  + E  LLK  G   D   C  T   +   + + V P+ G    R 
Sbjct: 167 LNQLAHDEPAAIVLRKFERALLKESGVSGDWKICTATRNPLLGGINYVVDPERGPRPARP 226

Query: 175 VGLPYAEKMLVLPSFLWKEEQTIDADSLKS-AFQLTDYFLNKYALQHNIIHCHLLRENFL 233
               +       P    K    ++ +     A Q+   FL ++ L H++    L     L
Sbjct: 227 A-DTW-------PHVAGKTLLDMEKEDYSDAATQMQSKFLMRFLLAHHLNGAPLNTRQIL 278

Query: 234 GKLLEL 239
             LL+L
Sbjct: 279 IDLLQL 284


>gi|113868515|ref|YP_727004.1| DNA repair protein RecO [Ralstonia eutropha H16]
 gi|113527291|emb|CAJ93636.1| combinational DNA repair protein (RecF pathway) [Ralstonia eutropha
           H16]
          Length = 297

 Score = 96.7 bits (240), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 36/162 (22%), Positives = 63/162 (38%), Gaps = 7/162 (4%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQ--SHRMQPILQAGNLVRVNWRSRLA 63
              +L    Y E ++IL++ TR YGR     +  +     ++ +LQ  + V V+W  R  
Sbjct: 67  PGFVLHAWPYRETSLILDLFTRDYGRISMVAKGAKRPHSALRAVLQHFHPVSVSWSGR-G 125

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKI 123
           +     + E +         + L  + L  +  L RF P  +    L+      L     
Sbjct: 126 EVKTLTKAEWVGGMPPLAGDALLSAFYLNEL--LMRFCPREDAHPALFRHYLTTLTRLAH 183

Query: 124 PSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVT--QDLLWV 163
               G +    E +LL+  GF +   +C+ TG      L +V
Sbjct: 184 GEQAGLVLRSFERVLLQETGFAVAFDQCLSTGERVQPGLDYV 225


>gi|194290150|ref|YP_002006057.1| DNA repair protein reco [Cupriavidus taiwanensis LMG 19424]
 gi|193223985|emb|CAQ69994.1| DNA repair protein [Cupriavidus taiwanensis LMG 19424]
          Length = 295

 Score = 96.4 bits (239), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 37/162 (22%), Positives = 63/162 (38%), Gaps = 7/162 (4%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQ--SHRMQPILQAGNLVRVNWRSRLA 63
              +L    Y E ++IL+V TR YGR     +  +     ++ +LQ  + V V+W  R  
Sbjct: 65  PGFVLHAWPYRETSLILDVFTRDYGRLSMVAKGAKRPHSALRAVLQHFHPVSVSWSGR-G 123

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKI 123
           +     + E +         + L  + L  +  L RF P  +    L+      L     
Sbjct: 124 EVKTLTKAEWVGGMPPLAGDALLSAFYLNEL--LMRFCPREDAHPVLFRHYLSTLTRLAH 181

Query: 124 PSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVT--QDLLWV 163
               G +    E +LL+  GF +   +C+ TG      L +V
Sbjct: 182 GEPAGLVLRSFERVLLQETGFAVAFDQCLSTGERVQAGLDYV 223


>gi|163802960|ref|ZP_02196847.1| DNA repair protein RecO [Vibrio sp. AND4]
 gi|159173250|gb|EDP58078.1| DNA repair protein RecO [Vibrio sp. AND4]
          Length = 243

 Score = 96.0 bits (238), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 35/157 (22%), Positives = 62/157 (39%), Gaps = 17/157 (10%)

Query: 8   IILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNWRSRLAQN 65
            +L  R Y E ++IL+V + +YGR     +  +S R  ++  LQ    + + W  + +  
Sbjct: 13  FVLHRRPYSESSLILDVFSEEYGRVTLMAKGARSKRSNLKGALQPFTPLLLKWSGKSS-- 70

Query: 66  LGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLF------RFLPEREPCLELYDMLNIFLN 119
                  +     A+ +S  L L+G+     ++      R L    P   L+      L 
Sbjct: 71  -------MKTLRQAEAISLGLPLFGINLYSAMYVNELVGRVLMAEVPMPALFHDYLHALT 123

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGV 156
                        + EL LL ++G+G+D   C  TG 
Sbjct: 124 ELAQNDNPEPALRRFELALLSSLGYGVDFLHCAGTGE 160


>gi|300724128|ref|YP_003713445.1| gap repair protein [Xenorhabdus nematophila ATCC 19061]
 gi|297630662|emb|CBJ91327.1| gap repair protein, part of RecFOR complex that targets RecA to
           ssDNA-dsDNA junction [Xenorhabdus nematophila ATCC
           19061]
          Length = 245

 Score = 96.0 bits (238), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 41/171 (23%), Positives = 66/171 (38%), Gaps = 21/171 (12%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNWRS 60
           WQ  A +L  R Y E +++L+  T   GR     +  +S R  ++  LQ    + + W  
Sbjct: 4   WQ-RAFVLHGRPYSETSLLLDFFTENEGRVRVLAKGVRSRRSHLKGCLQPFTPLLIRWSG 62

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLY------GLQSIVPLFRFLPEREPCLELYDML 114
           R          E+     A+ +S +L L       GL     L R L +      L+   
Sbjct: 63  R---------GEIKTLRDAEPISLALPLAGSVLYSGLYVNELLSRVLEQGTAYPALFFDY 113

Query: 115 NIFLNCHKIPSVIGK-IFVQIELMLLKNIGFGLDLTKCVVTG--VTQDLLW 162
              L          +    + EL LL +IG+G+D   C  +G  VT  + +
Sbjct: 114 LQCLQALAASDRTPEYALRRFELALLTSIGYGVDYLHCAGSGESVTDTMTY 164


>gi|317049178|ref|YP_004116826.1| DNA repair protein RecO [Pantoea sp. At-9b]
 gi|316950795|gb|ADU70270.1| DNA repair protein RecO [Pantoea sp. At-9b]
          Length = 242

 Score = 95.6 bits (237), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 41/169 (24%), Positives = 69/169 (40%), Gaps = 20/169 (11%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVN 57
           M  WQ  A +L  R Y E +++L++ +   GR     +  +S R  ++  LQ    + V 
Sbjct: 1   MEGWQ-RAFVLHSRPYSETSLLLDLFSESEGRVRVLAKGARSRRSQLKGALQPFTPLLVR 59

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLF------RFLPEREPCLELY 111
           W  R          EV     A+ +S +L L G+     L+      R L +  P  +L+
Sbjct: 60  WGGR---------GEVKTLRNAEAVSLALPLSGITLYCGLYVNELLSRVLEQEIPFSDLF 110

Query: 112 DMLNIFLNCHKIPSVIGK-IFVQIELMLLKNIGFGLDLTKCVVTGVTQD 159
                 +      S   +    + EL LL ++G+G+D   C  +G   D
Sbjct: 111 FDYLNCIQALAAASGTPEPALRRFELALLGHLGYGVDFLHCAGSGEEVD 159


>gi|297529348|ref|YP_003670623.1| DNA repair protein RecO [Geobacillus sp. C56-T3]
 gi|297252600|gb|ADI26046.1| DNA repair protein RecO [Geobacillus sp. C56-T3]
          Length = 262

 Score = 94.8 bits (235), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 38/187 (20%), Positives = 70/187 (37%), Gaps = 10/187 (5%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQ--SHRMQPILQA---GNLVRVNWRS 60
           +AI++    YGE N I+ + TR++G+     R  +  S R+  + Q    G+ V    R 
Sbjct: 6   EAIVMRTVDYGETNKIVTLFTREWGKVAAMARGAKKPSSRLSAVTQPLSYGHYVIRRSRG 65

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
               + G    E+++S  A         Y +  +    +   E++    L+++L   L  
Sbjct: 66  VGVLHQG----ELIDSMRALREDLFAAAYAVYIVELTDKSTEEQKRNPYLFELLLQTLQY 121

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
                 +  +    E  +L  +G    L +C   G T+     S K  G +C        
Sbjct: 122 MSEGRDLEILTFIYETKMLAVLGIPPVLDRCARCGATEGRFSFSVKEAGFLCHRCEASDP 181

Query: 181 EKMLVLP 187
            +   L 
Sbjct: 182 HR-FPLS 187


>gi|288555747|ref|YP_003427682.1| DNA repair protein RecO [Bacillus pseudofirmus OF4]
 gi|288546907|gb|ADC50790.1| DNA repair protein RecO [Bacillus pseudofirmus OF4]
          Length = 251

 Score = 94.4 bits (234), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 36/178 (20%), Positives = 70/178 (39%), Gaps = 6/178 (3%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQS--HRMQPILQAGNLVRVNW 58
           M  + +AI++    YGE N I+ + TR+ G+     R  +    R+  I Q        +
Sbjct: 1   MQ-KVEAIVIRTNDYGESNKIVTLFTRESGKVGVMARGAKKPKSRLAAISQLFIHGLYLF 59

Query: 59  RSRLAQNLGEF-RFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
           +   +  LG   + E++ S+        L  Y    +  + +   E++P   L+ +L   
Sbjct: 60  QK--SNGLGTLNQAEMIHSYKEVRNDLFLASYATYVVELIDKLTEEKQPNEPLFHLLQQT 117

Query: 118 LNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSV 175
           L           +    E+ +++  G   +L +C   G T+     S K  G +C+  
Sbjct: 118 LLYLDEGIDPEVLLRIFEMKMMQVAGITPELDQCTNCGSTEVPSGFSIKEAGFLCKKC 175


>gi|297617860|ref|YP_003703019.1| DNA repair protein RecO [Syntrophothermus lipocalidus DSM 12680]
 gi|297145697|gb|ADI02454.1| DNA repair protein RecO [Syntrophothermus lipocalidus DSM 12680]
          Length = 250

 Score = 94.1 bits (233), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 45/255 (17%), Positives = 98/255 (38%), Gaps = 37/255 (14%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQS--HRMQPILQA----------GNL 53
           +AI+L  + + E + I+    R+ G+     +  +     ++  +Q           G  
Sbjct: 8   EAIVLKNQDFIETDKIVTFFARREGKLRAVAKGIKKPNSSLRGAVQPFCFSCLHLSRGRE 67

Query: 54  VRVNWRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDM 113
           + +  + R+ +  G  R +++++           L+ L  +  L + L E +P  E++D 
Sbjct: 68  LDLITQGRIIEFFGYVRDDMVKT-----------LHSLYLMELLDKSLAEADPHPEVFDA 116

Query: 114 LNIFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCR 173
               L C +            EL L + +G+ L L KC++ G  + ++ +S K GG +C 
Sbjct: 117 TLTVLRCLEDGPFSPLAVRWFELKLARELGYALGLQKCILCGRGKAVV-LSIKDGGVLCD 175

Query: 174 SVGLPYAEKM-LVLPSFLWKEEQTIDADSL---------KSAFQLTDYFLNKYA---LQH 220
                  + +   L   LW   + ++   +           A ++ +  L ++    L H
Sbjct: 176 RCNRASTDNLIFALDGELWALLRDLEQKDVSFLQRVKPSARALRVAEQILERHLEYHLGH 235

Query: 221 NIIHCHLLRENFLGK 235
                 ++R     K
Sbjct: 236 RFNTKSVIRNLLEDK 250


>gi|291618444|ref|YP_003521186.1| RecO [Pantoea ananatis LMG 20103]
 gi|291153474|gb|ADD78058.1| RecO [Pantoea ananatis LMG 20103]
 gi|327394840|dbj|BAK12262.1| DNA repair protein RecO [Pantoea ananatis AJ13355]
          Length = 245

 Score = 94.1 bits (233), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 39/166 (23%), Positives = 67/166 (40%), Gaps = 20/166 (12%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVN 57
           M  WQ  A +L  R + E +++L++ +   GR     +  +S R  ++  LQ    + V 
Sbjct: 1   MEGWQ-RAFVLHSRPFSETSLLLDLFSESEGRVRVLAKGARSRRSQLKGTLQPFTPLLVR 59

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLF------RFLPEREPCLELY 111
           W  R          EV     A+ +S +L L G+     L+      R L +  P  EL+
Sbjct: 60  WSGR---------GEVKTLRNAEAVSLALPLSGITLYCGLYVNELLSRVLEQHIPFSELF 110

Query: 112 DMLNIFLNCHKIPSVIGK-IFVQIELMLLKNIGFGLDLTKCVVTGV 156
                 +          +    + EL LL ++G+G+D   C  +G 
Sbjct: 111 FDYLQCIQMLAAGEGSPEPALRRFELALLGHLGYGVDFLHCAGSGE 156


>gi|186475608|ref|YP_001857078.1| DNA repair protein RecO [Burkholderia phymatum STM815]
 gi|184192067|gb|ACC70032.1| DNA repair protein RecO [Burkholderia phymatum STM815]
          Length = 336

 Score = 94.1 bits (233), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 37/185 (20%), Positives = 71/185 (38%), Gaps = 22/185 (11%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQ--SHRMQPILQAGNLVRVNWRSRLA 63
            A +L    Y E ++I++V++R +GR     +  +     ++ +LQ    + +NW  +  
Sbjct: 107 PAFVLHSYPYRETSLIIDVLSRDHGRIALVAKGAKRPHSALRGVLQTFQPLSLNWSGKS- 165

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVP------LFRFLPEREPCLELYDMLNIF 117
                   E+     A+ +   L L G   +        L +FL   +P  +L+    + 
Sbjct: 166 --------EMRTLTGAEWVGGMLPLTGDALLCGFYVNELLVKFLAREDPHPQLFHHYVVT 217

Query: 118 LNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVT-GVTQDLLWV-SPKSGGAVCRSV 175
           L          ++    E +LL+  G+ + L + V    V  D  +V  P+ G    R  
Sbjct: 218 LTRLAHDEPPVQVLRSFERVLLRETGYAMSLNRTVARKAVVPDGRYVFDPERG---VREA 274

Query: 176 GLPYA 180
              Y 
Sbjct: 275 SDEYP 279


>gi|88812351|ref|ZP_01127601.1| Recombination protein O, RecO [Nitrococcus mobilis Nb-231]
 gi|88790358|gb|EAR21475.1| Recombination protein O, RecO [Nitrococcus mobilis Nb-231]
          Length = 249

 Score = 94.1 bits (233), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 36/147 (24%), Positives = 61/147 (41%), Gaps = 5/147 (3%)

Query: 5   DDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRL 62
           + A +L  R+Y E + I E+ T ++GR     R  +S R   + +LQ    + V+W++R 
Sbjct: 11  EPAYVLHRRAYRESSAIAELFTAEHGRLGVVARGVRSSRSRWRALLQPFTPLSVSWQARG 70

Query: 63  AQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHK 122
              LG      L+   + L +    + G      L R L   +P  EL+      +    
Sbjct: 71  D--LGTLTDVELQWR-STLPTGRRLVSGFYLNELLLRVLQREDPYPELFQCYAGAVLMLA 127

Query: 123 IPSVIGKIFVQIELMLLKNIGFGLDLT 149
                  +    E  LL  +G+GL L+
Sbjct: 128 SRGAEQPLLRCFERDLLAAMGYGLLLS 154


>gi|290476132|ref|YP_003469032.1| gap repair protein [Xenorhabdus bovienii SS-2004]
 gi|289175465|emb|CBJ82268.1| gap repair protein, part of RecFOR complex that targets RecA to
           ssDNA-dsDNA junction [Xenorhabdus bovienii SS-2004]
          Length = 245

 Score = 93.7 bits (232), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 40/161 (24%), Positives = 62/161 (38%), Gaps = 15/161 (9%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNWRS 60
           WQ  A +L  R Y E +++L+  T   GR     +  +  R  ++  LQ    + V W  
Sbjct: 4   WQ-RAFVLHGRPYSETSLLLDFFTENEGRVRVLAKGVRRRRSHLKGCLQPFTPLLVRWSG 62

Query: 61  RLAQNLGEFRF----EVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNI 116
           R     GE +     E +    A  L+ S+   GL     L R L +      L+     
Sbjct: 63  R-----GEIKILRDAEPISL--ALPLTGSVLYSGLYVNELLSRVLEQGAAYPALFFDYLQ 115

Query: 117 FLNCHKIPSVIGK-IFVQIELMLLKNIGFGLDLTKCVVTGV 156
            L          +    + EL LL N+G+G+D   C  +G 
Sbjct: 116 CLQILAASEYTPEYALRRFELALLTNMGYGVDYLHCAGSGE 156


>gi|253988788|ref|YP_003040144.1| DNA repair protein RecO [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|253780238|emb|CAQ83399.1| dna repair protein reco (recombination protein o) [Photorhabdus
           asymbiotica]
          Length = 241

 Score = 93.7 bits (232), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 42/171 (24%), Positives = 66/171 (38%), Gaps = 21/171 (12%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNWRS 60
           WQ  A IL  R Y E +++L++ T   GR     +  +S R  ++  LQ    + + W  
Sbjct: 4   WQ-RAFILHRRPYSETSLLLDLFTENEGRISVLAKGARSRRSNLKGCLQPFTPLLIRWSG 62

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFL------YGLQSIVPLFRFLPEREPCLELYDML 114
           R           V     A  +S +L L       GL     L R L +      L+   
Sbjct: 63  RGV---------VKTLRDADPISLTLPLTGSVLYSGLYVNELLSRVLEQGTAYPALFFDY 113

Query: 115 NIFLNCHKIPSVIGKIFV-QIELMLLKNIGFGLDLTKCVVTG--VTQDLLW 162
              L          +  + + EL LL N+G+G+D   C  +G  VT  + +
Sbjct: 114 LQCLQVLAASEYTPEHALRRFELALLANLGYGVDYLHCAGSGEPVTDTMTY 164


>gi|196248953|ref|ZP_03147653.1| DNA repair protein RecO [Geobacillus sp. G11MC16]
 gi|196211829|gb|EDY06588.1| DNA repair protein RecO [Geobacillus sp. G11MC16]
          Length = 258

 Score = 93.7 bits (232), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 35/185 (18%), Positives = 66/185 (35%), Gaps = 4/185 (2%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQ--SHRMQPILQAGNLVRVNWRSRLA 63
           +AI++    YGE N I+ + TR++G+     R  +  S R+  + Q         R    
Sbjct: 6   EAIVIRAIDYGETNKIVTLFTREWGKVAAMARGAKKPSSRLSAVTQPLAYGHYLIRRSRG 65

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKI 123
             L   + E+++S            Y    +    +   E++    L+++L   L     
Sbjct: 66  VGL-LHQGELIDSMRVLREDLFAAAYAAYIVELTDKSTEEQKRNPYLFELLLQTLQYMSE 124

Query: 124 PSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKM 183
              +  +    E+ +L  +G    L +C   G T+     S K  G +C         + 
Sbjct: 125 GRDLEIMTFIYEMKMLSVLGIPPVLDRCARCGATEGRFSFSVKEAGFLCHRCEAADPHR- 183

Query: 184 LVLPS 188
             L  
Sbjct: 184 FPLSP 188


>gi|300717985|ref|YP_003742788.1| DNA repair protein [Erwinia billingiae Eb661]
 gi|299063821|emb|CAX60941.1| DNA repair protein [Erwinia billingiae Eb661]
          Length = 244

 Score = 93.7 bits (232), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 41/174 (23%), Positives = 70/174 (40%), Gaps = 22/174 (12%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVN 57
           M  WQ  A +L  R Y E +++L++ +  YGR     +  +  R  ++  LQ    + V 
Sbjct: 1   MEGWQ-RAFVLHGRPYSETSLLLDLFSENYGRIRVLAKGARGKRSSLKGALQPFTPLLVR 59

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLF------RFLPEREPCLELY 111
           W  R          EV     A+ +S +L L GL     L+      R L +     EL+
Sbjct: 60  WGGR---------GEVKTLRGAEPISLALPLSGLTLYCGLYVNELLSRVLEQETAFTELF 110

Query: 112 DMLNIFLNCHKIPSVIGK-IFVQIELMLLKNIGFGLDLTKCVVTG--VTQDLLW 162
                 L      +   +    + EL +L ++G+G+D   C  +G  V   + +
Sbjct: 111 FDYLYCLQALAAVTGSPEPALRRFELAMLGHLGYGVDFMHCAGSGEEVADGMTY 164


>gi|20807456|ref|NP_622627.1| recombinational DNA repair protein [Thermoanaerobacter
           tengcongensis MB4]
 gi|20515981|gb|AAM24231.1| Recombinational DNA repair protein [Thermoanaerobacter
           tengcongensis MB4]
          Length = 257

 Score = 93.7 bits (232), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 40/197 (20%), Positives = 78/197 (39%), Gaps = 21/197 (10%)

Query: 1   MYW-QDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPI-----LQAGNLV 54
           M + + +AI+L      EK+ I  + TR YG+     +  +  + + +         N V
Sbjct: 11  MRFLKTEAIVLKSNLISEKDKIATLFTRDYGKLQAVAKGARRSKSRFVNAVRPFIVANYV 70

Query: 55  RVNWRSRLAQNLGEFRF---EVLESHCAKLLSSSLFLYGLQSIVP--LFRFLPEREPCLE 109
                    +    +     E++++   + +   L  + L S +   + R L E++   +
Sbjct: 71  IF-------EGQNYYYIDQWELVKN--FENIEKDLKKFALASYISETISRVLEEKQKNTK 121

Query: 110 LYDMLNIFLNCHKIPSVIGKIFV-QIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSG 168
           LY      L   +  +V   IF+    L L+  +G+   L  C V G  ++L + S   G
Sbjct: 122 LYFFTKHSLEAVESLNVETSIFLFSYTLKLISLLGYMPVLDSCAVCGKKENLSYFSSSCG 181

Query: 169 GAVCRSVGLPYAEKMLV 185
           GAVC+       +   +
Sbjct: 182 GAVCKDCNETCKDAKFL 198


>gi|42559491|sp|Q8RB48|RECO_THETN RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
          Length = 247

 Score = 93.7 bits (232), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 40/197 (20%), Positives = 78/197 (39%), Gaps = 21/197 (10%)

Query: 1   MYW-QDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPI-----LQAGNLV 54
           M + + +AI+L      EK+ I  + TR YG+     +  +  + + +         N V
Sbjct: 1   MRFLKTEAIVLKSNLISEKDKIATLFTRDYGKLQAVAKGARRSKSRFVNAVRPFIVANYV 60

Query: 55  RVNWRSRLAQNLGEFRF---EVLESHCAKLLSSSLFLYGLQSIVP--LFRFLPEREPCLE 109
                    +    +     E++++   + +   L  + L S +   + R L E++   +
Sbjct: 61  IF-------EGQNYYYIDQWELVKN--FENIEKDLKKFALASYISETISRVLEEKQKNTK 111

Query: 110 LYDMLNIFLNCHKIPSVIGKIFV-QIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSG 168
           LY      L   +  +V   IF+    L L+  +G+   L  C V G  ++L + S   G
Sbjct: 112 LYFFTKHSLEAVESLNVETSIFLFSYTLKLISLLGYMPVLDSCAVCGKKENLSYFSSSCG 171

Query: 169 GAVCRSVGLPYAEKMLV 185
           GAVC+       +   +
Sbjct: 172 GAVCKDCNETCKDAKFL 188


>gi|329297707|ref|ZP_08255043.1| DNA repair protein RecO [Plautia stali symbiont]
          Length = 245

 Score = 93.7 bits (232), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 41/169 (24%), Positives = 69/169 (40%), Gaps = 20/169 (11%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQ--PILQAGNLVRVN 57
           M  WQ  A +L  R Y E +++L++ +   GR     +  +S R Q    LQ    + V 
Sbjct: 1   MEGWQ-RAFVLHSRPYSETSLLLDLFSESQGRVRVLAKGARSRRSQRKGALQPFTPLLVR 59

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLF------RFLPEREPCLELY 111
           W  R          EV     A+ +S +L L G+     L+      R L +  P  EL+
Sbjct: 60  WGGR---------GEVKTLRNAEAVSLALPLSGITLYCGLYVNELLSRVLEQEIPFSELF 110

Query: 112 DMLNIFLNCHKIPSVIGK-IFVQIELMLLKNIGFGLDLTKCVVTGVTQD 159
                 +    + +   +    + EL LL ++G+G++   C  +G   D
Sbjct: 111 FDYLSCIQTLAVANGSPEPALRRFELALLGHLGYGVNFLHCAGSGEAVD 159


>gi|239827757|ref|YP_002950381.1| DNA repair protein RecO [Geobacillus sp. WCH70]
 gi|259563679|sp|C5D4S3|RECO_GEOSW RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|239808050|gb|ACS25115.1| DNA repair protein RecO [Geobacillus sp. WCH70]
          Length = 263

 Score = 93.3 bits (231), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 38/180 (21%), Positives = 68/180 (37%), Gaps = 7/180 (3%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQ--SHRMQPILQAGNL-VRVNWRSRL 62
           +AI++    YGE N I+   TR++G+     R  +  S R+  + Q       +  RSR 
Sbjct: 6   EAIVIRAIDYGETNKIVTFFTREWGKVATMARGAKKPSSRLSAVTQPFTHGYYLIQRSRG 65

Query: 63  AQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHK 122
              L   + ++++S            Y    +    +   E++    L+++L   L    
Sbjct: 66  VGVL--HQGDIIDSMRTIREDIFTAAYASYIVEMTDKVTEEQQRNPYLFELLLQTLQYMN 123

Query: 123 IPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSV--GLPYA 180
               +  +    E+ +L  +G    L  C V G T+     S K  G +C       PY 
Sbjct: 124 EGLDLEILACIYEMKMLSVMGIPPKLDHCAVCGRTEGKFSFSIKEAGFLCHRCEKTDPYR 183


>gi|89100472|ref|ZP_01173334.1| DNA repair protein RecO [Bacillus sp. NRRL B-14911]
 gi|89084815|gb|EAR63954.1| DNA repair protein RecO [Bacillus sp. NRRL B-14911]
          Length = 253

 Score = 93.3 bits (231), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 44/187 (23%), Positives = 76/187 (40%), Gaps = 11/187 (5%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQS--HRMQPILQAGNLVRV-NWRSRL 62
           + I+L   +YGE N I+ + TR++G+     R  +    R+  + Q          RS  
Sbjct: 6   EGIVLRTVNYGESNKIVTLYTREWGKVGVMARGAKKPNSRLSAVTQPFTYGYFLVQRS-- 63

Query: 63  AQNLGEFR-FEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCH 121
              LG  +  E++ S  +      L  Y    +    + + E++P    +++L+  LN  
Sbjct: 64  -SGLGLMQQGEMVSSMRSIREDIFLTAYASYIVDLTDKTVEEKKPNPFHFELLHQTLNYM 122

Query: 122 KIPSVIGKIFVQ-IELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGL--P 178
                  +I V   E+ +L ++G    L KC V G T      S + GG +C       P
Sbjct: 123 NEGYD-PEIMVNIYEMKMLNSLGLYPVLDKCSVCGSTDGHFSFSIREGGLICHRCLEKDP 181

Query: 179 YAEKMLV 185
           Y  K+  
Sbjct: 182 YHYKISP 188


>gi|227356255|ref|ZP_03840644.1| recombination protein O [Proteus mirabilis ATCC 29906]
 gi|227163719|gb|EEI48635.1| recombination protein O [Proteus mirabilis ATCC 29906]
          Length = 246

 Score = 93.3 bits (231), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 38/166 (22%), Positives = 61/166 (36%), Gaps = 20/166 (12%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVN 57
           M  WQ  A ++  R Y E +++L+  T   GR     +  +  R  ++  LQ    + + 
Sbjct: 1   MEGWQ-RAFVIHARPYSETSLLLDFFTENEGRVRILSKGARGRRSPLKGALQPFTPLLIR 59

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFL------YGLQSIVPLFRFLPEREPCLELY 111
           W  R          E+     A+ +S +L L       GL     L R L        L+
Sbjct: 60  WSGR---------GEIKTLRDAEPISLALPLTGTVLYSGLYLNELLSRVLENGTSYSALF 110

Query: 112 DMLNIFLNCHKIPSVIGKIFV-QIELMLLKNIGFGLDLTKCVVTGV 156
                 L          +  + + EL LL  +G+GLD   C  +G 
Sbjct: 111 FEYLSCLQILAASETTPEAALRRFELALLTQLGYGLDFLHCAGSGE 156


>gi|138896060|ref|YP_001126513.1| DNA repair protein RecO [Geobacillus thermodenitrificans NG80-2]
 gi|166221892|sp|A4IR14|RECO_GEOTN RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|134267573|gb|ABO67768.1| DNA repair protein RecO [Geobacillus thermodenitrificans NG80-2]
          Length = 258

 Score = 93.3 bits (231), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 35/185 (18%), Positives = 66/185 (35%), Gaps = 4/185 (2%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQ--SHRMQPILQAGNLVRVNWRSRLA 63
           +AI++    YGE N I+ + TR++G+     R  +  S R+  + Q         R    
Sbjct: 6   EAIVIRAIDYGETNKIVTLFTREWGKVAAMARGAKKPSSRLSAVTQPLAYGHYLIRRSRG 65

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKI 123
             L   + E+++S            Y    +    +   E++    L+++L   L     
Sbjct: 66  VGL-LHQGELIDSMRVLREDLFAAAYAAYIVELTDKSTEEQKRNPYLFELLLQTLQYMSE 124

Query: 124 PSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKM 183
              +  +    E+ +L  +G    L +C   G T+     S K  G +C         + 
Sbjct: 125 GRDLEIMTFIYEMKMLSVLGIPPVLDRCARCGATEGRFSFSVKEAGFLCHRCESADPHR- 183

Query: 184 LVLPS 188
             L  
Sbjct: 184 FPLSP 188


>gi|262273708|ref|ZP_06051521.1| DNA recombination and repair protein RecO [Grimontia hollisae CIP
           101886]
 gi|262222123|gb|EEY73435.1| DNA recombination and repair protein RecO [Grimontia hollisae CIP
           101886]
          Length = 237

 Score = 92.9 bits (230), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 34/165 (20%), Positives = 62/165 (37%), Gaps = 19/165 (11%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNW 58
           M       +L  R Y E ++IL+V +  +GR     +  +  R  ++  LQ    + + W
Sbjct: 1   MEGLQRCFVLHSRPYSETSLILDVFSENHGRVSLMAKGARGKRSPLKGALQPFTPLLMKW 60

Query: 59  RSRLAQNLGEFRFEVLESHCAKLLSSSLFL------YGLQSIVPLFRFL-PEREPCLELY 111
             R          E+     A+ +  ++ L       G      L R + PE       Y
Sbjct: 61  SGR---------GEMHTLRHAEAMGLAIPLSGNALFSGFYLNEILSRVVEPETAYHQLFY 111

Query: 112 DMLNIFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGV 156
           D +       +  +    +  + EL LL ++G+G+D   C  +G 
Sbjct: 112 DYVTALTELAQHRNPEPAL-RRFELALLDSLGYGVDFLHCAGSGE 155


>gi|254360746|ref|ZP_04976894.1| DNA recombination protein RecO [Mannheimia haemolytica PHL213]
 gi|153091316|gb|EDN73290.1| DNA recombination protein RecO [Mannheimia haemolytica PHL213]
          Length = 240

 Score = 92.9 bits (230), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 37/167 (22%), Positives = 61/167 (36%), Gaps = 11/167 (6%)

Query: 2   YWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNWR 59
            WQ  A +L  R Y E ++++E  T  +GR     +  +  R  ++ +LQ    + + W 
Sbjct: 5   QWQ-RAFVLHRREYSENSLLVEFFTEHHGRITLLAKGARRARSPLKAVLQPFTPLLLRWS 63

Query: 60  SRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLN 119
            +        + E         + +     G      L R L  +    EL+      + 
Sbjct: 64  GK-GDLKTLTKAEPAALTLP--METLSLYSGFYINEVLARVLENQTAYPELFQHYLRCIT 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPK 166
                  I  I    E   LK +G+G+D T C  TG+      V PK
Sbjct: 121 ELATQKQIEPILRTFEFHTLKALGYGVDFTHCAATGLP-----VDPK 162


>gi|21958064|gb|AAM84873.1|AE013732_5 recO protein [Yersinia pestis KIM 10]
 gi|45437170|gb|AAS62722.1| DNA repair protein [Yersinia pestis biovar Microtus str. 91001]
          Length = 243

 Score = 92.9 bits (230), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 38/157 (24%), Positives = 62/157 (39%), Gaps = 7/157 (4%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNWRS 60
           WQ  A +L  R Y E +++L++ T   GR     +  +  R  ++  LQ    + V W  
Sbjct: 6   WQ-RAFVLHGRPYSETSLMLDLFTEGEGRMRVLAKGARGRRSNLKGCLQPFTPLLVRWSG 64

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           R  +       E +    A  LS S+   GL     L R L  +     L+      L  
Sbjct: 65  R-GEVKTLRSAEPVSL--ALPLSGSMLYSGLYVNELLSRVLEHQTSYSALFFDYLHCLQA 121

Query: 121 HKIPSVIGKIFVQ-IELMLLKNIGFGLDLTKCVVTGV 156
                   +  ++  EL +L N+G+G+D   C  +G 
Sbjct: 122 LAGSDGSPEHALRQFELAMLANLGYGVDFLHCAGSGQ 158


>gi|149192069|ref|ZP_01870294.1| DNA repair protein RecO [Vibrio shilonii AK1]
 gi|148834094|gb|EDL51106.1| DNA repair protein RecO [Vibrio shilonii AK1]
          Length = 234

 Score = 92.9 bits (230), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 36/157 (22%), Positives = 59/157 (37%), Gaps = 17/157 (10%)

Query: 8   IILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNWRSRLAQN 65
            +L  R Y E ++IL+V + +YGR     +  +S R  ++  LQ    + + W       
Sbjct: 8   FVLHRRPYSESSLILDVFSEEYGRVTLLSKGARSKRSNLKGALQPFTPLLLKWSGG---- 63

Query: 66  LGEFRFEVLESHCAKLLSSSLFLYGLQSIVP------LFRFLPEREPCLELYDMLNIFLN 119
            G  +        A+ +S  L L G+           + R L    P   L+      L 
Sbjct: 64  -GSMK----TLRQAEAISLGLPLSGINLYSAMYVNELIARVLASEIPFPALFHDYLQALT 118

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGV 156
                +       + EL LL  +G+G+D   C  TG 
Sbjct: 119 ELAHNTNPEPALRRFELALLSAMGYGVDFLHCAGTGE 155


>gi|326389847|ref|ZP_08211411.1| DNA repair protein RecO [Thermoanaerobacter ethanolicus JW 200]
 gi|325994115|gb|EGD52543.1| DNA repair protein RecO [Thermoanaerobacter ethanolicus JW 200]
          Length = 248

 Score = 92.9 bits (230), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 40/180 (22%), Positives = 72/180 (40%), Gaps = 20/180 (11%)

Query: 4   QDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPI-----LQAGNLVRVNW 58
           + +AI+L     GE + I  + T+ YG+     +  +  + + +         N V    
Sbjct: 5   KTEAIVLKNNLIGETDKIATLFTKSYGKLQAVAKGARRSKSRFVNAIRPFVVANYVIF-- 62

Query: 59  RSRLAQNLGEFRF---EVLESHCAKLLSSSLFLYGLQSIVP--LFRFLPEREPCLELYDM 113
                +    +     E++E+H  K +   L  + + S +   + + L E +    LY  
Sbjct: 63  -----EGQNYYYIDQWELIEAH--KNIEKDLAKFSVASYIAETINKILEENQKSERLYLF 115

Query: 114 LNIFLNCHKIPSVIGKIFV-QIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVC 172
           L   L       +   IF+    L L+  +G+   L  CVV G  ++L + S   GGAVC
Sbjct: 116 LKHSLKAVDELQIDPLIFISSYNLKLVSLLGYMPQLDNCVVCGKRENLKYFSNSCGGAVC 175


>gi|307266974|ref|ZP_07548491.1| DNA repair protein RecO [Thermoanaerobacter wiegelii Rt8.B1]
 gi|306918023|gb|EFN48280.1| DNA repair protein RecO [Thermoanaerobacter wiegelii Rt8.B1]
          Length = 248

 Score = 92.9 bits (230), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 40/180 (22%), Positives = 72/180 (40%), Gaps = 20/180 (11%)

Query: 4   QDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPI-----LQAGNLVRVNW 58
           + +AI+L     GE + I  + T+ YG+     +  +  + + +         N V    
Sbjct: 5   KTEAIVLKNNLIGETDKIATLFTKSYGKLQAVAKGARRSKSRFVNAIRLFVVANYVIF-- 62

Query: 59  RSRLAQNLGEFRF---EVLESHCAKLLSSSLFLYGLQSIVP--LFRFLPEREPCLELYDM 113
                +    +     E++E+H  K +   L  + + S +   + + L E +    LY  
Sbjct: 63  -----EGQNYYYIDQWELIEAH--KNIEKDLAKFSVASYIAETINKILEENQKSERLYLF 115

Query: 114 LNIFLNCHKIPSVIGKIFV-QIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVC 172
           L   L       +   IF+    L L+  +G+   L  CVV G  ++L + S   GGAVC
Sbjct: 116 LKHSLKAVDELQIDPLIFISSYNLKLVSLLGYMPQLDNCVVCGKRENLKYFSNSCGGAVC 175


>gi|167039987|ref|YP_001662972.1| DNA repair protein RecO [Thermoanaerobacter sp. X514]
 gi|300914077|ref|ZP_07131393.1| DNA repair protein RecO [Thermoanaerobacter sp. X561]
 gi|307724690|ref|YP_003904441.1| DNA repair protein RecO [Thermoanaerobacter sp. X513]
 gi|238687639|sp|B0K710|RECO_THEPX RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|166854227|gb|ABY92636.1| DNA repair protein RecO [Thermoanaerobacter sp. X514]
 gi|300889012|gb|EFK84158.1| DNA repair protein RecO [Thermoanaerobacter sp. X561]
 gi|307581751|gb|ADN55150.1| DNA repair protein RecO [Thermoanaerobacter sp. X513]
          Length = 248

 Score = 92.9 bits (230), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 40/180 (22%), Positives = 72/180 (40%), Gaps = 20/180 (11%)

Query: 4   QDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPI-----LQAGNLVRVNW 58
           + +AI+L     GE + I  + T+ YG+     +  +  + + +         N V    
Sbjct: 5   KTEAIVLKNNLIGETDKIATLFTKSYGKLQAVAKGARRSKSRFVNAIRPFVVANYVIF-- 62

Query: 59  RSRLAQNLGEFRF---EVLESHCAKLLSSSLFLYGLQSIVP--LFRFLPEREPCLELYDM 113
                +    +     E++E+H  K +   L  + + S +   + + L E +    LY  
Sbjct: 63  -----EGQNYYYIDQWELIEAH--KNIEKDLAKFSVASYIAETINKILEENQKSERLYLF 115

Query: 114 LNIFLNCHKIPSVIGKIFV-QIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVC 172
           L   L       +   IF+    L L+  +G+   L  CVV G  ++L + S   GGAVC
Sbjct: 116 LKHSLKAVDELQIDPLIFISSYNLKLVSLLGYMPQLDNCVVCGKRENLKYFSNSCGGAVC 175


>gi|330446943|ref|ZP_08310594.1| DNA repair protein RecO [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
 gi|328491134|dbj|GAA05091.1| DNA repair protein RecO [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
          Length = 236

 Score = 92.9 bits (230), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 33/167 (19%), Positives = 61/167 (36%), Gaps = 9/167 (5%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNW 58
           M       +L  R Y E ++IL+V +  +GR     +  +  R  ++  LQ    + + W
Sbjct: 1   MEGLQRCFVLHSRPYSETSLILDVFSEDHGRLTLLSKGARRKRSNLKGTLQPFTPLFMKW 60

Query: 59  RSRLAQNLGEFR-FEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
             +    +      E +       + S +    +     L R L    P  +L+      
Sbjct: 61  SGK--GAMPVLTHAEPI--SIGLPMRSYILYSAMYVNEILVRVLGNHTPYPQLFLDYLNV 116

Query: 118 LNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVT--GVTQDLLW 162
           L              + EL LL ++G+G+D   C  +  GV  D+ +
Sbjct: 117 LRELAQADNPEPALRRFELSLLHHLGYGIDFLHCAGSGLGVEDDMTY 163


>gi|83720218|ref|YP_442267.1| DNA repair protein RecO [Burkholderia thailandensis E264]
 gi|83654043|gb|ABC38106.1| DNA repair protein RecO [Burkholderia thailandensis E264]
          Length = 286

 Score = 92.9 bits (230), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 30/173 (17%), Positives = 64/173 (36%), Gaps = 19/173 (10%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQ--SHRMQPILQAGNLVRVNWRSRLA 63
              +L    Y E +++++V+TR +GR     +  +     ++ +LQ    + ++W  +  
Sbjct: 57  PGFVLHSYPYRETSLVIDVLTRDHGRIALVAKGAKRPHSALRGVLQTFQPLSLSWSGKS- 115

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVP------LFRFLPEREPCLELYDMLNIF 117
                   E+     A+ +   L L G   +        L +F    +P   L+    + 
Sbjct: 116 --------ELRTLTGAEWVGGMLPLAGDALLCGFYANELLVKFCAREDPHPPLFQHYLVT 167

Query: 118 LNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQ--DLLWVSPKSG 168
           L          ++    E +LL+  G+ + L + V     +   L    P+ G
Sbjct: 168 LTRLAHGEPPVQVLRSFERVLLRETGYAMTLKRTVARRAVEPGKLYVFDPERG 220


>gi|197285741|ref|YP_002151613.1| DNA repair protein [Proteus mirabilis HI4320]
 gi|238693200|sp|B4F045|RECO_PROMH RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|194683228|emb|CAR43909.1| DNA repair protein [Proteus mirabilis HI4320]
          Length = 246

 Score = 92.9 bits (230), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 38/166 (22%), Positives = 61/166 (36%), Gaps = 20/166 (12%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVN 57
           M  WQ  A ++  R Y E +++L+  T   GR     +  +  R  ++  LQ    + + 
Sbjct: 1   MEGWQ-RAFVIHARPYSETSLLLDFFTENEGRVRILSKGARGRRSPLKGALQPFTPLLIR 59

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFL------YGLQSIVPLFRFLPEREPCLELY 111
           W  R          E+     A+ +S +L L       GL     L R L        L+
Sbjct: 60  WSGR---------GEIKTLRDAEPISLALPLTGTVLYSGLYLNELLSRVLENGTSYSTLF 110

Query: 112 DMLNIFLNCHKIPSVIGKIFV-QIELMLLKNIGFGLDLTKCVVTGV 156
                 L          +  + + EL LL  +G+GLD   C  +G 
Sbjct: 111 FEYLSCLQILAASETTPEAALRRFELALLTQLGYGLDFLHCAGSGE 156


>gi|51597204|ref|YP_071395.1| DNA repair protein RecO [Yersinia pseudotuberculosis IP 32953]
 gi|108808448|ref|YP_652364.1| DNA repair protein RecO [Yersinia pestis Antiqua]
 gi|108811371|ref|YP_647138.1| DNA repair protein RecO [Yersinia pestis Nepal516]
 gi|145598835|ref|YP_001162911.1| DNA repair protein RecO [Yersinia pestis Pestoides F]
 gi|149365388|ref|ZP_01887423.1| DNA repair protein [Yersinia pestis CA88-4125]
 gi|153948747|ref|YP_001400119.1| DNA repair protein RecO [Yersinia pseudotuberculosis IP 31758]
 gi|161484839|ref|NP_668622.2| DNA repair protein RecO [Yersinia pestis KIM 10]
 gi|161511351|ref|NP_993845.2| DNA repair protein RecO [Yersinia pestis biovar Microtus str.
           91001]
 gi|162420369|ref|YP_001607937.1| DNA repair protein RecO [Yersinia pestis Angola]
 gi|165925301|ref|ZP_02221133.1| DNA repair protein RecO [Yersinia pestis biovar Orientalis str.
           F1991016]
 gi|165937188|ref|ZP_02225753.1| DNA repair protein RecO [Yersinia pestis biovar Orientalis str.
           IP275]
 gi|166008243|ref|ZP_02229141.1| DNA repair protein RecO [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166212406|ref|ZP_02238441.1| DNA repair protein RecO [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|167399560|ref|ZP_02305084.1| DNA repair protein RecO [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167421237|ref|ZP_02312990.1| DNA repair protein RecO [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167423802|ref|ZP_02315555.1| DNA repair protein RecO [Yersinia pestis biovar Mediaevalis str.
           K1973002]
 gi|167467392|ref|ZP_02332096.1| DNA repair protein RecO [Yersinia pestis FV-1]
 gi|170023437|ref|YP_001719942.1| DNA repair protein RecO [Yersinia pseudotuberculosis YPIII]
 gi|186896301|ref|YP_001873413.1| DNA repair protein RecO [Yersinia pseudotuberculosis PB1/+]
 gi|218929792|ref|YP_002347667.1| DNA repair protein RecO [Yersinia pestis CO92]
 gi|229838283|ref|ZP_04458442.1| gap repair protein [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|229895521|ref|ZP_04510692.1| gap repair protein [Yersinia pestis Pestoides A]
 gi|229898847|ref|ZP_04513992.1| gap repair protein [Yersinia pestis biovar Orientalis str. India
           195]
 gi|229901621|ref|ZP_04516743.1| gap repair protein [Yersinia pestis Nepal516]
 gi|270489810|ref|ZP_06206884.1| DNA repair protein RecO [Yersinia pestis KIM D27]
 gi|294504511|ref|YP_003568573.1| DNA repair protein RecO [Yersinia pestis Z176003]
 gi|20139503|sp|Q8ZD70|RECO_YERPE RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|61214871|sp|Q667V3|RECO_YERPS RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|119361499|sp|Q1C553|RECO_YERPA RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|119361500|sp|Q1CKE2|RECO_YERPN RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|166221917|sp|A4TKX6|RECO_YERPP RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|166918733|sp|A7FFU1|RECO_YERP3 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|238687296|sp|A9R404|RECO_YERPG RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|238688564|sp|B1JRC9|RECO_YERPY RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|238691450|sp|B2KA45|RECO_YERPB RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|51590486|emb|CAH22126.1| DNA repair protein [Yersinia pseudotuberculosis IP 32953]
 gi|108775019|gb|ABG17538.1| DNA replication and repair protein RecO [Yersinia pestis Nepal516]
 gi|108780361|gb|ABG14419.1| DNA replication and repair protein RecO [Yersinia pestis Antiqua]
 gi|115348403|emb|CAL21339.1| DNA repair protein [Yersinia pestis CO92]
 gi|145210531|gb|ABP39938.1| DNA replication and repair protein RecO [Yersinia pestis Pestoides
           F]
 gi|149291801|gb|EDM41875.1| DNA repair protein [Yersinia pestis CA88-4125]
 gi|152960242|gb|ABS47703.1| DNA repair protein RecO [Yersinia pseudotuberculosis IP 31758]
 gi|162353184|gb|ABX87132.1| DNA repair protein RecO [Yersinia pestis Angola]
 gi|165915051|gb|EDR33663.1| DNA repair protein RecO [Yersinia pestis biovar Orientalis str.
           IP275]
 gi|165922908|gb|EDR40059.1| DNA repair protein RecO [Yersinia pestis biovar Orientalis str.
           F1991016]
 gi|165992625|gb|EDR44926.1| DNA repair protein RecO [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166206337|gb|EDR50817.1| DNA repair protein RecO [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|166960726|gb|EDR56747.1| DNA repair protein RecO [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167052064|gb|EDR63472.1| DNA repair protein RecO [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167057972|gb|EDR67718.1| DNA repair protein RecO [Yersinia pestis biovar Mediaevalis str.
           K1973002]
 gi|169749971|gb|ACA67489.1| DNA repair protein RecO [Yersinia pseudotuberculosis YPIII]
 gi|186699327|gb|ACC89956.1| DNA repair protein RecO [Yersinia pseudotuberculosis PB1/+]
 gi|229681550|gb|EEO77644.1| gap repair protein [Yersinia pestis Nepal516]
 gi|229688395|gb|EEO80466.1| gap repair protein [Yersinia pestis biovar Orientalis str. India
           195]
 gi|229694649|gb|EEO84696.1| gap repair protein [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|229701327|gb|EEO89355.1| gap repair protein [Yersinia pestis Pestoides A]
 gi|262362497|gb|ACY59218.1| DNA repair protein RecO [Yersinia pestis D106004]
 gi|262366498|gb|ACY63055.1| DNA repair protein RecO [Yersinia pestis D182038]
 gi|270338314|gb|EFA49091.1| DNA repair protein RecO [Yersinia pestis KIM D27]
 gi|294354970|gb|ADE65311.1| DNA repair protein RecO [Yersinia pestis Z176003]
 gi|320016073|gb|ADV99644.1| gap repair protein [Yersinia pestis biovar Medievalis str. Harbin
           35]
          Length = 241

 Score = 92.9 bits (230), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 38/157 (24%), Positives = 62/157 (39%), Gaps = 7/157 (4%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNWRS 60
           WQ  A +L  R Y E +++L++ T   GR     +  +  R  ++  LQ    + V W  
Sbjct: 4   WQ-RAFVLHGRPYSETSLMLDLFTEGEGRMRVLAKGARGRRSNLKGCLQPFTPLLVRWSG 62

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           R  +       E +    A  LS S+   GL     L R L  +     L+      L  
Sbjct: 63  R-GEVKTLRSAEPVSL--ALPLSGSMLYSGLYVNELLSRVLEHQTSYSALFFDYLHCLQA 119

Query: 121 HKIPSVIGKIFVQ-IELMLLKNIGFGLDLTKCVVTGV 156
                   +  ++  EL +L N+G+G+D   C  +G 
Sbjct: 120 LAGSDGSPEHALRQFELAMLANLGYGVDFLHCAGSGQ 156


>gi|85059763|ref|YP_455465.1| DNA repair protein RecO [Sodalis glossinidius str. 'morsitans']
 gi|119361486|sp|Q2NS15|RECO_SODGM RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|84780283|dbj|BAE75060.1| DNA repair protein RecO [Sodalis glossinidius str. 'morsitans']
          Length = 260

 Score = 92.5 bits (229), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 42/163 (25%), Positives = 63/163 (38%), Gaps = 19/163 (11%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNWRS 60
           WQ  A +L  R Y E +++L+  T Q GR     +  +S R  ++ +LQ    +   W  
Sbjct: 4   WQ-RAFVLHARPYSETSLLLDFFTEQQGRVRVLAKGARSRRSALKGVLQPFTPLLARWSG 62

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSI------VPLFRFLPEREPCLEL-YDM 113
           R          EV     A+ +S  L L GL           L R L       +L YD 
Sbjct: 63  R---------GEVKTLRSAEPVSLGLPLSGLMLYSGLYINELLSRVLDHETDYSKLFYDY 113

Query: 114 LNIFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGV 156
           L+                 + EL LL ++G+G+D   C  +G 
Sbjct: 114 LHCLQWLAGATGSPEPALRRFELALLSHLGYGVDFLHCAGSGE 156


>gi|237748851|ref|ZP_04579331.1| DNA repair protein recO [Oxalobacter formigenes OXCC13]
 gi|229380213|gb|EEO30304.1| DNA repair protein recO [Oxalobacter formigenes OXCC13]
          Length = 265

 Score = 92.5 bits (229), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 34/152 (22%), Positives = 57/152 (37%), Gaps = 17/152 (11%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQ--SHRMQPILQAGNLVRVNWRSRLA 63
              +L    Y E +++++V TR YGR     +  +  + R++ +LQ    + + W  +  
Sbjct: 37  PGFVLHSYVYKESSLVVDVFTRDYGRVALVAKGAKRPTSRLRGVLQTFQPLSIGWTGKS- 95

Query: 64  QNLGEFRFEVLESHCAKL------LSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
                   E+     A+       L +S  LYG      L +     +P   L+D     
Sbjct: 96  --------ELRTLTTAEWIGGMIPLENSALLYGFYLNELLLKLTAREDPHHLLFDHYVKA 147

Query: 118 LNCHKIPSVIGKIFVQIELMLLKNIGFGLDLT 149
           LN          +    EL LLK  G   DL+
Sbjct: 148 LNRLATSESAQTVLRIFELALLKETGVAADLS 179


>gi|261491681|ref|ZP_05988262.1| DNA recombination protein RecO [Mannheimia haemolytica serotype A2
           str. BOVINE]
 gi|261494444|ref|ZP_05990930.1| DNA recombination protein RecO [Mannheimia haemolytica serotype A2
           str. OVINE]
 gi|261309828|gb|EEY11045.1| DNA recombination protein RecO [Mannheimia haemolytica serotype A2
           str. OVINE]
 gi|261312634|gb|EEY13756.1| DNA recombination protein RecO [Mannheimia haemolytica serotype A2
           str. BOVINE]
          Length = 240

 Score = 92.5 bits (229), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 35/156 (22%), Positives = 58/156 (37%), Gaps = 6/156 (3%)

Query: 2   YWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNWR 59
            WQ  A +L  R Y E ++++E  T  +GR     +  +  R  ++ +LQ    + V W 
Sbjct: 5   QWQ-RAFVLHRREYSESSLLVEFFTEHHGRITLLAKGARRARSPLKAVLQPFTPLLVRWS 63

Query: 60  SRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLN 119
            +        + E         + ++    G      L R L  +    EL+      + 
Sbjct: 64  GK-GDLKTLTKAEPAALTLP--METAALYSGFYINEVLARVLENQTAYPELFQHYLRCMT 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTG 155
                  I  I    E   LK +G+G+D T C  TG
Sbjct: 121 ELATQHQIEPILRTFEFHTLKALGYGVDFTHCTATG 156


>gi|269140065|ref|YP_003296766.1| DNA repair protein [Edwardsiella tarda EIB202]
 gi|267985726|gb|ACY85555.1| DNA repair protein [Edwardsiella tarda EIB202]
 gi|304559893|gb|ADM42557.1| DNA recombination and repair protein RecO [Edwardsiella tarda
           FL6-60]
          Length = 242

 Score = 92.5 bits (229), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 37/163 (22%), Positives = 63/163 (38%), Gaps = 19/163 (11%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNWRS 60
           WQ  A +L  R Y E +++L+  T  +GR     +  +S R  ++  LQ    + + W  
Sbjct: 4   WQ-RAFVLHARPYSETSLMLDTFTEGHGRVRLLAKGARSRRSLLKGALQPFTPLLIRWGG 62

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSI------VPLFRFLPEREPCLELYDML 114
           R          EV     A+ +S +L L G+           L R L +      L+   
Sbjct: 63  R---------GEVKTLRSAEAVSLALPLSGITLYSGLYVNELLARVLEQETCYSALFFDY 113

Query: 115 NIFLNCHKIPSVIGK-IFVQIELMLLKNIGFGLDLTKCVVTGV 156
              +      +   +    + EL LL  +G+G+D   C  +G 
Sbjct: 114 LHCIQHLAAHAGSPEPALRRFELALLTQLGYGVDFLHCAGSGE 156


>gi|167037773|ref|YP_001665351.1| DNA repair protein RecO [Thermoanaerobacter pseudethanolicus ATCC
           33223]
 gi|256751967|ref|ZP_05492837.1| DNA repair protein RecO [Thermoanaerobacter ethanolicus CCSD1]
 gi|320116188|ref|YP_004186347.1| DNA repair protein RecO [Thermoanaerobacter brockii subsp. finnii
           Ako-1]
 gi|238687665|sp|B0KA52|RECO_THEP3 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|166856607|gb|ABY95015.1| DNA repair protein RecO [Thermoanaerobacter pseudethanolicus ATCC
           33223]
 gi|256749172|gb|EEU62206.1| DNA repair protein RecO [Thermoanaerobacter ethanolicus CCSD1]
 gi|319929279|gb|ADV79964.1| DNA repair protein RecO [Thermoanaerobacter brockii subsp. finnii
           Ako-1]
          Length = 248

 Score = 92.5 bits (229), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 39/180 (21%), Positives = 72/180 (40%), Gaps = 20/180 (11%)

Query: 4   QDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPI-----LQAGNLVRVNW 58
           + +AI+L     GE + I  + T+ YG+     +  +  + + +         N V    
Sbjct: 5   KTEAIVLKNNLIGETDKIATLFTKSYGKLQAVAKGARRSKSRFVNAIRPFIVANYVIF-- 62

Query: 59  RSRLAQNLGEFRF---EVLESHCAKLLSSSLFLYGLQSIVP--LFRFLPEREPCLELYDM 113
                +    +     E++E+H  + +   L  + + S +   + + L E +    LY  
Sbjct: 63  -----EGKNYYYIDQWELIEAH--RNIEKDLVKFSVASYIAETINKILEENQKSERLYLF 115

Query: 114 LNIFLNCHKIPSVIGKIFV-QIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVC 172
           L   L       +   IF+    L L+  +G+   L  CVV G  ++L + S   GGAVC
Sbjct: 116 LKHSLKAVDELQIDPLIFISSYNLKLVSLLGYMPQLDNCVVCGKRENLKYFSNSCGGAVC 175


>gi|322834125|ref|YP_004214152.1| DNA repair protein RecO [Rahnella sp. Y9602]
 gi|321169326|gb|ADW75025.1| DNA repair protein RecO [Rahnella sp. Y9602]
          Length = 245

 Score = 92.5 bits (229), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 41/167 (24%), Positives = 66/167 (39%), Gaps = 20/167 (11%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVN 57
           M  WQ  A +L  R Y E +++L++ T   GR     +  +  R  ++  LQ    + V 
Sbjct: 1   MEGWQ-RAFVLHGRPYSETSLMLDLFTEGQGRVRILAKGARGRRSNLKGCLQPFTPLLVR 59

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLF------RFLPEREPCLELY 111
           W  R          EV     A+ +S +L L GL     L+      R L +      L+
Sbjct: 60  WSGR---------GEVKTLRNAEPVSLALPLSGLMLYSGLYVNELVSRVLEQEANYSSLF 110

Query: 112 DMLNIFLNCHKIPSVIGKIFVQ-IELMLLKNIGFGLDLTKCVVTGVT 157
                 L      S   +  ++  EL LL ++G+G+D   C  +G  
Sbjct: 111 FDYLNCLQNLASASGSPEYALRQFELSLLHHLGYGVDFLHCAGSGEE 157


>gi|82702880|ref|YP_412446.1| DNA repair protein RecO [Nitrosospira multiformis ATCC 25196]
 gi|119361469|sp|Q2Y867|RECO_NITMU RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|82410945|gb|ABB75054.1| DNA replication and repair protein RecO [Nitrosospira multiformis
           ATCC 25196]
          Length = 242

 Score = 92.5 bits (229), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 36/158 (22%), Positives = 62/158 (39%), Gaps = 17/158 (10%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQ--SHRMQPILQAGNLVRVNWRSRLA 63
            A +L    Y E ++I+EV T+  GR     +  +  +  ++ +L+A   + ++W  +  
Sbjct: 12  PAFVLHSYPYLETSLIVEVFTQNSGRIAVVAKGAKRPTSPLRGLLRAFQPLLLSWGGKS- 70

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVP------LFRFLPEREPCLELYDMLNIF 117
                   E+   H A+     L L G   I        L R L   +P   L+      
Sbjct: 71  --------ELRTLHKAEWQGGQLPLQGTALICGFYLNELLIRLLHRNDPHERLFACYQEA 122

Query: 118 LNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTG 155
           L+     S    I  + E  LL+ +G+ L L   V +G
Sbjct: 123 LSDLSTASDYIPILRRFEQRLLQEMGYALTLDHDVSSG 160


>gi|37527214|ref|NP_930558.1| DNA repair protein RecO [Photorhabdus luminescens subsp. laumondii
           TTO1]
 gi|42559442|sp|Q7N1X7|RECO_PHOLL RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|36786648|emb|CAE15712.1| DNA repair protein recO (recombination protein O) [Photorhabdus
           luminescens subsp. laumondii TTO1]
          Length = 241

 Score = 92.1 bits (228), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 36/158 (22%), Positives = 58/158 (36%), Gaps = 18/158 (11%)

Query: 8   IILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNWRSRLAQN 65
            +L  R Y E +++L++ T   GR     +  +  R  ++  LQ    + V W  R    
Sbjct: 8   FVLHGRPYSETSLLLDLFTENEGRISVLAKGARGRRSNLKGCLQPFTPLLVRWSGR---- 63

Query: 66  LGEFRFEVLESHCAKLLSSSLFL------YGLQSIVPLFRFLPEREPCLELYDMLNIFLN 119
            G  +        A  +S +L L       GL     L R L +      L+      L 
Sbjct: 64  -GAIK----TLRDADPISLALPLTGSVLYSGLYINELLSRVLEQGTAYPALFFDYLQCLQ 118

Query: 120 CHKIPSVIGK-IFVQIELMLLKNIGFGLDLTKCVVTGV 156
                    +    + EL LL N+G+G+D   C  +G 
Sbjct: 119 ILAASEYTPEYALRRFELALLANLGYGVDYLHCAGSGE 156


>gi|148263002|ref|YP_001229708.1| DNA repair protein RecO [Geobacter uraniireducens Rf4]
 gi|189039657|sp|A5GBB7|RECO_GEOUR RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|146396502|gb|ABQ25135.1| DNA replication and repair protein RecO [Geobacter uraniireducens
           Rf4]
          Length = 244

 Score = 92.1 bits (228), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 39/177 (22%), Positives = 71/177 (40%), Gaps = 8/177 (4%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQ--PILQAGNLVRVNWRSRLA 63
           +AI+LGV  YGE + I+ + T ++G+  G  R+ +  R +    L+    +R++   ++ 
Sbjct: 7   EAIVLGVMDYGEADKIVTLFTLEHGKLKGLARSAKKSRKRFGGALEPFARLRLHLAMKV- 65

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLF-RFLPEREPCLELYDMLNIFLNCHK 122
             L       + +    +    + +        L  R +PE E    L+ +L  +L+   
Sbjct: 66  -GLSTLNGADIVTIFPHIRQDLVKIGHAAYACELVERLVPEAEQNHRLFRLLAAYLDHLD 124

Query: 123 IPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWV---SPKSGGAVCRSVG 176
                       E  LLK +G+   L++C           V   SP S G +C   G
Sbjct: 125 QFQHDPSDRRFFEANLLKVVGYQPALSRCAACDADLAGALVLRWSPSSAGVLCGRCG 181


>gi|126652273|ref|ZP_01724452.1| DNA repair protein RecO [Bacillus sp. B14905]
 gi|126591005|gb|EAZ85117.1| DNA repair protein RecO [Bacillus sp. B14905]
          Length = 262

 Score = 92.1 bits (228), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 48/222 (21%), Positives = 78/222 (35%), Gaps = 9/222 (4%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQ--SHRMQPILQAGNLVRVNW 58
           M  + + I+L VR+YGE N I+ ++TR+ G+     R  +  S R+  + Q         
Sbjct: 1   MLHKWEGIVLKVRAYGESNKIVTLLTREAGKVATMARGAKKPSSRLASVTQPFTYGMFMV 60

Query: 59  RSRLAQNLGEF-RFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
           +      +G   + E L S            Y    +  + R + E +P    +D+L   
Sbjct: 61  Q--HHTGMGTLQQGEHLNSMRHIREDIMATAYASYIMELVERVVEEGKPEPFAFDVLLQA 118

Query: 118 LNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGL 177
           L   +       I +  E  +L   G    L  C   G        S   GG +C     
Sbjct: 119 LQAIEDGYDPESITLFAEWKMLPYTGVQPILHACAACGAVDGEFAFSFAQGGFLCHRCYQ 178

Query: 178 --PYAEKMLVLPSFLWK--EEQTIDADSLKSAFQLTDYFLNK 215
             PY  ++      L +      ID        + T YF+ K
Sbjct: 179 HDPYIIRLTPTQLKLIRMFYTVPIDQIGKIELKKETKYFIKK 220


>gi|310764813|gb|ADP09763.1| DNA repair protein RecO [Erwinia sp. Ejp617]
          Length = 245

 Score = 92.1 bits (228), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 41/167 (24%), Positives = 68/167 (40%), Gaps = 20/167 (11%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVN 57
           M  WQ  A +L  R + E +++L++ + Q+GR     +  +S R  ++  LQ    + V 
Sbjct: 1   MEGWQ-RAFVLHGRPWSETSLLLDLFSEQHGRVRVLAKGARSKRSSLKGALQPFTPLLVR 59

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLF------RFLPEREPCLEL- 110
           W  R          EV     A+ +S +L L G      L+      R L       EL 
Sbjct: 60  WSGR---------GEVKTLRAAEPVSLALPLSGNTLYCGLYVNELLSRVLQHETAFSELF 110

Query: 111 YDMLNIFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVT 157
           +D L         P+       + EL +L ++G+G+D   C  +G  
Sbjct: 111 FDYLQCIQTLAADPASPEPALRRFELSMLGHLGYGVDFLHCAGSGEE 157


>gi|259907679|ref|YP_002648035.1| DNA repair protein RecO [Erwinia pyrifoliae Ep1/96]
 gi|224963301|emb|CAX54786.1| DNA repair protein RecO [Erwinia pyrifoliae Ep1/96]
 gi|283477530|emb|CAY73446.1| DNA repair protein recO (Recombination protein O) [Erwinia
           pyrifoliae DSM 12163]
          Length = 245

 Score = 92.1 bits (228), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 41/167 (24%), Positives = 68/167 (40%), Gaps = 20/167 (11%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVN 57
           M  WQ  A +L  R + E +++L++ + Q+GR     +  +S R  ++  LQ    + V 
Sbjct: 1   MEGWQ-RAFVLHGRPWSETSLLLDLFSEQHGRVRVLAKGARSKRSSLKGALQPFTPLLVR 59

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLF------RFLPEREPCLEL- 110
           W  R          EV     A+ +S +L L G      L+      R L       EL 
Sbjct: 60  WSGR---------GEVKTLRAAEPVSLALPLSGNTLYCGLYVNELLSRVLQHETAFSELF 110

Query: 111 YDMLNIFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVT 157
           +D L         P+       + EL +L ++G+G+D   C  +G  
Sbjct: 111 FDYLQCIQTLAADPASPEPALRRFELSMLGHLGYGVDFLHCAGSGEE 157


>gi|209695941|ref|YP_002263871.1| DNA repair protein RecO [Aliivibrio salmonicida LFI1238]
 gi|238058640|sp|B6EKM7|RECO_ALISL RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|208009894|emb|CAQ80207.1| DNA repair protein RecO (recombination protein O) [Aliivibrio
           salmonicida LFI1238]
          Length = 238

 Score = 92.1 bits (228), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 40/168 (23%), Positives = 72/168 (42%), Gaps = 24/168 (14%)

Query: 8   IILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNWRSRLAQN 65
            +L  R Y E ++IL+V + +YGR     +  +S R  ++ +LQA   + + W  +    
Sbjct: 9   FVLHRRPYSESSLILDVFSEEYGRLSIISKGARSKRSNLKGVLQAFTPLLMKWSGK---- 64

Query: 66  LGEFRFEVLESHCAKLLSSSLFLYGLQSIVPL------FRFLPEREPCLELY-DMLNIFL 118
            G  R        A+ +S ++ L G+     L       R + +  P   L+ D L    
Sbjct: 65  -GSMR----TLRQAETISLAIPLTGINLYSALYINELVVRVIEQETPYPALFLDYLTALT 119

Query: 119 NCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPK 166
              +  +    +  + EL LL ++G+G+D   C  +G       VSP+
Sbjct: 120 ELAQTKNPEPAL-RRFELALLSSLGYGVDFLHCAGSGEM-----VSPE 161


>gi|167563524|ref|ZP_02356440.1| DNA repair protein RecO [Burkholderia oklahomensis EO147]
          Length = 251

 Score = 92.1 bits (228), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 33/173 (19%), Positives = 68/173 (39%), Gaps = 19/173 (10%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQ--SHRMQPILQAGNLVRVNWRSRLA 63
            A +L    Y E +++++V+TR +GR     +  +     ++ +LQ    + ++W  +  
Sbjct: 22  PAFVLHSHPYRETSLVIDVLTRDHGRIALVAKGAKRPHSALRGVLQTFQPLSLSWSGKS- 80

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVP------LFRFLPEREPCLELYDMLNIF 117
                   E+     A+ +   L L G   +        L +F    +P   L+    + 
Sbjct: 81  --------ELRTLTGAEWVGGMLPLAGDALLCGFYVNELLVKFCAREDPHPPLFTHYLVT 132

Query: 118 LNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQ-DLLWV-SPKSG 168
           L          ++    E +LL+  G+ + L + V     + D L+V  P+ G
Sbjct: 133 LTRLAHGEPPVQVLRSFERVLLRETGYAMSLKRTVARRSVEPDRLYVFDPERG 185


>gi|299535812|ref|ZP_07049133.1| DNA repair protein RecO [Lysinibacillus fusiformis ZC1]
 gi|298729012|gb|EFI69566.1| DNA repair protein RecO [Lysinibacillus fusiformis ZC1]
          Length = 261

 Score = 92.1 bits (228), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 50/222 (22%), Positives = 81/222 (36%), Gaps = 9/222 (4%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQ--SHRMQPILQAGNLVRVNW 58
           M  + + I+L VR+YGE N I+ ++TR+ G+     R  +  S R+  I Q         
Sbjct: 1   MLHKWEGIVLKVRAYGESNKIVILLTREAGKVATMARGAKKPSSRLASITQPFTYGMFMV 60

Query: 59  RSRLAQNLGEF-RFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
           +      +G   + E L S            Y    +  + R + E +P    +D+L   
Sbjct: 61  Q--HHTGMGTLQQGEHLNSMRHIREDIMATAYASYIMELVERVVEEGKPEPFAFDVLLHA 118

Query: 118 LNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGL 177
           L   +       I + +E  +L   G    L  C   G        S   GG +C     
Sbjct: 119 LQAIEDGYDPEAITLFVEWKMLPYTGVQPILHACAACGAVDGEFAFSFAQGGFLCHRCYQ 178

Query: 178 --PYAEKMLVLPSFLWKEEQTIDADSLK--SAFQLTDYFLNK 215
             PY  ++      L +   TI  D +      + T YF+ K
Sbjct: 179 HDPYIIRLTPTQLKLIRMFYTIPIDQIGKIELKKETKYFIKK 220


>gi|76810334|ref|YP_334274.1| DNA repair protein RecO [Burkholderia pseudomallei 1710b]
 gi|161723199|ref|YP_109019.2| DNA repair protein RecO [Burkholderia pseudomallei K96243]
 gi|254191247|ref|ZP_04897751.1| DNA repair protein RecO [Burkholderia pseudomallei Pasteur 52237]
 gi|254195774|ref|ZP_04902200.1| DNA repair protein RecO [Burkholderia pseudomallei S13]
 gi|76579787|gb|ABA49262.1| DNA repair protein RecO [Burkholderia pseudomallei 1710b]
 gi|157938919|gb|EDO94589.1| DNA repair protein RecO [Burkholderia pseudomallei Pasteur 52237]
 gi|169652519|gb|EDS85212.1| DNA repair protein RecO [Burkholderia pseudomallei S13]
          Length = 286

 Score = 92.1 bits (228), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 33/173 (19%), Positives = 68/173 (39%), Gaps = 19/173 (10%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQ--SHRMQPILQAGNLVRVNWRSRLA 63
            A +L    Y E +++++V+TR +GR     +  +     ++ +LQ    + ++W  +  
Sbjct: 57  PAFVLHSYPYRETSLVIDVLTRDHGRIALVAKGAKRPHSALRGVLQTFQPLSLSWSGKS- 115

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVP------LFRFLPEREPCLELYDMLNIF 117
                   E+     A+ +   L L G   +        L +F    +P   L+    + 
Sbjct: 116 --------ELRTLTGAEWVGGMLPLAGDALLCGFYANELLVKFCAREDPHPPLFQHYLVT 167

Query: 118 LNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQ-DLLWV-SPKSG 168
           L          ++    E +LL+  G+ + L + V     + D L+V  P+ G
Sbjct: 168 LTRLAHGEPPVQVLRSFERVLLRETGYAMTLKRTVARRAVEPDKLYVFDPQRG 220


>gi|167581153|ref|ZP_02374027.1| DNA repair protein RecO [Burkholderia thailandensis TXDOH]
          Length = 275

 Score = 92.1 bits (228), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 30/173 (17%), Positives = 64/173 (36%), Gaps = 19/173 (10%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQ--SHRMQPILQAGNLVRVNWRSRLA 63
              +L    Y E +++++V+TR +GR     +  +     ++ +LQ    + ++W  +  
Sbjct: 46  PGFVLHSYPYRETSLVIDVLTRDHGRIALVAKGAKRPHSALRGVLQTFQPLSLSWSGKS- 104

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVP------LFRFLPEREPCLELYDMLNIF 117
                   E+     A+ +   L L G   +        L +F    +P   L+    + 
Sbjct: 105 --------ELRTLTGAEWVGGMLPLAGDALLCGFYANELLVKFCAREDPHPPLFQHYLVT 156

Query: 118 LNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQ--DLLWVSPKSG 168
           L          ++    E +LL+  G+ + L + V     +   L    P+ G
Sbjct: 157 LTRLAHGEPPVQVLRSFERVLLRETGYAMTLKRTVARRAVEPGKLYVFDPERG 209


>gi|167619238|ref|ZP_02387869.1| DNA repair protein RecO [Burkholderia thailandensis Bt4]
 gi|257138460|ref|ZP_05586722.1| DNA repair protein RecO [Burkholderia thailandensis E264]
 gi|119361451|sp|Q2SXT2|RECO_BURTA RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
          Length = 275

 Score = 92.1 bits (228), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 30/173 (17%), Positives = 64/173 (36%), Gaps = 19/173 (10%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQ--SHRMQPILQAGNLVRVNWRSRLA 63
              +L    Y E +++++V+TR +GR     +  +     ++ +LQ    + ++W  +  
Sbjct: 46  PGFVLHSYPYRETSLVIDVLTRDHGRIALVAKGAKRPHSALRGVLQTFQPLSLSWSGKS- 104

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVP------LFRFLPEREPCLELYDMLNIF 117
                   E+     A+ +   L L G   +        L +F    +P   L+    + 
Sbjct: 105 --------ELRTLTGAEWVGGMLPLAGDALLCGFYANELLVKFCAREDPHPPLFQHYLVT 156

Query: 118 LNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQ--DLLWVSPKSG 168
           L          ++    E +LL+  G+ + L + V     +   L    P+ G
Sbjct: 157 LTRLAHGEPPVQVLRSFERVLLRETGYAMTLKRTVARRAVEPGKLYVFDPERG 209


>gi|226328139|ref|ZP_03803657.1| hypothetical protein PROPEN_02030 [Proteus penneri ATCC 35198]
 gi|225203843|gb|EEG86197.1| hypothetical protein PROPEN_02030 [Proteus penneri ATCC 35198]
          Length = 245

 Score = 92.1 bits (228), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 39/169 (23%), Positives = 65/169 (38%), Gaps = 17/169 (10%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNWRS 60
           WQ  A ++  R Y E +++L+  T   GR     +  +  R  ++  LQ    + + W  
Sbjct: 4   WQ-RAFVIHARPYSETSLLLDFFTENEGRVRILSKGARGRRSPLKGALQPFTPLLIRWSG 62

Query: 61  RLAQNLGEFR----FEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNI 116
           R     GE +     E +    A  L+ S+   GL     L R L        L+     
Sbjct: 63  R-----GEIKTLRDAEPISL--ALPLTGSVLYSGLYLNELLSRVLENGTSYSVLFFEYLS 115

Query: 117 FLNCHKIPSVIGKIFV-QIELMLLKNIGFGLDLTKCVVTG--VTQDLLW 162
            L          +  + + EL LL  +G+GLD   C  +G  V+  + +
Sbjct: 116 CLQILAASETTPEAALRRFELALLTQLGYGLDFLHCAGSGEPVSDSMTY 164


>gi|46143334|ref|ZP_00135440.2| COG1381: Recombinational DNA repair protein (RecF pathway)
           [Actinobacillus pleuropneumoniae serovar 1 str. 4074]
 gi|126208027|ref|YP_001053252.1| DNA repair protein RecO [Actinobacillus pleuropneumoniae L20]
 gi|166221881|sp|A3MZR1|RECO_ACTP2 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|126096819|gb|ABN73647.1| DNA repair protein RecO [Actinobacillus pleuropneumoniae serovar 5b
           str. L20]
          Length = 240

 Score = 91.7 bits (227), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 30/157 (19%), Positives = 58/157 (36%), Gaps = 7/157 (4%)

Query: 2   YWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNWR 59
            W     +L  R Y E +++++  T ++GR     +  +  R  ++ +LQ    + + W 
Sbjct: 4   NWH-RGFVLHRREYSETSLLVDFFTEEHGRVTLLAKGARRPRSPLKAVLQPFTPLLLRWS 62

Query: 60  SRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLN 119
            +        + E         + +     G      L R L  +    EL+      + 
Sbjct: 63  GK-GDLKTLTKAEPASLTLP--MQTLALYSGFYVNEVLARVLENQTAYPELFQHYLQCMT 119

Query: 120 CHK-IPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTG 155
                P  I  I    E  +LK +G+G++ + C  TG
Sbjct: 120 RLATQPKQIEPILRTFEFQMLKALGYGVNFSICAATG 156


>gi|313637816|gb|EFS03157.1| DNA repair protein RecO [Listeria seeligeri FSL S4-171]
          Length = 255

 Score = 91.7 bits (227), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 37/186 (19%), Positives = 69/186 (37%), Gaps = 6/186 (3%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQS--HRMQPILQAGNLVRVNW 58
           M  + + I++   SY E + I+ + TR++G+     R  +    R+  + Q        +
Sbjct: 1   ME-KCEGIVIRQTSYRESDKIVRMYTREFGKIGVVARGAKKTKSRLAAVTQLFTSGYFTF 59

Query: 59  RSRLAQNLGEFR-FEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
                  LG  +  EV+E+  +      +  Y       L +   ER+P   LY++    
Sbjct: 60  FG--GNGLGTLQQGEVIENFSSIQQDIFMTAYATYVCELLDKATEERQPNPYLYELTFQI 117

Query: 118 LNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGL 177
           L           +    E+ +L  +G    + KC + G T      S +S G +C     
Sbjct: 118 LRDIDEGYDPQILTQIFEMKMLPVLGHYPTMDKCAICGETTGHFDFSTRSNGIICHRCFD 177

Query: 178 PYAEKM 183
               +M
Sbjct: 178 KDRYRM 183


>gi|289434742|ref|YP_003464614.1| recombination protein O [Listeria seeligeri serovar 1/2b str.
           SLCC3954]
 gi|289170986|emb|CBH27528.1| recombination protein O [Listeria seeligeri serovar 1/2b str.
           SLCC3954]
          Length = 255

 Score = 91.7 bits (227), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 37/186 (19%), Positives = 69/186 (37%), Gaps = 6/186 (3%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQS--HRMQPILQAGNLVRVNW 58
           M  + + I++   SY E + I+ + TR++G+     R  +    R+  + Q        +
Sbjct: 1   ME-KCEGIVIRQTSYRESDKIVRMYTREFGKIGVVARGAKKTKSRLAAVTQLFTSGYFTF 59

Query: 59  RSRLAQNLGEFR-FEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
                  LG  +  EV+E+  +      +  Y       L +   ER+P   LY++    
Sbjct: 60  FG--GNGLGTLQQGEVIENFSSIQQDIFMTAYATYVCELLDKATEERQPNPYLYELTFQI 117

Query: 118 LNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGL 177
           L           +    E+ +L  +G    + KC + G T      S +S G +C     
Sbjct: 118 LRDIDEGYDPQILTQIFEMKMLPVLGHYPTMDKCAICGETTGHFDFSTRSNGIICHRCFD 177

Query: 178 PYAEKM 183
               +M
Sbjct: 178 KDRYRM 183


>gi|53725349|ref|YP_102341.1| DNA repair protein RecO [Burkholderia mallei ATCC 23344]
 gi|52428772|gb|AAU49365.1| Recombination protein O [Burkholderia mallei ATCC 23344]
          Length = 286

 Score = 91.7 bits (227), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 33/173 (19%), Positives = 68/173 (39%), Gaps = 19/173 (10%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQ--SHRMQPILQAGNLVRVNWRSRLA 63
            A +L    Y E +++++V+TR +GR     +  +     ++ +LQ    + ++W  +  
Sbjct: 57  PAFVLHSYPYRETSLVIDVLTRDHGRIALVAKGAKRPHSALRGVLQTFQPLSLSWSGKS- 115

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVP------LFRFLPEREPCLELYDMLNIF 117
                   E+     A+ +   L L G   +        L +F    +P   L+    + 
Sbjct: 116 --------ELRTLTGAEWVGGMLPLAGDALLCGFYANELLVKFCAREDPHPPLFQHYLVT 167

Query: 118 LNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQ-DLLWV-SPKSG 168
           L          ++    E +LL+  G+ + L + V     + D L+V  P+ G
Sbjct: 168 LTRLAHGEPPVQVLRSFERVLLRETGYAMTLKRTVARRAVEPDKLYVFDPQRG 220


>gi|165975964|ref|YP_001651557.1| DNA repair protein RecO [Actinobacillus pleuropneumoniae serovar 3
           str. JL03]
 gi|238687534|sp|B0BUA8|RECO_ACTPJ RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|165876065|gb|ABY69113.1| DNA repair protein [Actinobacillus pleuropneumoniae serovar 3 str.
           JL03]
          Length = 240

 Score = 91.7 bits (227), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 29/157 (18%), Positives = 57/157 (36%), Gaps = 7/157 (4%)

Query: 2   YWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQ--SHRMQPILQAGNLVRVNWR 59
            W     +L  R Y E +++++  T ++GR     +  +     ++ +LQ    + + W 
Sbjct: 4   NWH-RGFVLHRREYSETSLLVDFFTEEHGRITLLAKGARRPHSPLKAVLQPFTPLLLRWS 62

Query: 60  SRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLN 119
            +        + E         + +     G      L R L  +    EL+      + 
Sbjct: 63  GK-GDLKTLTKAEPASLTLP--MQTLALYSGFYVNEVLARVLENQTAYPELFQHYLQCMT 119

Query: 120 CHK-IPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTG 155
                P  I  I    E  +LK +G+G++ + C  TG
Sbjct: 120 RLATQPEQIEPILRTFEFQMLKALGYGVNFSICAATG 156


>gi|238753922|ref|ZP_04615282.1| DNA repair protein recO [Yersinia ruckeri ATCC 29473]
 gi|238707910|gb|EEQ00268.1| DNA repair protein recO [Yersinia ruckeri ATCC 29473]
          Length = 243

 Score = 91.7 bits (227), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 40/166 (24%), Positives = 64/166 (38%), Gaps = 20/166 (12%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVN 57
           M  WQ  A +L  R Y E +++L++ T   GR     +  +S R  ++  LQ    + V 
Sbjct: 1   MEGWQ-RAFVLHSRPYSETSLMLDLFTEGEGRMRVLAKGARSRRSNLKGCLQPFTPLLVR 59

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFL------YGLQSIVPLFRFLPEREPCLELY 111
           W  R          EV     A+ +S +L L       GL     L R L        L+
Sbjct: 60  WAGR---------GEVKTLRSAEPVSLALPLSGTMLYSGLYVNELLSRVLEHGTNYSALF 110

Query: 112 DMLNIFLNCHKIPSVIGKIFVQ-IELMLLKNIGFGLDLTKCVVTGV 156
                 L          +  ++  EL +L ++G+G+D   C  +G 
Sbjct: 111 FDYLHCLQALAATDGSPECVLRQFELAMLASLGYGVDFLHCAGSGQ 156


>gi|323490067|ref|ZP_08095288.1| DNA repair protein RecO [Planococcus donghaensis MPA1U2]
 gi|323396363|gb|EGA89188.1| DNA repair protein RecO [Planococcus donghaensis MPA1U2]
          Length = 260

 Score = 91.7 bits (227), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 37/172 (21%), Positives = 68/172 (39%), Gaps = 15/172 (8%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQS--HRMQPILQAGNLVRVN- 57
           M  Q + I++    YGE N I+ + T++ G+     R  +    R+  I Q       + 
Sbjct: 1   MQNQVEGIVIRTMPYGETNKIVTLFTKEAGKITCMARGAKKPASRLAAITQVFTHGSFSI 60

Query: 58  WRSRLAQNLGEFR----FEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPER-EPCLELYD 112
           ++ +    +G  +     E L      ++S++   Y    +  L   L E+ EP   ++D
Sbjct: 61  YKGK---GMGTIQAGDPLESLRHIREDIMSTAYASY----VTELIDRLTEQDEPQPAIFD 113

Query: 113 MLNIFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVS 164
           ML   L+          I + +E  +L+  G    L +C   G T+     S
Sbjct: 114 MLYQALHAIDDGYDPEAITLFVEWKMLQTAGLTPTLHQCANCGSTEGEFAFS 165


>gi|94311352|ref|YP_584562.1| DNA repair protein RecO [Cupriavidus metallidurans CH34]
 gi|119361474|sp|Q1LKN3|RECO_RALME RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|93355204|gb|ABF09293.1| DNA repair protein recO (Recombination protein O) [Cupriavidus
           metallidurans CH34]
          Length = 298

 Score = 91.7 bits (227), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 33/164 (20%), Positives = 62/164 (37%), Gaps = 7/164 (4%)

Query: 4   QDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQ--SHRMQPILQAGNLVRVNWRSR 61
            +   +L    Y E +++L+V TR +GR     +  +     ++ +LQ  + + ++W  R
Sbjct: 66  NEAGFVLHAHPYRETSLVLDVFTRDHGRVAMVAKGAKRPHSALRAVLQHFHPIALSWTGR 125

Query: 62  LAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCH 121
             +     + E +       LS    L G      L RF P  +    L+      L   
Sbjct: 126 -GEVKTLTKAEYVGGMLP--LSGDALLSGFYLNELLLRFCPREDAHPTLFRHYMATLTRL 182

Query: 122 KIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVT--QDLLWV 163
                   +    E +LL+  GF +   +C+ +G      L +V
Sbjct: 183 SHGEPASFVLRSFERVLLQETGFAVAFDQCLRSGERVQPGLDYV 226


>gi|116872891|ref|YP_849672.1| DNA repair protein RecO [Listeria welshimeri serovar 6b str.
           SLCC5334]
 gi|123461072|sp|A0AIR1|RECO_LISW6 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|116741769|emb|CAK20893.1| recombination protein O [Listeria welshimeri serovar 6b str.
           SLCC5334]
          Length = 255

 Score = 91.7 bits (227), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 37/186 (19%), Positives = 69/186 (37%), Gaps = 6/186 (3%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQS--HRMQPILQAGNLVRVNW 58
           M  + + I++   SY E + I+ + TR++G+     R  +    R+  + Q        +
Sbjct: 1   ME-KCEGIVIRQTSYRESDKIVRMYTREFGKIGVVARGAKKTKSRLAAVTQLFTNGYFTF 59

Query: 59  RSRLAQNLGEFR-FEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
                  LG  +  EV+E+  +      +  Y       L +   ER+P   LY++    
Sbjct: 60  FG--GNGLGTLQQGEVIENFSSIQQDIFMTAYATYVCELLDKATEERQPNPYLYELTFQI 117

Query: 118 LNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGL 177
           L           +    E+ +L  +G    + KC + G T      S +S G +C     
Sbjct: 118 LRDIDEGYDPQILTQIYEMKMLPVLGLYPTMDKCAICGETTGHFDFSTRSNGIICHRCFE 177

Query: 178 PYAEKM 183
               +M
Sbjct: 178 KDRYRM 183


>gi|238920903|ref|YP_002934418.1| DNA repair protein RecO, [Edwardsiella ictaluri 93-146]
 gi|238870472|gb|ACR70183.1| DNA repair protein RecO, putative [Edwardsiella ictaluri 93-146]
          Length = 242

 Score = 91.7 bits (227), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 37/163 (22%), Positives = 63/163 (38%), Gaps = 19/163 (11%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNWRS 60
           WQ  A +L  R Y E +++L+  T  +GR     +  +S R  ++  LQ    + + W  
Sbjct: 4   WQ-RAFVLHARPYSETSLMLDTFTEGHGRVRLLAKGARSRRSLLKGALQPFTPLLIRWGG 62

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSI------VPLFRFLPEREPCLELYDML 114
           R          EV     A+ +S +L L G+           L R L +      L+   
Sbjct: 63  R---------GEVKTLRSAEAVSLALPLSGITLYSGLYVNELLARVLEQETCYNALFFDY 113

Query: 115 NIFLNCHKIPSVIGK-IFVQIELMLLKNIGFGLDLTKCVVTGV 156
              +      +   +    + EL LL  +G+G+D   C  +G 
Sbjct: 114 LHCIQHLAAHAGSPEPALRRFELALLAQLGYGVDFLHCAGSGE 156


>gi|190149856|ref|YP_001968381.1| DNA repair protein RecO [Actinobacillus pleuropneumoniae serovar 7
           str. AP76]
 gi|307263179|ref|ZP_07544800.1| DNA repair protein recO [Actinobacillus pleuropneumoniae serovar 13
           str. N273]
 gi|238692329|sp|B3GX87|RECO_ACTP7 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|189914987|gb|ACE61239.1| DNA repair protein RecO [Actinobacillus pleuropneumoniae serovar 7
           str. AP76]
 gi|306871541|gb|EFN03264.1| DNA repair protein recO [Actinobacillus pleuropneumoniae serovar 13
           str. N273]
          Length = 240

 Score = 91.7 bits (227), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 30/157 (19%), Positives = 58/157 (36%), Gaps = 7/157 (4%)

Query: 2   YWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNWR 59
            W     +L  R Y E +++++  T ++GR     +  +  R  ++ +LQ    + + W 
Sbjct: 4   NWH-RGFVLHRREYSETSLLVDFFTEEHGRITLLAKGARRPRSPLKAVLQPFTPLLLRWS 62

Query: 60  SRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLN 119
            +        + E         + +     G      L R L  +    EL+      + 
Sbjct: 63  GK-GDLKTLTKAEPASLTLP--MQTLALYSGFYVNEVLARVLENQTAYPELFQHYLQCMT 119

Query: 120 CHK-IPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTG 155
                P  I  I    E  +LK +G+G++ + C  TG
Sbjct: 120 RLATQPEQIEPILRTFEFQMLKALGYGVNFSICAATG 156


>gi|169829165|ref|YP_001699323.1| DNA repair protein RecO [Lysinibacillus sphaericus C3-41]
 gi|168993653|gb|ACA41193.1| DNA repair protein recO (Recombination protein O) [Lysinibacillus
           sphaericus C3-41]
          Length = 272

 Score = 91.7 bits (227), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 48/222 (21%), Positives = 78/222 (35%), Gaps = 9/222 (4%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQ--SHRMQPILQAGNLVRVNW 58
           M  + + I+L VR+YGE N I+ ++TR+ G+     R  +  S R+  + Q         
Sbjct: 11  MLHKWEGIVLKVRAYGESNKIVTLLTREAGKVATMARGAKKPSSRLASVTQPFTYGMFMV 70

Query: 59  RSRLAQNLGEF-RFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
           +      +G   + E L S            Y    +  + R + E +P    +D+L   
Sbjct: 71  Q--HHTGMGTLQQGEHLNSMRHIREDIMATAYASYIMELVERVVEEGKPEPFAFDVLLQA 128

Query: 118 LNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGL 177
           L   +       I +  E  +L   G    L  C   G        S   GG +C     
Sbjct: 129 LQAIEDGYDPESITLFAEWKMLPYTGVQPILHACAACGAVDGEFAFSFAQGGFLCHRCYQ 188

Query: 178 --PYAEKMLVLPSFLWK--EEQTIDADSLKSAFQLTDYFLNK 215
             PY  ++      L +      ID        + T YF+ K
Sbjct: 189 HDPYIIRLTPTQLKLIRMFYTVPIDQIGKIELKKETKYFIKK 230


>gi|261820521|ref|YP_003258627.1| DNA repair protein RecO [Pectobacterium wasabiae WPP163]
 gi|261604534|gb|ACX87020.1| DNA repair protein RecO [Pectobacterium wasabiae WPP163]
          Length = 245

 Score = 91.7 bits (227), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 37/161 (22%), Positives = 62/161 (38%), Gaps = 8/161 (4%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVN 57
           M  WQ  A +L  R Y E +++L++ +   GR     +  ++ R  ++  LQ    + V 
Sbjct: 1   MEGWQ-RAFVLHGRPYSETSLLLDLFSESDGRVRVLAKGARARRSSLKGCLQPFTPLLVR 59

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
           W  R  +       E +    A  L+ S+   GL     L R L        L+      
Sbjct: 60  WSGR-GEVKTLRSAEPVSL--ALPLTGSMLYSGLYVNELLSRVLEHETNYSALFFDYLHC 116

Query: 118 LNCHKIPSVIGK-IFVQIELMLLKNIGFGLDLTKCVVTGVT 157
           L          +    + EL LL  +G+G+D   C  +G +
Sbjct: 117 LQHLAAQDASPEPALRRFELALLSYLGYGVDFLHCAGSGES 157


>gi|167570685|ref|ZP_02363559.1| DNA repair protein RecO [Burkholderia oklahomensis C6786]
          Length = 248

 Score = 91.7 bits (227), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 33/173 (19%), Positives = 68/173 (39%), Gaps = 19/173 (10%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQ--SHRMQPILQAGNLVRVNWRSRLA 63
            A +L    Y E +++++V+TR +GR     +  +     ++ +LQ    + ++W  +  
Sbjct: 19  PAFVLHSHPYRETSLVIDVLTRDHGRIALVAKGAKRPHSALRGVLQTFQPLSLSWSGKS- 77

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVP------LFRFLPEREPCLELYDMLNIF 117
                   E+     A+ +   L L G   +        L +F    +P   L+    + 
Sbjct: 78  --------ELRTLTGAEWVGGMLPLAGDALLCGFYVNELLVKFCAREDPHPPLFTHYLVT 129

Query: 118 LNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQ-DLLWV-SPKSG 168
           L          ++    E +LL+  G+ + L + V     + D L+V  P+ G
Sbjct: 130 LTRLAHGEPPVQVLRSFERVLLRETGYAMSLKRTVARRSVEPDRLYVFDPERG 182


>gi|39995684|ref|NP_951635.1| DNA repair protein RecO [Geobacter sulfurreducens PCA]
 gi|61215122|sp|Q74FM9|RECO_GEOSL RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|39982447|gb|AAR33908.1| DNA repair protein RecO [Geobacter sulfurreducens PCA]
 gi|298504695|gb|ADI83418.1| DNA repair protein RecO [Geobacter sulfurreducens KN400]
          Length = 243

 Score = 91.7 bits (227), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 31/155 (20%), Positives = 58/155 (37%), Gaps = 5/155 (3%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQS--HRMQPILQAGNLVRVNWRSRLA 63
           +A++L    Y E + I+ + T  +G+  G  R  +    R    L+    + V    R  
Sbjct: 7   EAVVLATMDYRESDRIVTLFTLCHGKVRGLARGARKSMRRFGGALEPFARLSVELVVR-- 64

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFL-YGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHK 122
           + L   R   + +   ++      + +G  ++  + R LP+      L+ +L  +L    
Sbjct: 65  EGLSSLRGVDIVTVYPRIRQDLAAIGHGGYAVELVDRLLPDGASVPRLFRLLVSYLEHLD 124

Query: 123 IPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVT 157
                       E  LL  +G+ L L  C   GV 
Sbjct: 125 QGGASPSDRRFFEANLLNILGYRLSLDACAACGVE 159


>gi|50122198|ref|YP_051365.1| DNA repair protein RecO [Pectobacterium atrosepticum SCRI1043]
 gi|61214937|sp|Q6D221|RECO_ERWCT RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|49612724|emb|CAG76174.1| DNA repair protein [Pectobacterium atrosepticum SCRI1043]
          Length = 245

 Score = 91.7 bits (227), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 37/160 (23%), Positives = 61/160 (38%), Gaps = 8/160 (5%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVN 57
           M  WQ  A +L  R Y E +++L++ +   GR     +  ++ R  ++  LQ    + V 
Sbjct: 1   MEGWQ-RAFVLHGRPYSETSLLLDLFSESDGRVRVLAKGARARRSSLKGCLQPFTPLLVR 59

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
           W  R  +       E +    A  L+ S+   GL     L R L        L+      
Sbjct: 60  WSGR-GEVKTLRSAEPVSL--ALPLTGSMLYSGLYVNELLARVLEHETNYSALFFDYLHC 116

Query: 118 LNCHKIPSVIGK-IFVQIELMLLKNIGFGLDLTKCVVTGV 156
           L          +    + EL LL  +G+G+D   C  +G 
Sbjct: 117 LQHLAAQDASPEPALRRFELALLGYLGYGVDFLHCAGSGE 156


>gi|293394831|ref|ZP_06639121.1| recombination protein O [Serratia odorifera DSM 4582]
 gi|291422582|gb|EFE95821.1| recombination protein O [Serratia odorifera DSM 4582]
          Length = 243

 Score = 91.4 bits (226), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 39/166 (23%), Positives = 64/166 (38%), Gaps = 20/166 (12%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVN 57
           M  WQ  A +L  R Y E +++L++ T  +GR     +  +S R  ++  LQ    + V 
Sbjct: 1   MEGWQ-RAFVLHGRPYSETSLMLDLFTEGHGRVRLLAKGARSRRSNLKGCLQPFTPLLVR 59

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFL------YGLQSIVPLFRFLPEREPCLELY 111
           W  R           +     A+ +S  L L       GL     L R L +      L+
Sbjct: 60  WGGRGD---------IKTLRNAEAVSLGLPLSGMMLYSGLYVNELLSRVLEQEADYSLLF 110

Query: 112 DMLNIFLNCHKIPSVIGKIFVQ-IELMLLKNIGFGLDLTKCVVTGV 156
                 L          +  ++  EL LL ++G+G+D   C  +G 
Sbjct: 111 FDYLQCLQALAAAERSPEQALRQFELALLHHLGYGVDFLHCAGSGE 156


>gi|303252177|ref|ZP_07338345.1| DNA repair protein RecO [Actinobacillus pleuropneumoniae serovar 2
           str. 4226]
 gi|307247517|ref|ZP_07529562.1| DNA repair protein recO [Actinobacillus pleuropneumoniae serovar 2
           str. S1536]
 gi|302648960|gb|EFL79148.1| DNA repair protein RecO [Actinobacillus pleuropneumoniae serovar 2
           str. 4226]
 gi|306856020|gb|EFM88178.1| DNA repair protein recO [Actinobacillus pleuropneumoniae serovar 2
           str. S1536]
          Length = 240

 Score = 91.4 bits (226), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 30/157 (19%), Positives = 58/157 (36%), Gaps = 7/157 (4%)

Query: 2   YWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNWR 59
            W     +L  R Y E +++++  T ++GR     +  +  R  ++ +LQ    + + W 
Sbjct: 4   NWH-RGFVLHRREYSETSLLVDFFTEEHGRITLLAKGARRPRSPLKAVLQPFTPLLLRWS 62

Query: 60  SRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLN 119
            +        + E         + +     G      L R L  +    EL+      + 
Sbjct: 63  GK-GDLKTLTKAEPASLTLP--MQTLALYSGFYVNEVLARVLENQTAYPELFQHYLQCMT 119

Query: 120 CHK-IPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTG 155
                P  I  I    E  +LK +G+G++ + C  TG
Sbjct: 120 RLATQPKQIEPILRTFEFQMLKALGYGVNFSICAATG 156


>gi|313633230|gb|EFS00100.1| DNA repair protein RecO [Listeria seeligeri FSL N1-067]
          Length = 255

 Score = 91.4 bits (226), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 37/186 (19%), Positives = 69/186 (37%), Gaps = 6/186 (3%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQS--HRMQPILQAGNLVRVNW 58
           M  + + I++   SY E + I+ + TR++G+     R  +    R+  + Q        +
Sbjct: 1   ME-KCEGIVIRQTSYRESDKIVRMYTREFGKIGVVARGAKKTKSRLAAVTQLFTSGYFTF 59

Query: 59  RSRLAQNLGEFR-FEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
                  LG  +  EV+E+  +      +  Y       L +   ER+P   LY++    
Sbjct: 60  FG--GNGLGTLQQGEVIENFPSIQQDIFMTAYATYVCELLDKATEERQPNPYLYELTFQI 117

Query: 118 LNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGL 177
           L           +    E+ +L  +G    + KC + G T      S +S G +C     
Sbjct: 118 LRDIDEGYDPQILTQIFEMKMLPVLGHYPTMDKCAICGETTGHFDFSTRSNGIICHRCFD 177

Query: 178 PYAEKM 183
               +M
Sbjct: 178 KDRYRM 183


>gi|303251582|ref|ZP_07337756.1| DNA repair protein RecO [Actinobacillus pleuropneumoniae serovar 6
           str. Femo]
 gi|307245402|ref|ZP_07527490.1| DNA repair protein recO [Actinobacillus pleuropneumoniae serovar 1
           str. 4074]
 gi|307249748|ref|ZP_07531727.1| DNA repair protein recO [Actinobacillus pleuropneumoniae serovar 4
           str. M62]
 gi|307252105|ref|ZP_07534004.1| DNA repair protein recO [Actinobacillus pleuropneumoniae serovar 6
           str. Femo]
 gi|307254357|ref|ZP_07536195.1| DNA repair protein recO [Actinobacillus pleuropneumoniae serovar 9
           str. CVJ13261]
 gi|307256564|ref|ZP_07538345.1| DNA repair protein recO [Actinobacillus pleuropneumoniae serovar 10
           str. D13039]
 gi|307258815|ref|ZP_07540547.1| DNA repair protein recO [Actinobacillus pleuropneumoniae serovar 11
           str. 56153]
 gi|302649580|gb|EFL79762.1| DNA repair protein RecO [Actinobacillus pleuropneumoniae serovar 6
           str. Femo]
 gi|306853743|gb|EFM85960.1| DNA repair protein recO [Actinobacillus pleuropneumoniae serovar 1
           str. 4074]
 gi|306858256|gb|EFM90333.1| DNA repair protein recO [Actinobacillus pleuropneumoniae serovar 4
           str. M62]
 gi|306860405|gb|EFM92419.1| DNA repair protein recO [Actinobacillus pleuropneumoniae serovar 6
           str. Femo]
 gi|306862656|gb|EFM94612.1| DNA repair protein recO [Actinobacillus pleuropneumoniae serovar 9
           str. CVJ13261]
 gi|306864974|gb|EFM96876.1| DNA repair protein recO [Actinobacillus pleuropneumoniae serovar 10
           str. D13039]
 gi|306867166|gb|EFM99022.1| DNA repair protein recO [Actinobacillus pleuropneumoniae serovar 11
           str. 56153]
          Length = 240

 Score = 91.4 bits (226), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 30/157 (19%), Positives = 58/157 (36%), Gaps = 7/157 (4%)

Query: 2   YWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNWR 59
            W     +L  R Y E +++++  T ++GR     +  +  R  ++ +LQ    + + W 
Sbjct: 4   NWH-RGFVLHRREYSETSLLVDFFTEEHGRITLLAKGARRPRSPLKAVLQPFTPLLLRWS 62

Query: 60  SRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLN 119
            +        + E         + +     G      L R L  +    EL+      + 
Sbjct: 63  GK-GDLKTLTKAEPASLTLP--MQTLALYSGFYVNEVLARVLENQTAYPELFQHYLQCMT 119

Query: 120 CHK-IPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTG 155
                P  I  I    E  +LK +G+G++ + C  TG
Sbjct: 120 RLATQPKQIEPILRTFEFQMLKALGYGVNFSICAATG 156


>gi|153835469|ref|ZP_01988136.1| DNA repair protein RecO [Vibrio harveyi HY01]
 gi|269960403|ref|ZP_06174776.1| DNA repair protein recO [Vibrio harveyi 1DA3]
 gi|148867980|gb|EDL67177.1| DNA repair protein RecO [Vibrio harveyi HY01]
 gi|269834830|gb|EEZ88916.1| DNA repair protein recO [Vibrio harveyi 1DA3]
          Length = 243

 Score = 91.4 bits (226), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 36/157 (22%), Positives = 62/157 (39%), Gaps = 17/157 (10%)

Query: 8   IILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNWRSRLAQN 65
            +L  R Y E ++IL+V + +YGR     +  +S R  ++  LQ    + + W  +    
Sbjct: 13  FVLHRRPYSESSLILDVFSEEYGRITLMAKGARSKRSNLKGALQPFTPLLLKWSGK---- 68

Query: 66  LGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLF------RFLPEREPCLELYDMLNIFLN 119
            G  +        A+ +S  L L+G+     ++      R L    P   L+      L 
Sbjct: 69  -GSMK----TLRQAEPISLGLPLFGINLYSAMYVNELVGRVLMAEVPMPALFHDYLHALT 123

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGV 156
                        + EL LL ++G+G+D   C  TG 
Sbjct: 124 ELAQSDNPEPGLRRFELALLSSMGYGVDFLHCAGTGE 160


>gi|332308047|ref|YP_004435898.1| DNA repair protein RecO [Glaciecola agarilytica 4H-3-7+YE-5]
 gi|332175376|gb|AEE24630.1| DNA repair protein RecO [Glaciecola agarilytica 4H-3-7+YE-5]
          Length = 240

 Score = 91.4 bits (226), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 37/153 (24%), Positives = 61/153 (39%), Gaps = 7/153 (4%)

Query: 7   AIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNWRSRLAQ 64
             +L  R+Y E + ++   T + G+    V+  +  +   + +LQ    + V    R   
Sbjct: 8   GFVLHRRAYRETSFLINFFTMENGKVSAIVKGARGAKSDKKSLLQPFQPLLVAVSGRFE- 66

Query: 65  NLGEFRFEVLESHCAKLLSSSLFLY-GLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKI 123
                  + +ES  A L  S   LY  L     L R L +  P  E++ +    L+    
Sbjct: 67  ---LKNLQQVESTGAMLRLSGQALYCALYLNEVLNRVLADDIPHPEIFVLYQQSLHALVD 123

Query: 124 PSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGV 156
            +    I    EL LL  +G+G+DLT    TG 
Sbjct: 124 STHFEPILRSFELGLLDALGYGIDLTHDADTGQ 156


>gi|317491020|ref|ZP_07949456.1| recombination protein O [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316920567|gb|EFV41890.1| recombination protein O [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 242

 Score = 91.4 bits (226), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 42/174 (24%), Positives = 71/174 (40%), Gaps = 22/174 (12%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVN 57
           M  WQ  A +L  R Y E +++L++ T  +GR     +  +S R  ++  LQ    + V 
Sbjct: 1   MEGWQ-RAFVLHGRPYSETSLLLDLFTEGHGRVRLLAKGARSKRSSLKGALQPFTPLLVR 59

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLF------RFLPEREPCLELY 111
           W  +          EV     A+ +S  L L G+     L+      R L +      L+
Sbjct: 60  WGGK---------GEVKTLRNAEPVSLGLPLTGISLYSGLYVNELVSRVLEQETNYSSLF 110

Query: 112 DMLNIFLNCHKIPSVIGKIFVQ-IELMLLKNIGFGLDLTKCVVTG--VTQDLLW 162
                 L          +  ++  EL LL N+G+G+D   C  +G  V+ D+ +
Sbjct: 111 FDYLNCLQNLAATVGSPEHTLREFELALLGNLGYGIDFLHCAGSGEPVSDDMTY 164


>gi|269101848|ref|ZP_06154545.1| DNA recombination and repair protein RecO [Photobacterium damselae
           subsp. damselae CIP 102761]
 gi|268161746|gb|EEZ40242.1| DNA recombination and repair protein RecO [Photobacterium damselae
           subsp. damselae CIP 102761]
          Length = 236

 Score = 91.4 bits (226), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 32/166 (19%), Positives = 60/166 (36%), Gaps = 7/166 (4%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNW 58
           M       +L  R Y E ++IL+V +   GR     +  +  R  ++  LQ    + + W
Sbjct: 1   MEGLQRCFVLHSRPYSETSLILDVFSEDSGRLSILSKGARRKRSNLKGALQPFTPLFMKW 60

Query: 59  RSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFL 118
             +          E +       + S +    +     L R L  + P   L+      L
Sbjct: 61  SGK-GSMPVLTHAEPI--SIGLPMRSYILYSAMYVNEVLCRVLEAQTPYPVLFLDYLNVL 117

Query: 119 NCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTG--VTQDLLW 162
                         + EL LL+++G+G+D   C  +G  V  ++ +
Sbjct: 118 RELAQADNPEPALRRFELALLQHLGYGIDFLHCAGSGLPVEDNMTY 163


>gi|59712692|ref|YP_205468.1| DNA repair protein RecO [Vibrio fischeri ES114]
 gi|197335983|ref|YP_002156884.1| DNA repair protein RecO [Vibrio fischeri MJ11]
 gi|67461219|sp|Q5E316|RECO_VIBF1 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|238690260|sp|B5FAG8|RECO_VIBFM RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|59480793|gb|AAW86580.1| gap repair protein [Vibrio fischeri ES114]
 gi|197317473|gb|ACH66920.1| DNA repair protein RecO [Vibrio fischeri MJ11]
          Length = 238

 Score = 91.4 bits (226), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 40/168 (23%), Positives = 70/168 (41%), Gaps = 24/168 (14%)

Query: 8   IILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNWRSRLAQN 65
            +L  R Y E ++IL+V + +YGR     +  +S R  ++ +LQA   + + W  +    
Sbjct: 9   FVLHRRPYSESSLILDVFSEEYGRLSIISKGARSKRSNLKGVLQAFTPLLMKWSGK---- 64

Query: 66  LGEFRFEVLESHCAKLLSSSLFLYGLQSIVP------LFRFLPEREPCLELY-DMLNIFL 118
            G  R        A+ +S  + L G+           L R + +  P   L+ D L    
Sbjct: 65  -GSMR----TLRQAETISLGIPLTGINLYSAMYINELLVRVVEQETPYPALFLDYLTALT 119

Query: 119 NCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPK 166
              +  +    +  + EL LL  +G+G+D   C  +G       VSP+
Sbjct: 120 ELAQSTNPEPAL-RRFELALLSAMGYGVDFLHCAGSGEM-----VSPE 161


>gi|126440516|ref|YP_001059798.1| DNA repair protein RecO [Burkholderia pseudomallei 668]
 gi|126452734|ref|YP_001067085.1| DNA repair protein RecO [Burkholderia pseudomallei 1106a]
 gi|134277090|ref|ZP_01763805.1| DNA repair protein RecO [Burkholderia pseudomallei 305]
 gi|167720556|ref|ZP_02403792.1| DNA repair protein RecO [Burkholderia pseudomallei DM98]
 gi|167816750|ref|ZP_02448430.1| DNA repair protein RecO [Burkholderia pseudomallei 91]
 gi|167825157|ref|ZP_02456628.1| DNA repair protein RecO [Burkholderia pseudomallei 9]
 gi|167846654|ref|ZP_02472162.1| DNA repair protein RecO [Burkholderia pseudomallei B7210]
 gi|167895242|ref|ZP_02482644.1| DNA repair protein RecO [Burkholderia pseudomallei 7894]
 gi|167903625|ref|ZP_02490830.1| DNA repair protein RecO [Burkholderia pseudomallei NCTC 13177]
 gi|167911874|ref|ZP_02498965.1| DNA repair protein RecO [Burkholderia pseudomallei 112]
 gi|167919871|ref|ZP_02506962.1| DNA repair protein RecO [Burkholderia pseudomallei BCC215]
 gi|217421115|ref|ZP_03452620.1| DNA repair protein RecO [Burkholderia pseudomallei 576]
 gi|226199969|ref|ZP_03795519.1| DNA repair protein RecO [Burkholderia pseudomallei Pakistan 9]
 gi|237813193|ref|YP_002897644.1| DNA repair protein RecO [Burkholderia pseudomallei MSHR346]
 gi|242316189|ref|ZP_04815205.1| DNA repair protein RecO [Burkholderia pseudomallei 1106b]
 gi|254184212|ref|ZP_04890802.1| DNA repair protein RecO [Burkholderia pseudomallei 1655]
 gi|254258139|ref|ZP_04949193.1| DNA repair protein RecO [Burkholderia pseudomallei 1710a]
 gi|254296873|ref|ZP_04964326.1| DNA repair protein RecO [Burkholderia pseudomallei 406e]
 gi|61214848|sp|Q63S98|RECO_BURPS RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|119361449|sp|Q3JQ79|RECO_BURP1 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|52210447|emb|CAH36430.1| DNA repair protein RecO [Burkholderia pseudomallei K96243]
 gi|126220009|gb|ABN83515.1| DNA repair protein RecO [Burkholderia pseudomallei 668]
 gi|126226376|gb|ABN89916.1| DNA repair protein RecO [Burkholderia pseudomallei 1106a]
 gi|134250740|gb|EBA50819.1| DNA repair protein RecO [Burkholderia pseudomallei 305]
 gi|157807319|gb|EDO84489.1| DNA repair protein RecO [Burkholderia pseudomallei 406e]
 gi|184214743|gb|EDU11786.1| DNA repair protein RecO [Burkholderia pseudomallei 1655]
 gi|217396527|gb|EEC36544.1| DNA repair protein RecO [Burkholderia pseudomallei 576]
 gi|225928025|gb|EEH24062.1| DNA repair protein RecO [Burkholderia pseudomallei Pakistan 9]
 gi|237503117|gb|ACQ95435.1| DNA repair protein RecO [Burkholderia pseudomallei MSHR346]
 gi|242139428|gb|EES25830.1| DNA repair protein RecO [Burkholderia pseudomallei 1106b]
 gi|254216828|gb|EET06212.1| DNA repair protein RecO [Burkholderia pseudomallei 1710a]
          Length = 275

 Score = 91.4 bits (226), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 33/173 (19%), Positives = 68/173 (39%), Gaps = 19/173 (10%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQ--SHRMQPILQAGNLVRVNWRSRLA 63
            A +L    Y E +++++V+TR +GR     +  +     ++ +LQ    + ++W  +  
Sbjct: 46  PAFVLHSYPYRETSLVIDVLTRDHGRIALVAKGAKRPHSALRGVLQTFQPLSLSWSGKS- 104

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVP------LFRFLPEREPCLELYDMLNIF 117
                   E+     A+ +   L L G   +        L +F    +P   L+    + 
Sbjct: 105 --------ELRTLTGAEWVGGMLPLAGDALLCGFYANELLVKFCAREDPHPPLFQHYLVT 156

Query: 118 LNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQ-DLLWV-SPKSG 168
           L          ++    E +LL+  G+ + L + V     + D L+V  P+ G
Sbjct: 157 LTRLAHGEPPVQVLRSFERVLLRETGYAMTLKRTVARRAVEPDKLYVFDPQRG 209


>gi|90412088|ref|ZP_01220095.1| DNA repair protein RecO [Photobacterium profundum 3TCK]
 gi|90327066|gb|EAS43445.1| DNA repair protein RecO [Photobacterium profundum 3TCK]
          Length = 236

 Score = 91.0 bits (225), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 37/168 (22%), Positives = 63/168 (37%), Gaps = 16/168 (9%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNW 58
           M       +L  R Y E ++IL+V +  YGR     +  +  R  ++  LQ    + + W
Sbjct: 1   MEGLQRCFVLHSRPYSETSLILDVFSEDYGRLTILSKGARRKRSNLKGTLQPFTPLFMKW 60

Query: 59  RSRLAQNLGEFR----FEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELY-DM 113
             R     G  +     E +       +   +          L R L    P   L+ D 
Sbjct: 61  TGR-----GSMKTLTHAEPISISLP--MRGYILYSAFYLNEVLARVLENDTPYPVLFMDY 113

Query: 114 LNIFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGV-TQDL 160
           LN      +  +    +  + EL LL ++G+G+D   C  +G+   DL
Sbjct: 114 LNALRELVQADNPEPAL-RRFELALLHHLGYGIDFLHCAGSGLPVDDL 160


>gi|260771273|ref|ZP_05880200.1| DNA recombination and repair protein RecO [Vibrio furnissii CIP
           102972]
 gi|260613870|gb|EEX39062.1| DNA recombination and repair protein RecO [Vibrio furnissii CIP
           102972]
 gi|315179120|gb|ADT86034.1| DNA repair protein RecO [Vibrio furnissii NCTC 11218]
          Length = 241

 Score = 91.0 bits (225), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 36/162 (22%), Positives = 61/162 (37%), Gaps = 17/162 (10%)

Query: 8   IILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNWRSRLAQN 65
            +L  R Y E ++IL+V + +YGR     +  +S R  ++  LQ    + + W    +  
Sbjct: 9   FVLHRRPYSETSLILDVFSEEYGRLTLLAKGARSKRSNLKGALQPFTPLLLKWSGNSS-- 66

Query: 66  LGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLF------RFLPEREPCLELYDMLNIFLN 119
                  +     A+ +S  L L G+     ++      R L    P   L+      L 
Sbjct: 67  -------MKTLRQAEAISLGLPLTGIHLYSAMYVNELVGRVLAPEVPSPGLFHDYLFALT 119

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLL 161
                        + EL LL ++G+G+D   C  TG   D  
Sbjct: 120 ELAQSDNPEPPLRRFELALLSSLGYGVDFLHCAGTGEPVDPA 161


>gi|167586635|ref|ZP_02379023.1| DNA repair protein RecO [Burkholderia ubonensis Bu]
          Length = 255

 Score = 91.0 bits (225), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 34/173 (19%), Positives = 69/173 (39%), Gaps = 19/173 (10%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQ--SHRMQPILQAGNLVRVNWRSRLA 63
            A +L    Y E ++I++V+TR +GR     +  +     ++ +LQ    + ++W  +  
Sbjct: 26  PAFVLHSYPYRETSLIIDVLTRDHGRLALVAKGAKRPHSALRGVLQTFQPLLLSWSGKS- 84

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVP------LFRFLPEREPCLELYDMLNIF 117
                   E+     A+ +   L L G   +        L +F    +P   L++   + 
Sbjct: 85  --------EMRTLTGAEWVGGMLPLAGDALLCGFYANELLVKFCAREDPQPPLFNHYVVT 136

Query: 118 LNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQ-DLLWV-SPKSG 168
           L          ++    E +LL+  G+ + L + V     + D L+V  P+ G
Sbjct: 137 LTRLAHGEPAVQVLRSFERVLLRETGYAMALNRTVARRAVEADRLYVFDPERG 189


>gi|296158232|ref|ZP_06841064.1| DNA repair protein RecO [Burkholderia sp. Ch1-1]
 gi|295891568|gb|EFG71354.1| DNA repair protein RecO [Burkholderia sp. Ch1-1]
          Length = 306

 Score = 91.0 bits (225), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 37/244 (15%), Positives = 85/244 (34%), Gaps = 33/244 (13%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQ--SHRMQPILQAGNLVRVNWRSRLA 63
            A +L    Y E ++I++V++R +GR     +  +     ++ +LQ    + ++W  +  
Sbjct: 77  PAFVLHSYPYRETSLIIDVLSRDHGRLALVAKGAKRPHSALRGVLQTFQPLALSWSGKS- 135

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVP------LFRFLPEREPCLELYDMLNIF 117
                   EV     A+ +   L L G   +        L +F    +P  +L+    + 
Sbjct: 136 --------EVRTLTAAEWVGGMLPLAGDALLCGFYVNELLVKFCAREDPHPQLFHHYVVT 187

Query: 118 LNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVT--QDLLWVSPKSG-GAVCRS 174
           +          ++    E +LL+  G+ + L + V       +      P+ G       
Sbjct: 188 MTRLAHDEPPVQVLRSFERVLLRETGYAMALDRTVARKAVLAEGRYVFDPERGVREASDD 247

Query: 175 VGLPYA----EKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRE 230
           +   +     + +L       +++    A ++  +  L  + LN Y            R+
Sbjct: 248 LPAQWPVIAGQTLL-----DMEQDDYHRAQTVAQSKTLMRFLLNTYL----GGTPLATRQ 298

Query: 231 NFLG 234
             + 
Sbjct: 299 ILID 302


>gi|67641138|ref|ZP_00439923.1| DNA repair protein RecO [Burkholderia mallei GB8 horse 4]
 gi|121600755|ref|YP_993768.1| DNA repair protein RecO [Burkholderia mallei SAVP1]
 gi|124384477|ref|YP_001028766.1| DNA repair protein RecO [Burkholderia mallei NCTC 10229]
 gi|126448568|ref|YP_001081326.1| DNA repair protein RecO [Burkholderia mallei NCTC 10247]
 gi|167000781|ref|ZP_02266588.1| DNA repair protein RecO [Burkholderia mallei PRL-20]
 gi|254178235|ref|ZP_04884890.1| DNA repair protein RecO [Burkholderia mallei ATCC 10399]
 gi|254199234|ref|ZP_04905600.1| DNA repair protein RecO [Burkholderia mallei FMH]
 gi|254205541|ref|ZP_04911893.1| DNA repair protein RecO [Burkholderia mallei JHU]
 gi|254357708|ref|ZP_04973981.1| DNA repair protein RecO [Burkholderia mallei 2002721280]
 gi|61214835|sp|Q62LS7|RECO_BURMA RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|121229565|gb|ABM52083.1| DNA repair protein RecO [Burkholderia mallei SAVP1]
 gi|124292497|gb|ABN01766.1| DNA repair protein RecO [Burkholderia mallei NCTC 10229]
 gi|126241438|gb|ABO04531.1| DNA repair protein RecO [Burkholderia mallei NCTC 10247]
 gi|147748830|gb|EDK55904.1| DNA repair protein RecO [Burkholderia mallei FMH]
 gi|147752984|gb|EDK60049.1| DNA repair protein RecO [Burkholderia mallei JHU]
 gi|148026835|gb|EDK84856.1| DNA repair protein RecO [Burkholderia mallei 2002721280]
 gi|160699274|gb|EDP89244.1| DNA repair protein RecO [Burkholderia mallei ATCC 10399]
 gi|238522003|gb|EEP85450.1| DNA repair protein RecO [Burkholderia mallei GB8 horse 4]
 gi|243063331|gb|EES45517.1| DNA repair protein RecO [Burkholderia mallei PRL-20]
          Length = 275

 Score = 91.0 bits (225), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 33/173 (19%), Positives = 68/173 (39%), Gaps = 19/173 (10%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQ--SHRMQPILQAGNLVRVNWRSRLA 63
            A +L    Y E +++++V+TR +GR     +  +     ++ +LQ    + ++W  +  
Sbjct: 46  PAFVLHSYPYRETSLVIDVLTRDHGRIALVAKGAKRPHSALRGVLQTFQPLSLSWSGKS- 104

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVP------LFRFLPEREPCLELYDMLNIF 117
                   E+     A+ +   L L G   +        L +F    +P   L+    + 
Sbjct: 105 --------ELRTLTGAEWVGGMLPLAGDALLCGFYANELLVKFCAREDPHPPLFQHYLVT 156

Query: 118 LNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQ-DLLWV-SPKSG 168
           L          ++    E +LL+  G+ + L + V     + D L+V  P+ G
Sbjct: 157 LTRLAHGEPPVQVLRSFERVLLRETGYAMTLKRTVARRAVEPDKLYVFDPQRG 209


>gi|253689438|ref|YP_003018628.1| DNA repair protein RecO [Pectobacterium carotovorum subsp.
           carotovorum PC1]
 gi|251756016|gb|ACT14092.1| DNA repair protein RecO [Pectobacterium carotovorum subsp.
           carotovorum PC1]
          Length = 245

 Score = 91.0 bits (225), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 37/160 (23%), Positives = 61/160 (38%), Gaps = 8/160 (5%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVN 57
           M  WQ  A +L  R Y E +++L++ +   GR     +  ++ R  ++  LQ    + V 
Sbjct: 1   MEGWQ-RAFVLHGRPYSETSLLLDLFSESDGRVRVLAKGARARRSSLKGCLQPFTPLLVR 59

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
           W  R  +       E +    A  L+ S+   GL     L R L        L+      
Sbjct: 60  WSGR-GEVKTLRSAEPVSL--ALPLTGSMLYSGLYVNELLSRVLEHETNYSALFFDYLHC 116

Query: 118 LNCHKIPSVIGK-IFVQIELMLLKNIGFGLDLTKCVVTGV 156
           L          +    + EL LL  +G+G+D   C  +G 
Sbjct: 117 LQHLAAQDASPEPALRRFELALLGYLGYGVDFLHCAGSGE 156


>gi|167837345|ref|ZP_02464228.1| DNA repair protein RecO [Burkholderia thailandensis MSMB43]
          Length = 237

 Score = 91.0 bits (225), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 31/180 (17%), Positives = 66/180 (36%), Gaps = 21/180 (11%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQ--SHRMQPILQAGNLVRVNWRSRLA 63
              +L    Y E +++++V+TR +GR     +  +     ++ +LQ    + ++W  +  
Sbjct: 8   PGFVLHSYPYRETSLVVDVLTRDHGRIALVAKGAKRPHSALRGVLQTFQPLSLSWSGKS- 66

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVP------LFRFLPEREPCLELYDMLNIF 117
                   E+     A+ +   L L G   +        L +F    +P   L+    + 
Sbjct: 67  --------ELRTLTGAEWVGGMLPLAGDALLCGFYVNELLVKFCAREDPHPPLFQHYLVT 118

Query: 118 LNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQD--LLWVSPKSGGAVCRSV 175
           L          ++    E +LL+  G+ + L + V     +   L    P+    VC + 
Sbjct: 119 LTRLAHGEPPVQVLRSFERVLLRETGYAMTLKRTVARRAVEPGRLYVFDPQ--RGVCDAG 176


>gi|90580327|ref|ZP_01236134.1| DNA repair protein RecO [Vibrio angustum S14]
 gi|90438629|gb|EAS63813.1| DNA repair protein RecO [Vibrio angustum S14]
          Length = 236

 Score = 90.6 bits (224), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 36/171 (21%), Positives = 62/171 (36%), Gaps = 17/171 (9%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNW 58
           M       +L  R Y E ++IL+V +  +GR     +  +  R  ++  LQ    + + W
Sbjct: 1   MEGLQRCFVLHSRPYSETSLILDVFSEDHGRLTLLSKGARRKRSNLKGTLQPFTPLFMKW 60

Query: 59  RSRLAQNLGEFR-FEVLESHCAKLLSSSLFLYGLQSI----VPLFRFLPEREPCLELYDM 113
             +    +      E +       +   L  Y L S       L R L    P  +L+  
Sbjct: 61  SGK--GAMPVLTHAEPIS------IGLPLRSYILYSAMYVNEILVRVLGNHTPYPQLFLD 112

Query: 114 LNIFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTG--VTQDLLW 162
               L              + EL LL ++G+G+D   C  +G  V  D+ +
Sbjct: 113 YLNVLRELAQADNPEPALRRFELSLLHHLGYGIDFLHCAGSGLSVEDDMTY 163


>gi|167463436|ref|ZP_02328525.1| DNA repair protein RecO [Paenibacillus larvae subsp. larvae
           BRL-230010]
 gi|322383676|ref|ZP_08057427.1| RecO-like protein [Paenibacillus larvae subsp. larvae B-3650]
 gi|321151888|gb|EFX44831.1| RecO-like protein [Paenibacillus larvae subsp. larvae B-3650]
          Length = 250

 Score = 90.6 bits (224), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 39/192 (20%), Positives = 68/192 (35%), Gaps = 20/192 (10%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQ-----PILQAGNLVR 55
           M ++ + IIL    YGE N I+ V+T+  G+     R  +  + +      +L  G  V 
Sbjct: 1   MLYRIEGIILRTVDYGEGNKIITVLTQA-GKVGLMARGAKKVKSRLSAVTQLLIYGEFVF 59

Query: 56  VNWRSRLAQNLGEFR----FEVLESHCAKLLSS-SLFLYGLQSIVPLFRFLPEREPCLEL 110
                     +G        E       +L     L  Y    +  + + LPE E  + L
Sbjct: 60  FKQSG-----MGTLNHADIIEPYH----RLREDIYLSAYASYLVEMVDKMLPEGEANIYL 110

Query: 111 YDMLNIFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGA 170
           ++ L   L   +       +    E+ +L + G+   +  CV  G     +  S   GG 
Sbjct: 111 FEQLKSALKTMEEGKDPQIVVHIFEMAMLASAGYSPVMDVCVSCGSVDGDMMFSSLMGGI 170

Query: 171 VCRSVGLPYAEK 182
           +C        +K
Sbjct: 171 LCPGCTHKDPQK 182


>gi|28899344|ref|NP_798949.1| DNA repair protein RecO [Vibrio parahaemolyticus RIMD 2210633]
 gi|260365943|ref|ZP_05778433.1| DNA repair protein RecO [Vibrio parahaemolyticus K5030]
 gi|260878965|ref|ZP_05891320.1| DNA repair protein RecO [Vibrio parahaemolyticus AN-5034]
 gi|260898318|ref|ZP_05906814.1| DNA repair protein RecO [Vibrio parahaemolyticus Peru-466]
 gi|260899639|ref|ZP_05908034.1| DNA repair protein RecO [Vibrio parahaemolyticus AQ4037]
 gi|31340321|sp|Q87LP1|RECO_VIBPA RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|28807580|dbj|BAC60833.1| DNA repair protein RecO [Vibrio parahaemolyticus RIMD 2210633]
 gi|308085237|gb|EFO34932.1| DNA repair protein RecO [Vibrio parahaemolyticus Peru-466]
 gi|308090490|gb|EFO40185.1| DNA repair protein RecO [Vibrio parahaemolyticus AN-5034]
 gi|308110552|gb|EFO48092.1| DNA repair protein RecO [Vibrio parahaemolyticus AQ4037]
 gi|308113207|gb|EFO50747.1| DNA repair protein RecO [Vibrio parahaemolyticus K5030]
 gi|328474123|gb|EGF44928.1| DNA repair protein RecO [Vibrio parahaemolyticus 10329]
          Length = 243

 Score = 90.6 bits (224), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 36/157 (22%), Positives = 62/157 (39%), Gaps = 17/157 (10%)

Query: 8   IILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNWRSRLAQN 65
            +L  R Y E ++IL+V + +YGR     +  +S R  ++  LQ    + + W  +    
Sbjct: 13  FVLHRRPYSESSLILDVFSEEYGRITLMAKGARSKRSNLKGALQPFTPLLLKWSGK---- 68

Query: 66  LGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLF------RFLPEREPCLELYDMLNIFLN 119
            G  +        A+ +S  L L+G+     ++      R L    P   L+      L 
Sbjct: 69  -GSMK----TLRQAEPISLGLPLFGINLYSAMYVNELVGRVLMAEVPMPALFHDYLHALT 123

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGV 156
                        + EL LL ++G+G+D   C  TG 
Sbjct: 124 ELAQCENPEPALRRFELALLSSMGYGVDFLHCAGTGE 160


>gi|161525338|ref|YP_001580350.1| DNA repair protein RecO [Burkholderia multivorans ATCC 17616]
 gi|189349925|ref|YP_001945553.1| DNA repair protein RecO [Burkholderia multivorans ATCC 17616]
 gi|221201353|ref|ZP_03574392.1| DNA repair protein RecO [Burkholderia multivorans CGD2M]
 gi|221208833|ref|ZP_03581831.1| DNA repair protein RecO [Burkholderia multivorans CGD2]
 gi|160342767|gb|ABX15853.1| DNA repair protein RecO [Burkholderia multivorans ATCC 17616]
 gi|189333947|dbj|BAG43017.1| DNA repair protein [Burkholderia multivorans ATCC 17616]
 gi|221171289|gb|EEE03738.1| DNA repair protein RecO [Burkholderia multivorans CGD2]
 gi|221178621|gb|EEE11029.1| DNA repair protein RecO [Burkholderia multivorans CGD2M]
          Length = 278

 Score = 90.6 bits (224), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 34/173 (19%), Positives = 68/173 (39%), Gaps = 19/173 (10%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQ--SHRMQPILQAGNLVRVNWRSRLA 63
            A +L    Y E ++I++V+TR +GR     +  +     ++ +LQ    + ++W  +  
Sbjct: 49  PAFVLHSYPYRETSLIVDVLTRDHGRLALVAKGAKRPHSALRGVLQTFQPLLLSWSGKS- 107

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVP------LFRFLPEREPCLELYDMLNIF 117
                   EV     A+ +   L L G   +        L +F    +P   L++   + 
Sbjct: 108 --------EVRTLTGAEWVGGMLPLAGDALLCGFYANELLVKFCAREDPQPPLFNHYVLT 159

Query: 118 LNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQ-DLLWV-SPKSG 168
           L          ++    E +LL+  G+ + L + V     + D  +V  P+ G
Sbjct: 160 LTRLAHGEPAVQVLRSFERVLLRETGYAMALNRTVARRAVEPDQRYVFDPERG 212


>gi|221214086|ref|ZP_03587059.1| DNA repair protein RecO [Burkholderia multivorans CGD1]
 gi|221166263|gb|EED98736.1| DNA repair protein RecO [Burkholderia multivorans CGD1]
          Length = 275

 Score = 90.6 bits (224), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 34/173 (19%), Positives = 68/173 (39%), Gaps = 19/173 (10%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQ--SHRMQPILQAGNLVRVNWRSRLA 63
            A +L    Y E ++I++V+TR +GR     +  +     ++ +LQ    + ++W  +  
Sbjct: 46  PAFVLHSYPYRETSLIVDVLTRDHGRLALVAKGAKRPHSALRGVLQTFQPLLLSWSGKS- 104

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVP------LFRFLPEREPCLELYDMLNIF 117
                   EV     A+ +   L L G   +        L +F    +P   L++   + 
Sbjct: 105 --------EVRTLTGAEWVGGMLPLAGDALLCGFYANELLVKFCAREDPQPPLFNHYVLT 156

Query: 118 LNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQ-DLLWV-SPKSG 168
           L          ++    E +LL+  G+ + L + V     + D  +V  P+ G
Sbjct: 157 LTRLAHGEPAVQVLRSFERVLLRETGYAMALNRTVARRAVEPDQRYVFDPERG 209


>gi|227112905|ref|ZP_03826561.1| DNA repair protein RecO [Pectobacterium carotovorum subsp.
           brasiliensis PBR1692]
 gi|227328579|ref|ZP_03832603.1| DNA repair protein RecO [Pectobacterium carotovorum subsp.
           carotovorum WPP14]
          Length = 245

 Score = 90.6 bits (224), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 37/160 (23%), Positives = 61/160 (38%), Gaps = 8/160 (5%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVN 57
           M  WQ  A +L  R Y E +++L++ +   GR     +  ++ R  ++  LQ    + V 
Sbjct: 1   MEGWQ-RAFVLHGRPYSETSLLLDLFSESDGRVRVLAKGARARRSSLKGCLQPFTPLLVR 59

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
           W  R  +       E +    A  L+ S+   GL     L R L        L+      
Sbjct: 60  WSGR-GEVKTLRSAEPVSL--ALPLTGSMLYSGLYVNELLSRVLEHETNYSALFFDYLHC 116

Query: 118 LNCHKIPSVIGK-IFVQIELMLLKNIGFGLDLTKCVVTGV 156
           L          +    + EL LL  +G+G+D   C  +G 
Sbjct: 117 LQHLAAQDASPEPALRRFELALLGYLGYGVDFLHCAGSGE 156


>gi|188533140|ref|YP_001906937.1| DNA repair protein RecO [Erwinia tasmaniensis Et1/99]
 gi|238691986|sp|B2VI48|RECO_ERWT9 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|188028182|emb|CAO96040.1| DNA repair protein RecO [Erwinia tasmaniensis Et1/99]
          Length = 245

 Score = 90.6 bits (224), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 41/167 (24%), Positives = 68/167 (40%), Gaps = 20/167 (11%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVN 57
           M  WQ  A +L  R + E +++L++ + Q+GR     +  ++ R  ++  LQ    + V 
Sbjct: 1   MEGWQ-RAFVLHGRPWSETSLLLDLFSEQHGRVRVLAKGARAKRSSLKGALQPFTPLLVR 59

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLF------RFLPEREPCLEL- 110
           W  R          EV     A+ +S +L L G      L+      R L       EL 
Sbjct: 60  WSGR---------GEVKTLRSAEPVSLALPLSGTTLYCGLYVNELLSRVLQHETAFSELF 110

Query: 111 YDMLNIFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVT 157
           +D LN        P        + EL +L ++G+G+D   C  +G  
Sbjct: 111 FDYLNCIQTLAADPPSPEPALRRFELSMLGHLGYGVDFLHCAGSGEE 157


>gi|313618902|gb|EFR90766.1| DNA repair protein RecO [Listeria innocua FSL S4-378]
          Length = 255

 Score = 90.6 bits (224), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 37/186 (19%), Positives = 69/186 (37%), Gaps = 6/186 (3%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQS--HRMQPILQAGNLVRVNW 58
           M  + + I++   SY E + I+ + TR++G+     R  +    R+  + Q        +
Sbjct: 1   ME-KCEGIVIRQTSYRESDKIVRMYTREFGKIGVVARGAKKTKSRLAAVTQLFTNGYFTF 59

Query: 59  RSRLAQNLGEFR-FEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
                  LG  +  EV+E+  +      +  Y       L +   ER+P   LY++    
Sbjct: 60  FG--GNGLGTLQQGEVIENFSSIQQDIFMTAYATYVCELLDKATEERQPNPYLYELTFQI 117

Query: 118 LNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGL 177
           L           +    E+ +L  +G    + KC + G T      S +S G +C     
Sbjct: 118 LRDIDEGYDPQILTQIYEMKMLPVLGLYPTMDKCAICGETTGHFDFSTRSNGIICHRCFD 177

Query: 178 PYAEKM 183
               +M
Sbjct: 178 KDRYRM 183


>gi|16800565|ref|NP_470833.1| DNA repair protein RecO [Listeria innocua Clip11262]
 gi|20139533|sp|Q92BQ0|RECO_LISIN RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|16413970|emb|CAC96728.1| lin1497 [Listeria innocua Clip11262]
          Length = 255

 Score = 90.6 bits (224), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 37/186 (19%), Positives = 69/186 (37%), Gaps = 6/186 (3%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQS--HRMQPILQAGNLVRVNW 58
           M  + + I++   SY E + I+ + TR++G+     R  +    R+  + Q        +
Sbjct: 1   ME-KCEGIVIRQTSYRESDKIVRMYTREFGKIGVVARGAKKTKSRLAAVTQLFTNGYFTF 59

Query: 59  RSRLAQNLGEFR-FEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
                  LG  +  EV+E+  +      +  Y       L +   ER+P   LY++    
Sbjct: 60  FG--GNGLGTLQQGEVIENFSSIQQDIFMTAYATYVCELLDKATEERQPNPYLYELTFQI 117

Query: 118 LNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGL 177
           L           +    E+ +L  +G    + KC + G T      S +S G +C     
Sbjct: 118 LRDIDEGYDPQILTQIYEMKMLPVLGLYPTMDKCAICGETTGHFDFSTRSNGIICHRCFD 177

Query: 178 PYAEKM 183
               +M
Sbjct: 178 KDRYRM 183


>gi|269965787|ref|ZP_06179884.1| DNA repair protein recO [Vibrio alginolyticus 40B]
 gi|269829655|gb|EEZ83892.1| DNA repair protein recO [Vibrio alginolyticus 40B]
          Length = 243

 Score = 90.6 bits (224), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 36/157 (22%), Positives = 60/157 (38%), Gaps = 17/157 (10%)

Query: 8   IILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNWRSRLAQN 65
            +L  R Y E ++IL+V + +YGR     +  +S R  ++  LQ    + + W  +    
Sbjct: 13  FVLHRRPYSESSLILDVFSEEYGRMTLMAKGARSKRSNLKGALQPFTPLLLKWSGK---- 68

Query: 66  LGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLF------RFLPEREPCLELYDMLNIFLN 119
            G  +        A+ +S  L L G+     ++      R L    P   L+      L 
Sbjct: 69  -GSMK----TLRQAEPISLGLPLTGINLYSAMYVNELIGRILMAEVPMPALFHDYLHALT 123

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGV 156
                        + EL LL  +G+G+D   C  TG 
Sbjct: 124 ELAHNENPEPALRRFELALLSAMGYGVDFLHCAGTGE 160


>gi|315635029|ref|ZP_07890310.1| recombination protein O [Aggregatibacter segnis ATCC 33393]
 gi|315476291|gb|EFU67042.1| recombination protein O [Aggregatibacter segnis ATCC 33393]
          Length = 247

 Score = 90.2 bits (223), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 35/168 (20%), Positives = 70/168 (41%), Gaps = 13/168 (7%)

Query: 2   YWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNWR 59
            WQ    +L  +SY E +++++++T  +GR     +  ++ R  ++ +LQ    + + W 
Sbjct: 14  NWQ-RGFVLHRKSYSETSLLVDLLTEDFGRISVLAKGARAKRSMLKGVLQPFTPLLLRWS 72

Query: 60  SRLAQNLGEFRFEVLESHCAKLL-SSSLFLY-GLQSIVPLFRFLPEREPCLELYDMLNIF 117
            R     G+ +        A  L   ++ LY G      + R L       +L+      
Sbjct: 73  GR-----GDLKILTKAEPAAIALPLQNVALYSGFYLNELICRVLEPETAYPQLFQHYLQC 127

Query: 118 LNCHKIP-SVIGKIFVQIELMLLKNIGFGLDLTKCVVTG--VTQDLLW 162
           L    +  + +       E  LL+ +G+G+D T C  +G  V  D+ +
Sbjct: 128 LTQLALSQTHVEPALRTFEFQLLRTLGYGIDFTHCAGSGKAVEADMTY 175


>gi|209517220|ref|ZP_03266065.1| DNA repair protein RecO [Burkholderia sp. H160]
 gi|209502356|gb|EEA02367.1| DNA repair protein RecO [Burkholderia sp. H160]
          Length = 301

 Score = 90.2 bits (223), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 41/225 (18%), Positives = 84/225 (37%), Gaps = 25/225 (11%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQ--SHRMQPILQAGNLVRVNWRSRLA 63
            A +L    Y E ++I++V++R +GR     +  +     ++ +LQ    + + W  +  
Sbjct: 72  PAFVLHSYPYRETSLIIDVLSRDHGRLALVAKGAKRPHSALRGVLQTFQPLSLAWSGKS- 130

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVP------LFRFLPEREPCLELYDMLNIF 117
                   E+     A+ +   L L G   +        L RF    +P  +L+    + 
Sbjct: 131 --------EMRTLTGAEWVGGMLPLTGDALLCGFYVNELLVRFCAREDPHPQLFHHYVVT 182

Query: 118 LNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVT-GVTQDLLWV-SPKSGGAVCRSV 175
           L          ++    E +LL+  G+ + L + V    V  D  +V  P+ G    R  
Sbjct: 183 LTRLAHDEPPVQVLRSFERVLLRETGYAMALDRTVARKAVLADGRYVFDPERG---VREA 239

Query: 176 GLPYAEKMLVLPS---FLWKEEQTIDADSLKSAFQLTDYFLNKYA 217
              +  +  V+        +++    A ++  +  L  + LN Y 
Sbjct: 240 SDEWPAQWPVVSGQTLLDMEKDDYHRAQTVAQSKTLMRFLLNTYL 284


>gi|47095411|ref|ZP_00233021.1| recombination protein O [Listeria monocytogenes str. 1/2a F6854]
 gi|254898374|ref|ZP_05258298.1| DNA repair protein RecO [Listeria monocytogenes J0161]
 gi|254912134|ref|ZP_05262146.1| recombination protein O [Listeria monocytogenes J2818]
 gi|254936462|ref|ZP_05268159.1| recombination protein O [Listeria monocytogenes F6900]
 gi|47016232|gb|EAL07155.1| recombination protein O [Listeria monocytogenes str. 1/2a F6854]
 gi|258609055|gb|EEW21663.1| recombination protein O [Listeria monocytogenes F6900]
 gi|293590106|gb|EFF98440.1| recombination protein O [Listeria monocytogenes J2818]
          Length = 255

 Score = 90.2 bits (223), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 37/186 (19%), Positives = 68/186 (36%), Gaps = 6/186 (3%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQS--HRMQPILQAGNLVRVNW 58
           M  + + I++   SY E + I+ + TR++G+     R  +    R+  + Q        +
Sbjct: 1   ME-KCEGIVIRQTSYRESDKIVRMYTREFGKIGVVARGAKKTKSRLAAVTQLFTNGYFTF 59

Query: 59  RSRLAQNLGEFR-FEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
                  LG  +  EV+E+  +      +  Y       L +   ER+P   LY++    
Sbjct: 60  FG--GNGLGTLQQGEVIETFSSIQQDIFMTAYATYVCELLDKATEERQPNPYLYELTFQI 117

Query: 118 LNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGL 177
           L           +    E+ +L  +G    + KC + G T      S  S G +C     
Sbjct: 118 LRDIDEGYDPQILTQIYEMKMLPMLGLYPTMDKCAICGETTGHFDFSTSSNGIICHRCFE 177

Query: 178 PYAEKM 183
               +M
Sbjct: 178 KDRYRM 183


>gi|156932892|ref|YP_001436808.1| hypothetical protein ESA_00694 [Cronobacter sakazakii ATCC BAA-894]
 gi|166221891|sp|A7MH01|RECO_ENTS8 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|156531146|gb|ABU75972.1| hypothetical protein ESA_00694 [Cronobacter sakazakii ATCC BAA-894]
          Length = 245

 Score = 90.2 bits (223), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 40/169 (23%), Positives = 65/169 (38%), Gaps = 20/169 (11%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVN 57
           M  WQ  A +L  R + E ++I+++ + + GR     +  +  R  ++  LQ    + V 
Sbjct: 1   MEGWQ-RAFVLHARPWSETSLIIDLFSEESGRVRVVAKGARRKRSNLKGALQPFTPLLVR 59

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPL------FRFL-PEREPCLEL 110
           W  R           V     A+ +S +L L G+     L       R L PE       
Sbjct: 60  WSGRGD---------VKNLTSAEAVSLALPLSGITLYSGLYVNELVARVLEPETRFSELF 110

Query: 111 YDMLNIFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQD 159
           +D L+                 + EL LL ++G+G+D   C  TG   D
Sbjct: 111 FDYLHCIQALAGASGSPEPALRRFELALLGHLGYGVDFLHCAGTGDEVD 159


>gi|307132116|ref|YP_003884132.1| gap repair protein [Dickeya dadantii 3937]
 gi|306529645|gb|ADM99575.1| gap repair protein [Dickeya dadantii 3937]
          Length = 244

 Score = 90.2 bits (223), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 39/160 (24%), Positives = 63/160 (39%), Gaps = 8/160 (5%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVN 57
           M  WQ  A +L  R Y E +++L++ +   GR     +  ++ R  ++  LQ    + V 
Sbjct: 1   MEGWQ-RAFVLHGRPYSETSLLLDLFSENEGRVRVLAKGARARRSSLKGALQPFTPLLVR 59

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
           W  R  +       E +    A  LS  L   GL     L R L        L+      
Sbjct: 60  WGGR-GEVKTLRNAEPVSL--ALPLSGPLLYSGLYVNELLTRVLELETDYSALFFDYLHC 116

Query: 118 LNCHKIPSVIGK-IFVQIELMLLKNIGFGLDLTKCVVTGV 156
           L      S   +    + EL LL+++G+G+D   C  +G 
Sbjct: 117 LQQLAAASGSPEPALRRFELALLEHLGYGVDFLHCAGSGE 156


>gi|16803500|ref|NP_464985.1| DNA repair protein RecO [Listeria monocytogenes EGD-e]
 gi|217964394|ref|YP_002350072.1| DNA repair protein RecO [Listeria monocytogenes HCC23]
 gi|224499690|ref|ZP_03668039.1| DNA repair protein RecO [Listeria monocytogenes Finland 1988]
 gi|254827748|ref|ZP_05232435.1| DNA repair protein recO [Listeria monocytogenes FSL N3-165]
 gi|254829781|ref|ZP_05234436.1| DNA repair protein RecO [Listeria monocytogenes 10403S]
 gi|255030078|ref|ZP_05302029.1| DNA repair protein RecO [Listeria monocytogenes LO28]
 gi|290894222|ref|ZP_06557191.1| DNA repair protein recO [Listeria monocytogenes FSL J2-071]
 gi|20139471|sp|Q8Y752|RECO_LISMO RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|254764641|sp|B8DE51|RECO_LISMH RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|16410889|emb|CAC99538.1| lmo1460 [Listeria monocytogenes EGD-e]
 gi|217333664|gb|ACK39458.1| DNA repair protein RecO [Listeria monocytogenes HCC23]
 gi|258600127|gb|EEW13452.1| DNA repair protein recO [Listeria monocytogenes FSL N3-165]
 gi|290556219|gb|EFD89764.1| DNA repair protein recO [Listeria monocytogenes FSL J2-071]
 gi|307571041|emb|CAR84220.1| DNA repair protein O [Listeria monocytogenes L99]
 gi|313608757|gb|EFR84575.1| DNA repair protein RecO [Listeria monocytogenes FSL F2-208]
          Length = 255

 Score = 90.2 bits (223), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 37/186 (19%), Positives = 68/186 (36%), Gaps = 6/186 (3%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQS--HRMQPILQAGNLVRVNW 58
           M  + + I++   SY E + I+ + TR++G+     R  +    R+  + Q        +
Sbjct: 1   ME-KCEGIVIRQTSYRESDKIVRMYTREFGKIGVVARGAKKTKSRLAAVTQLFTNGYFTF 59

Query: 59  RSRLAQNLGEFR-FEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
                  LG  +  EV+E+  +      +  Y       L +   ER+P   LY++    
Sbjct: 60  FG--GNGLGTLQQGEVIETFSSIQQDIFMTAYATYVCELLDKATEERQPNPYLYELTFQI 117

Query: 118 LNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGL 177
           L           +    E+ +L  +G    + KC + G T      S  S G +C     
Sbjct: 118 LRDIDEGYDPQILTQIYEMKMLPVLGLYPTMDKCAICGETTGHFDFSTSSNGIICHRCFE 177

Query: 178 PYAEKM 183
               +M
Sbjct: 178 KDRYRM 183


>gi|17545784|ref|NP_519186.1| DNA repair protein RecO [Ralstonia solanacearum GMI1000]
 gi|20139464|sp|Q8Y0H9|RECO_RALSO RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|17428078|emb|CAD14767.1| probable dna repair protein reco (recombination protein o)
           [Ralstonia solanacearum GMI1000]
 gi|299067033|emb|CBJ38228.1| DNA repair protein recO (Recombination protein O) [Ralstonia
           solanacearum CMR15]
          Length = 272

 Score = 90.2 bits (223), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 34/157 (21%), Positives = 58/157 (36%), Gaps = 17/157 (10%)

Query: 4   QDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQ--SHRMQPILQAGNLVRVNWRSR 61
           Q  A +L    Y E ++I++V TR +GR     +  +     ++ +LQ    + ++W  R
Sbjct: 41  QQPAFVLHSYPYRETSLIIDVFTRDHGRIALVAKGAKRPHSALRAVLQTFQPLSLSWSGR 100

Query: 62  LAQNLGEFRFEVLESHCAKLLSSSLFLY------GLQSIVPLFRFLPEREPCLELYDMLN 115
                     EV     A+ +   L L       G      L +F+   +    L+    
Sbjct: 101 ---------GEVKTLTRAEWVGGMLPLGGEGLLSGFYLNELLVKFVAREDGHPVLFSHYV 151

Query: 116 IFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCV 152
             LN       +       E +LL+  GF   L +CV
Sbjct: 152 ETLNKLAHGEPVAFTLRAFERVLLRETGFAAQLDRCV 188


>gi|315282356|ref|ZP_07870784.1| DNA repair protein RecO [Listeria marthii FSL S4-120]
 gi|313613998|gb|EFR87714.1| DNA repair protein RecO [Listeria marthii FSL S4-120]
          Length = 255

 Score = 90.2 bits (223), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 37/186 (19%), Positives = 69/186 (37%), Gaps = 6/186 (3%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQS--HRMQPILQAGNLVRVNW 58
           M  + + I++   SY E + I+ + TR++G+     R  +    R+  + Q        +
Sbjct: 1   ME-KCEGIVIRQTSYRESDKIVRMYTREFGKIGVVARGAKKTKSRLAAVTQLFTNGYFTF 59

Query: 59  RSRLAQNLGEFR-FEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
                  LG  +  EV+E+  +      +  Y       L +   ER+P   LY++    
Sbjct: 60  FG--GNGLGTLQQGEVIENFSSIQQDIFMTAYATYVCELLDKATEERQPNPYLYELTFQI 117

Query: 118 LNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGL 177
           L           +    E+ +L  +G    + KC + G T      S +S G +C     
Sbjct: 118 LRDIDEGYDPQILTQIYEMKMLPVLGLYPTMDKCAICGETTGHFDFSTRSNGIICHRCFD 177

Query: 178 PYAEKM 183
               +M
Sbjct: 178 RDRYRM 183


>gi|300691970|ref|YP_003752965.1| DNA repair protein recO (Recombination protein O) [Ralstonia
           solanacearum PSI07]
 gi|299079030|emb|CBJ51692.1| DNA repair protein recO (Recombination protein O) [Ralstonia
           solanacearum PSI07]
          Length = 272

 Score = 90.2 bits (223), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 33/157 (21%), Positives = 58/157 (36%), Gaps = 17/157 (10%)

Query: 4   QDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQ--SHRMQPILQAGNLVRVNWRSR 61
           Q  A +L    Y E ++I++V TR +GR     +  +     ++ +LQ    + ++W  R
Sbjct: 41  QQPAFVLHSYPYRETSLIIDVFTRDHGRIALVAKGAKRPHSALRAVLQTFQPLSLSWSGR 100

Query: 62  LAQNLGEFRFEVLESHCAKLLSSSLFLY------GLQSIVPLFRFLPEREPCLELYDMLN 115
                     EV     A+ +   L L       G      L +F+   +    L+    
Sbjct: 101 ---------GEVKTLTRAEWVGGMLPLGGEGLLSGFYLNELLVKFVAREDGHPVLFSHYV 151

Query: 116 IFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCV 152
             LN       +       E +LL+  GF   L +C+
Sbjct: 152 ETLNKLAHGEPVAFTLRAFERVLLRETGFAAQLDRCI 188


>gi|254230526|ref|ZP_04923897.1| DNA repair protein RecO [Vibrio sp. Ex25]
 gi|262393272|ref|YP_003285126.1| DNA recombination and repair protein RecO [Vibrio sp. Ex25]
 gi|151936951|gb|EDN55838.1| DNA repair protein RecO [Vibrio sp. Ex25]
 gi|262336866|gb|ACY50661.1| DNA recombination and repair protein RecO [Vibrio sp. Ex25]
          Length = 243

 Score = 90.2 bits (223), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 36/157 (22%), Positives = 61/157 (38%), Gaps = 17/157 (10%)

Query: 8   IILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNWRSRLAQN 65
            +L  R Y E ++IL+V + +YGR     +  +S R  ++  LQ    + + W  +    
Sbjct: 13  FVLHRRPYSESSLILDVFSEEYGRMTLMAKGARSKRSNLKGALQPFTPLLLKWSGK---- 68

Query: 66  LGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLF------RFLPEREPCLELYDMLNIFLN 119
            G  +        A+ +S  L L G+     ++      R L    P   L+      L 
Sbjct: 69  -GSMK----TLRQAEPISLGLPLTGINLYSAMYVNELIGRILMAEVPMPALFHDYLHALT 123

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGV 156
                        + EL LL ++G+G+D   C  TG 
Sbjct: 124 ELAHNENPEPALRRFELALLSSMGYGVDFLHCAGTGE 160


>gi|299822894|ref|ZP_07054780.1| recombination protein O [Listeria grayi DSM 20601]
 gi|299816423|gb|EFI83661.1| recombination protein O [Listeria grayi DSM 20601]
          Length = 255

 Score = 90.2 bits (223), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 33/186 (17%), Positives = 69/186 (37%), Gaps = 6/186 (3%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQS--HRMQPILQAGNLVRVNW 58
           M  + + I++    Y E + I+ + TR++G+     R  +    R+  + Q        +
Sbjct: 1   ME-KCEGIVIRQTDYRESDKIVVLYTREFGKIGVVARGAKKTKSRLAAVTQPFVNGYFTF 59

Query: 59  RSRLAQNLGEFR-FEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
            +  +  LG  +  E++++  +      L  Y       L +   E+     LY+++   
Sbjct: 60  FA--SSGLGTLQQGELIQNFSSIQQDIFLTAYAAYICELLDKATDEKRANPSLYELVFQI 117

Query: 118 LNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGL 177
           L           +    E+ +L  +GF   + KC + G T      S  S G +C     
Sbjct: 118 LRDIDEGYDPEILVQLFEMKMLPVMGFYPVMDKCAICGETTGHFDFSTHSDGIICHRCFE 177

Query: 178 PYAEKM 183
               ++
Sbjct: 178 KDPYRL 183


>gi|300704605|ref|YP_003746208.1| DNA repair protein reco (recombination protein o) [Ralstonia
           solanacearum CFBP2957]
 gi|299072269|emb|CBJ43602.1| DNA repair protein recO (Recombination protein O) [Ralstonia
           solanacearum CFBP2957]
          Length = 272

 Score = 89.8 bits (222), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 33/157 (21%), Positives = 58/157 (36%), Gaps = 17/157 (10%)

Query: 4   QDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQ--SHRMQPILQAGNLVRVNWRSR 61
           Q  A +L    Y E ++I++V TR +GR     +  +     ++ +LQ    + ++W  R
Sbjct: 41  QQPAFVLHSYPYRETSLIIDVFTRDHGRVALVAKGAKRPHSALRAVLQTFQPLSLSWSGR 100

Query: 62  LAQNLGEFRFEVLESHCAKLLSSSLFLY------GLQSIVPLFRFLPEREPCLELYDMLN 115
                     EV     A+ +   L L       G      L +F+   +    L+    
Sbjct: 101 ---------GEVKTLTRAEWVGGMLPLGGEGLLSGFYLNELLVKFVAREDGHPVLFSHYV 151

Query: 116 IFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCV 152
             LN       +       E +LL+  GF   L +C+
Sbjct: 152 DTLNKLAHGEPVAFTLRAFERVLLRETGFAARLDRCI 188


>gi|89075086|ref|ZP_01161527.1| DNA repair protein RecO [Photobacterium sp. SKA34]
 gi|89049173|gb|EAR54738.1| DNA repair protein RecO [Photobacterium sp. SKA34]
          Length = 236

 Score = 89.8 bits (222), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 35/171 (20%), Positives = 62/171 (36%), Gaps = 17/171 (9%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNW 58
           M       +L  R Y E ++IL+V +  +GR     +  +  R  ++  LQ    + + W
Sbjct: 1   MEGLQRCFVLHSRPYSETSLILDVFSEDHGRLTLLSKGARRKRSNLKGTLQPFTPLFMKW 60

Query: 59  RSRLAQNLGEFR-FEVLESHCAKLLSSSLFLYGLQSI----VPLFRFLPEREPCLELYDM 113
             +    +      E +       +   L  Y L S       L R L    P  +L+  
Sbjct: 61  SGK--GAMPVLTHAEPIS------IGLPLRSYILYSAMYVNEILVRVLGNHTPYPQLFLD 112

Query: 114 LNIFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTG--VTQDLLW 162
               L              + EL LL ++G+G+D   C  +G  V  ++ +
Sbjct: 113 YLNVLRELAQADNPEPALRRFELSLLHHLGYGIDFLHCAGSGLSVEDNMTY 163


>gi|284006741|emb|CBA71998.1| DNA repair protein [Arsenophonus nasoniae]
          Length = 237

 Score = 89.8 bits (222), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 39/163 (23%), Positives = 65/163 (39%), Gaps = 19/163 (11%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNWRS 60
           WQ  A +L  R Y E +++L+  T   GR     +  +S R  ++  LQ    + + W  
Sbjct: 4   WQ-RAFVLHTRPYSETSLLLDFFTENEGRIRLLAKGARSRRSNLKGCLQPFTPLLIRWGG 62

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLF-----LY-GLQSIVPLFRFLPEREPCLELYDML 114
           +          E+     A+ +S +L      LY GL     L R L +  P   L+   
Sbjct: 63  K---------GEMKTLRSAEPISLALPFTGTVLYSGLYVNELLARVLAQNIPYQSLFFEY 113

Query: 115 NIFLNCHKIPSVIGKIFV-QIELMLLKNIGFGLDLTKCVVTGV 156
              L          +  + + EL LL ++G+G+D   C  +G 
Sbjct: 114 LTCLQILAGSESTPEHALRRFELSLLSHLGYGVDFLHCSGSGE 156


>gi|260771920|ref|ZP_05880838.1| DNA recombination and repair protein RecO [Vibrio metschnikovii CIP
           69.14]
 gi|260613212|gb|EEX38413.1| DNA recombination and repair protein RecO [Vibrio metschnikovii CIP
           69.14]
          Length = 241

 Score = 89.8 bits (222), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 34/157 (21%), Positives = 58/157 (36%), Gaps = 17/157 (10%)

Query: 8   IILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNWRSRLAQN 65
            +L  R Y E ++IL+V + +YGR     +  +  R  ++  LQ    + + W       
Sbjct: 9   FVLNRRPYSESSLILDVFSEEYGRLTLMAKGARGKRSQLKGALQPFTPLLLKWSGNST-- 66

Query: 66  LGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLF------RFLPEREPCLELYDMLNIFLN 119
                  +     A+ +S  L L G+     ++      R L    P   L+      L 
Sbjct: 67  -------MKTLRQAESISLGLPLSGISLYSAMYVNELVGRVLANDVPSPALFHDYLFALT 119

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGV 156
                        + EL LL ++G+G+D   C  TG 
Sbjct: 120 ELAQSDNPEPALRRFELALLSSLGYGVDFLHCAGTGE 156


>gi|260598948|ref|YP_003211519.1| DNA repair protein recO [Cronobacter turicensis z3032]
 gi|260218125|emb|CBA32921.1| DNA repair protein recO [Cronobacter turicensis z3032]
          Length = 245

 Score = 89.8 bits (222), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 40/169 (23%), Positives = 65/169 (38%), Gaps = 20/169 (11%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVN 57
           M  WQ  A +L  R + E ++I+++ + + GR     +  +  R  ++  LQ    + V 
Sbjct: 1   MEGWQ-RAFVLHARPWSETSLIIDLFSEESGRVRVVAKGARRKRSNLKGALQPFTPLLVR 59

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPL------FRFL-PEREPCLEL 110
           W  R           V     A+ +S +L L G+     L       R L PE       
Sbjct: 60  WSGRGD---------VKNLTSAEAVSLALPLSGITLYSGLYVNELVARVLEPETRFSELF 110

Query: 111 YDMLNIFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQD 159
           +D L+                 + EL LL ++G+G+D   C  TG   D
Sbjct: 111 FDYLHCIQALAGATGTPEPALRRFELALLGHLGYGVDFLHCAGTGDEVD 159


>gi|328474972|gb|EGF45766.1| DNA repair protein RecO [Listeria monocytogenes 220]
          Length = 254

 Score = 89.8 bits (222), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 37/185 (20%), Positives = 69/185 (37%), Gaps = 5/185 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQ-SHRMQPILQAGNLVRVNWR 59
           M  + + I++   SY E + I+ + TR++G+     R  +   R+  + Q        + 
Sbjct: 1   ME-KCEGIVIRQTSYRESDKIVRMYTREFGKIGVVARGAKTKSRLAAVTQLFTNGYFTFF 59

Query: 60  SRLAQNLGEFR-FEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFL 118
              +  LG  +  EV+E+  +      +  Y       L +   ER+P   LY++    L
Sbjct: 60  G--SNGLGTLQQGEVIENFSSIQQDIFMTAYATYVCELLDKATEERQPNPYLYELTFQIL 117

Query: 119 NCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
                      +    E+ +L  +G    + KC + G T      S  S G +C      
Sbjct: 118 RDINEGYDPQILTQIFEMKMLPVLGLYPTMDKCAICGETTGHFDFSTSSNGIICHRCFEK 177

Query: 179 YAEKM 183
              +M
Sbjct: 178 DRYRM 182


>gi|37681013|ref|NP_935622.1| DNA repair protein RecO [Vibrio vulnificus YJ016]
 gi|42559437|sp|Q7MHP0|RECO_VIBVY RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|37199763|dbj|BAC95593.1| Recombinational DNA repair protein [Vibrio vulnificus YJ016]
          Length = 243

 Score = 89.8 bits (222), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 36/157 (22%), Positives = 61/157 (38%), Gaps = 17/157 (10%)

Query: 8   IILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNWRSRLAQN 65
            +L  R Y E ++IL+V + ++GR     +  +S R  ++  LQ    + + W  + A  
Sbjct: 11  FVLHRRPYSESSLILDVFSEEFGRITLMSKGARSKRSNLKGALQPFTPLLLKWSGKGA-- 68

Query: 66  LGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLF------RFLPEREPCLELYDMLNIFLN 119
                  +     A+ +S  L L G+     L+      R L +  P   L+      L 
Sbjct: 69  -------MKTLRQAEPISLGLPLTGINLYSALYVNELIGRVLMQEVPMPGLFHDYLFALT 121

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGV 156
                        + EL LL  +G+G+D   C  TG 
Sbjct: 122 ELAQADNPEPALRRFELALLAAMGYGVDFLHCAGTGE 158


>gi|256821982|ref|YP_003145945.1| DNA repair protein RecO [Kangiella koreensis DSM 16069]
 gi|256795521|gb|ACV26177.1| DNA repair protein RecO [Kangiella koreensis DSM 16069]
          Length = 239

 Score = 89.8 bits (222), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 31/150 (20%), Positives = 60/150 (40%), Gaps = 18/150 (12%)

Query: 7   AIILGVRSYGEKNIILEVMTRQYGRHLGF---VRNGQSHRMQPILQAGNLVRVNWRSRLA 63
           A +L  R + E ++I+E+ T + GR       VR  + +  + +LQ    ++V+W  R  
Sbjct: 9   AFVLHTRPFKETSLIVELFTEESGRVNVLAKGVRGNRKNSNRALLQPFQPIKVSWFGRS- 67

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPER------EPCLELYDMLNIF 117
                   E+      +    S  L G+ S+  L+            +P  +++      
Sbjct: 68  --------ELKTLKQVEADGFSHRLNGIASLSALYLNELLLRLFIQWDPHPDIFHFYQTS 119

Query: 118 LNCHKIPSVIGKIFVQIELMLLKNIGFGLD 147
           L   ++      I  + EL LL  +G+ +D
Sbjct: 120 LQHLQLGDKPNLILREFELELLDVLGYAID 149


>gi|238762799|ref|ZP_04623768.1| DNA repair protein recO [Yersinia kristensenii ATCC 33638]
 gi|238699104|gb|EEP91852.1| DNA repair protein recO [Yersinia kristensenii ATCC 33638]
          Length = 241

 Score = 89.4 bits (221), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 38/168 (22%), Positives = 67/168 (39%), Gaps = 10/168 (5%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVN 57
           M  WQ  A +L  R Y E +++L++ T   GR     +  +  R  ++  LQ    + V 
Sbjct: 1   MEGWQ-RAFVLHGRPYSETSLMLDLFTEGEGRMRVLAKGARGRRSNLKGCLQPFTPLLVR 59

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
           W  R  +       E +    A  L+ S+   GL     L R L  +     L+      
Sbjct: 60  WTGR-GEVKTLRSAEPVSL--ALPLTGSMLYSGLYVNELLARVLEHQTNYSALFFDYLHC 116

Query: 118 LNCHKIPSVIGKIFVQ-IELMLLKNIGFGLDLTKCVVTG--VTQDLLW 162
           L          +  ++  EL +L ++G+G+D   C  +G  V+  + +
Sbjct: 117 LQSLAGSDGSPEYALRQFELAILAHLGYGVDFLHCAGSGQPVSDSMTY 164


>gi|313623741|gb|EFR93883.1| DNA repair protein RecO [Listeria innocua FSL J1-023]
          Length = 255

 Score = 89.4 bits (221), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 37/186 (19%), Positives = 68/186 (36%), Gaps = 6/186 (3%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQS--HRMQPILQAGNLVRVNW 58
           M  + + I++   SY E + I+ + TR++G+     R  +    R+  + Q        +
Sbjct: 1   ME-KCEGIVIRQTSYRESDKIVRMYTREFGKIGVVARGAKKTKSRLAAVTQLFTNGYFTF 59

Query: 59  RSRLAQNLGEFR-FEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
                  LG  +  EV+E+         +  Y       L +   ER+P   LY++    
Sbjct: 60  FG--GNGLGTLQQGEVIENFSFIQQDIFMTAYATYVCELLDKATEERQPNPYLYELTFQI 117

Query: 118 LNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGL 177
           L           +    E+ +L  +G    + KC + G T      S +S G +C     
Sbjct: 118 LRDIDEGYDPQILTQIYEMKMLPVLGLYPTMDKCAICGETTGHFDFSTRSNGIICHRCFD 177

Query: 178 PYAEKM 183
               +M
Sbjct: 178 KDRYRM 183


>gi|295399212|ref|ZP_06809194.1| DNA repair protein RecO [Geobacillus thermoglucosidasius C56-YS93]
 gi|294978678|gb|EFG54274.1| DNA repair protein RecO [Geobacillus thermoglucosidasius C56-YS93]
          Length = 264

 Score = 89.4 bits (221), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 38/187 (20%), Positives = 71/187 (37%), Gaps = 8/187 (4%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQ--SHRMQPILQAGNL-VRVNWRSRL 62
           +AI++    YGE N I+   TR++G+     R  +  S R+  + Q       +  RSR 
Sbjct: 6   EAIVIRATDYGETNKIVTFFTREWGKVAAMARGAKKPSSRLSAVTQLFTYGYYLIQRSR- 64

Query: 63  AQNLGEF-RFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCH 121
              +G   + ++++S  A         Y    +    +   E++    L+++L   L   
Sbjct: 65  --GVGVLQQGDIIDSMRATREDIFTAAYASYIVELTDKITEEQQRNPYLFELLLQTLQYM 122

Query: 122 KIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAE 181
                +  +    E  +L  +G    L  C + G T+     S K  G +C      Y  
Sbjct: 123 NEGRDLEILASIYETKMLSVMGIPPKLDYCAICGRTEGKFSFSIKEAGFLCHRC-EQYDP 181

Query: 182 KMLVLPS 188
             + L +
Sbjct: 182 HRIPLSA 188


>gi|114567078|ref|YP_754232.1| DNA repair protein [Syntrophomonas wolfei subsp. wolfei str.
           Goettingen]
 gi|119361496|sp|Q0AWP3|RECO_SYNWW RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|114338013|gb|ABI68861.1| DNA replication and repair protein RecO [Syntrophomonas wolfei
           subsp. wolfei str. Goettingen]
          Length = 250

 Score = 89.4 bits (221), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 50/238 (21%), Positives = 86/238 (36%), Gaps = 33/238 (13%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQA-------- 50
           MY +  AI++    Y E + ++ +     G+     R  +  R  ++  +Q         
Sbjct: 1   MYLRSRAIVIKNMDYRESDKLVTIFCEHEGKMKAVARGIKKPRSSLRACVQPFCHSSLFF 60

Query: 51  --GNLVRVNWRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCL 108
             G  + +  + +L    G  R +   S           LY L  +  L + L E     
Sbjct: 61  SRGKGMNLITQGKLLDFYGNTREDFERS-----------LYALYLMELLDKSLMEGVAIP 109

Query: 109 ELYDMLNIFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSG 168
            LY      L+          +    E+ LL N+G+   L  CV+ G   DL   S   G
Sbjct: 110 RLYTSTLEVLSHLNHSGYNPMLIRYFEMNLLVNLGYSPLLDHCVLCGKKDDLKVFSLPDG 169

Query: 169 GAVCR------SVGLPYAEKMLVLPSFLWKEEQTIDADSLK---SAFQLTDYFLNKYA 217
           G +CR      S  +  +++ L L   L    +    + ++    A +  +YFL KY 
Sbjct: 170 GMLCRDCSYQASGAVSLSKETLAL-ISLLGRSRLATVERVRVSNKAQKELEYFLEKYL 226


>gi|284801847|ref|YP_003413712.1| DNA repair protein RecO [Listeria monocytogenes 08-5578]
 gi|284994989|ref|YP_003416757.1| DNA repair protein RecO [Listeria monocytogenes 08-5923]
 gi|284057409|gb|ADB68350.1| DNA repair protein RecO [Listeria monocytogenes 08-5578]
 gi|284060456|gb|ADB71395.1| DNA repair protein RecO [Listeria monocytogenes 08-5923]
          Length = 255

 Score = 89.4 bits (221), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 37/186 (19%), Positives = 69/186 (37%), Gaps = 6/186 (3%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQS--HRMQPILQAGNLVRVNW 58
           M  + + I++   SY E + I+ + TR++G+     R  +    R+  + Q        +
Sbjct: 1   ME-KCEGIVIRQTSYRESDKIVRMYTREFGKIGVVARGAKKTKSRLAAVTQLFTNGYFTF 59

Query: 59  RSRLAQNLGEFR-FEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
               +  LG  +  EV+E+  +      +  Y       L +   ER+P   LY++    
Sbjct: 60  FG--SNGLGTLQQGEVIENFSSIQQDIFMTAYATYVCELLDKATEERQPNPYLYELTFQI 117

Query: 118 LNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGL 177
           L           +    E+ +L  +G    + KC + G T      S  S G +C     
Sbjct: 118 LRDIDEGYDPQILTQIYEMKMLPVLGLYPTMDKCAICGETTGHFDFSTSSNGIICHRCFE 177

Query: 178 PYAEKM 183
               +M
Sbjct: 178 KDRYRM 183


>gi|295677174|ref|YP_003605698.1| DNA repair protein RecO [Burkholderia sp. CCGE1002]
 gi|295437017|gb|ADG16187.1| DNA repair protein RecO [Burkholderia sp. CCGE1002]
          Length = 301

 Score = 89.4 bits (221), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 35/187 (18%), Positives = 70/187 (37%), Gaps = 22/187 (11%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQ--SHRMQPILQAGNLVRVNWRSRLA 63
            A +L    Y E ++I++V++R +GR     +  +     ++ +LQ    + + W  +  
Sbjct: 72  PAFVLHSYPYRETSLIIDVLSRDHGRLALVAKGAKRPHSALRGVLQTFQPLSLAWSGKS- 130

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVP------LFRFLPEREPCLELYDMLNIF 117
                   E+     A+ +   L L G   +        L RF    +P  +L+    + 
Sbjct: 131 --------EMRTLTGAEWVGGMLPLTGDALLCGFYVNELLVRFCAREDPHPQLFHHYVVT 182

Query: 118 LNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVT-GVTQDLLWV-SPKSGGAVCRSV 175
           L          ++    E +LL+  G+ + L + V    V  D  +V  P+ G    R  
Sbjct: 183 LTRLAHDEPPVQVLRSFERVLLRETGYAMALDRTVARKAVLADGRYVFDPERG---VREA 239

Query: 176 GLPYAEK 182
              +  +
Sbjct: 240 SDEWPAQ 246


>gi|153839962|ref|ZP_01992629.1| DNA repair protein RecO [Vibrio parahaemolyticus AQ3810]
 gi|149746521|gb|EDM57510.1| DNA repair protein RecO [Vibrio parahaemolyticus AQ3810]
          Length = 162

 Score = 89.4 bits (221), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 36/157 (22%), Positives = 62/157 (39%), Gaps = 17/157 (10%)

Query: 8   IILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNWRSRLAQN 65
            +L  R Y E ++IL+V + +YGR     +  +S R  ++  LQ    + + W  +    
Sbjct: 13  FVLHRRPYSESSLILDVFSEEYGRITLMAKGARSKRSNLKGALQPFTPLLLKWSGK---- 68

Query: 66  LGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLF------RFLPEREPCLELYDMLNIFLN 119
            G  +        A+ +S  L L+G+     ++      R L    P   L+      L 
Sbjct: 69  -GSMK----TLRQAEPISLGLPLFGINLYSAMYVNELVGRVLMAEVPMPALFHDYLHALT 123

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGV 156
                        + EL LL ++G+G+D   C  TG 
Sbjct: 124 ELAQCENPEPALRRFELALLSSMGYGVDFLHCAGTGE 160


>gi|319651592|ref|ZP_08005719.1| DNA repair protein RecO [Bacillus sp. 2_A_57_CT2]
 gi|317396659|gb|EFV77370.1| DNA repair protein RecO [Bacillus sp. 2_A_57_CT2]
          Length = 250

 Score = 89.4 bits (221), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 35/181 (19%), Positives = 70/181 (38%), Gaps = 11/181 (6%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQS--HRMQPILQA---GNLVR 55
           M  + + I++   +Y E N I+ + TR++G+     R  +    R+  + Q    GN + 
Sbjct: 1   MLDKCEGIVIRTTNYSETNKIVTLYTREWGKVGVMARGAKKPNSRLAAVTQLFTYGNFLV 60

Query: 56  VNWRSRLAQNLGEFR-FEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDML 114
                     LG  +  +++ S  +      L  Y    +    + + +++P   L+++L
Sbjct: 61  QRGSG-----LGTLQQGDMISSMRSIKEDIFLTAYASYIVDLTDKSIEDKKPNPFLFELL 115

Query: 115 NIFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRS 174
              LN          +    E+ +L  +G    L +C V G T      S +  G +C  
Sbjct: 116 YQTLNLINEGYDPEILTNIYEMKMLNALGLYPVLDQCSVCGSTDGHFAFSIRENGLICHR 175

Query: 175 V 175
            
Sbjct: 176 C 176


>gi|294637609|ref|ZP_06715889.1| DNA repair protein RecO [Edwardsiella tarda ATCC 23685]
 gi|291089239|gb|EFE21800.1| DNA repair protein RecO [Edwardsiella tarda ATCC 23685]
          Length = 243

 Score = 89.4 bits (221), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 39/171 (22%), Positives = 66/171 (38%), Gaps = 21/171 (12%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNWRS 60
           WQ  A +L  R Y E +++L+  T   GR     +  +S R  ++  LQ    + + W  
Sbjct: 5   WQ-RAFVLHARPYSETSLLLDTFTEGQGRVRLLAKGARSRRSQLKGALQPFTPLLIRWGG 63

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSI------VPLFRFLPEREPCLEL-YDM 113
           +          EV     A+ +S +L L G+           L R L +      L +D 
Sbjct: 64  K---------GEVKTLRSAEAVSLALPLSGITLYSGLYVNELLARVLEQETCYSALFFDY 114

Query: 114 LNIFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTG--VTQDLLW 162
           L+              +  + EL LL  +G+G+D   C  +G  V   + +
Sbjct: 115 LHCIQQLAGHSGSPEPVLRRFELALLAQLGYGIDFLHCAGSGEPVADGMTY 165


>gi|238026619|ref|YP_002910850.1| DNA repair protein RecO [Burkholderia glumae BGR1]
 gi|237875813|gb|ACR28146.1| DNA repair protein RecO [Burkholderia glumae BGR1]
          Length = 281

 Score = 89.4 bits (221), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 34/173 (19%), Positives = 66/173 (38%), Gaps = 19/173 (10%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQ--SHRMQPILQAGNLVRVNWRSRLA 63
              +L    Y E ++I++V+TR +GR     +  +     ++ +LQ    + ++W  +  
Sbjct: 52  PGFVLHSHPYRETSLIIDVLTRDHGRVALVAKGAKRPHSALRGVLQTFQPLALSWSGKS- 110

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVP------LFRFLPEREPCLELYDMLNIF 117
                   E+     A+ +   L L G   +        L +F    +P   L+    + 
Sbjct: 111 --------EMRTLTGAEWVGGMLPLGGDALLCGFYVNELLVKFCAREDPFPALFQHYLVT 162

Query: 118 LNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVV-TGVTQDLLWV-SPKSG 168
           L          ++    E +LL+  G+   L + V    VT D  +V  P+ G
Sbjct: 163 LARLAHDEPAVQVLRSFERVLLRETGYARALNRTVARRAVTADGRYVFDPERG 215


>gi|187924873|ref|YP_001896515.1| DNA repair protein RecO [Burkholderia phytofirmans PsJN]
 gi|187716067|gb|ACD17291.1| DNA repair protein RecO [Burkholderia phytofirmans PsJN]
          Length = 309

 Score = 89.4 bits (221), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 28/156 (17%), Positives = 61/156 (39%), Gaps = 17/156 (10%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQ--SHRMQPILQAGNLVRVNWRSRLA 63
            A +L    Y E ++I++V++R +GR     +  +     ++ +LQ    + ++W  +  
Sbjct: 80  PAFVLHSYPYRETSLIIDVLSRDHGRLALVAKGAKRPHSALRGVLQTFQPLALSWSGKS- 138

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVP------LFRFLPEREPCLELYDMLNIF 117
                   EV     A+ +   L L G   +        L +F    +P  +L+    + 
Sbjct: 139 --------EVRTLTGAEWVGGMLPLAGDALLCGFYVNELLVKFCAREDPHPQLFHHYVVT 190

Query: 118 LNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVV 153
           +          ++    E +LL+  G+ + L + V 
Sbjct: 191 MTRLAHDEPPVQVLRSFERVLLRETGYAMALDRTVA 226


>gi|46907688|ref|YP_014077.1| DNA repair protein RecO [Listeria monocytogenes serotype 4b str.
           F2365]
 gi|47093467|ref|ZP_00231230.1| recombination protein O [Listeria monocytogenes str. 4b H7858]
 gi|226224061|ref|YP_002758168.1| RecO protein [Listeria monocytogenes Clip81459]
 gi|254824481|ref|ZP_05229482.1| recombination protein O [Listeria monocytogenes FSL J1-194]
 gi|254852085|ref|ZP_05241433.1| recombination protein O [Listeria monocytogenes FSL R2-503]
 gi|254932645|ref|ZP_05266004.1| recombination protein O [Listeria monocytogenes HPB2262]
 gi|255521275|ref|ZP_05388512.1| DNA repair protein RecO [Listeria monocytogenes FSL J1-175]
 gi|300765603|ref|ZP_07075582.1| recombination protein O [Listeria monocytogenes FSL N1-017]
 gi|61215088|sp|Q71ZL0|RECO_LISMF RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|259563681|sp|C1KVA7|RECO_LISMC RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|46880957|gb|AAT04254.1| recombination protein O [Listeria monocytogenes serotype 4b str.
           F2365]
 gi|47018143|gb|EAL08913.1| recombination protein O [Listeria monocytogenes str. 4b H7858]
 gi|225876523|emb|CAS05232.1| Putative RecO protein [Listeria monocytogenes serotype 4b str. CLIP
           80459]
 gi|258605384|gb|EEW17992.1| recombination protein O [Listeria monocytogenes FSL R2-503]
 gi|293584204|gb|EFF96236.1| recombination protein O [Listeria monocytogenes HPB2262]
 gi|293593719|gb|EFG01480.1| recombination protein O [Listeria monocytogenes FSL J1-194]
 gi|300513704|gb|EFK40772.1| recombination protein O [Listeria monocytogenes FSL N1-017]
 gi|328465503|gb|EGF36732.1| DNA repair protein RecO [Listeria monocytogenes 1816]
 gi|332311901|gb|EGJ24996.1| DNA repair protein RecO [Listeria monocytogenes str. Scott A]
          Length = 255

 Score = 89.4 bits (221), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 37/186 (19%), Positives = 69/186 (37%), Gaps = 6/186 (3%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQS--HRMQPILQAGNLVRVNW 58
           M  + + I++   SY E + I+ + TR++G+     R  +    R+  + Q        +
Sbjct: 1   ME-KCEGIVIRQTSYRESDKIVRMYTREFGKIGVVARGAKKTKSRLAAVTQLFTNGYFTF 59

Query: 59  RSRLAQNLGEFR-FEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
               +  LG  +  EV+E+  +      +  Y       L +   ER+P   LY++    
Sbjct: 60  FG--SNGLGTLQQGEVIENFSSIQQDIFMTAYATYVCELLDKATEERQPNPYLYELTFQI 117

Query: 118 LNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGL 177
           L           +    E+ +L  +G    + KC + G T      S  S G +C     
Sbjct: 118 LRDINEGYDPQILTQIFEMKMLPVLGLYPTMDKCAICGETTGHFDFSTSSNGIICHRCFE 177

Query: 178 PYAEKM 183
               +M
Sbjct: 178 KDRYRM 183


>gi|170695424|ref|ZP_02886569.1| DNA repair protein RecO [Burkholderia graminis C4D1M]
 gi|170139615|gb|EDT07798.1| DNA repair protein RecO [Burkholderia graminis C4D1M]
          Length = 307

 Score = 89.4 bits (221), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 38/244 (15%), Positives = 86/244 (35%), Gaps = 33/244 (13%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQ--SHRMQPILQAGNLVRVNWRSRLA 63
            A +L    Y E ++I++V++R +GR     +  +     ++ +LQ    + ++W  +  
Sbjct: 78  PAFVLHSYPYRETSLIIDVLSRDHGRLALVAKGAKRPHSALRGVLQTFQPLALSWSGKS- 136

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVP------LFRFLPEREPCLELYDMLNIF 117
                   EV     A+ +   L L G   +        L +F    +P  +L+    + 
Sbjct: 137 --------EVRTLTGAEWVGGMLPLTGDALLCGFYVNELLVKFCAREDPHPQLFHHYVVT 188

Query: 118 LNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQ-DLLWV-SPKSG-GAVCRS 174
           +          ++    E +LL+  G+ + L + V          +V  P+ G       
Sbjct: 189 MTRLAHDEPPVQVLRSFERVLLRETGYAMSLDRTVTRKAVDAGKRYVFDPERGVREASDD 248

Query: 175 VGLPYA----EKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRE 230
           +   +     + +L       +++    A ++  +  L  + LN Y            R+
Sbjct: 249 LPAQWPVVAGQTLL-----DMEQDDYHRAQTVAQSKTLMRFLLNTYL----GGTPLATRQ 299

Query: 231 NFLG 234
             + 
Sbjct: 300 ILID 303


>gi|109900011|ref|YP_663266.1| DNA repair protein RecO [Pseudoalteromonas atlantica T6c]
 gi|119361472|sp|Q15PH6|RECO_PSEA6 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|109702292|gb|ABG42212.1| DNA replication and repair protein RecO [Pseudoalteromonas
           atlantica T6c]
          Length = 240

 Score = 89.0 bits (220), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 32/153 (20%), Positives = 62/153 (40%), Gaps = 7/153 (4%)

Query: 7   AIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNWRSRLAQ 64
             +L  R+Y E + ++ + T + G+    V+  +  +   + +LQ    + +    R   
Sbjct: 8   GYVLHRRAYRETSFLVNIFTLENGKVSAVVKGVRGSKSDKKSLLQPFQPLLIGVSGRSE- 66

Query: 65  NLGEFRFEVLESHCAKLLSSSLFLY-GLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKI 123
                  + +ES  A +  +   LY  L     L R L +  P  E++ +    ++    
Sbjct: 67  ---LKNLQQVESTGAMIRLAGQALYCALYLNEVLNRVLADEIPHPEIFVLYQQSMHALVA 123

Query: 124 PSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGV 156
            +    +    EL LL  +G+G+DLT    TG 
Sbjct: 124 QTNFEPVLRSFELGLLDALGYGIDLTHDADTGQ 156


>gi|123441365|ref|YP_001005352.1| DNA repair protein RecO [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|166221916|sp|A1JKK5|RECO_YERE8 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|122088326|emb|CAL11117.1| DNA repair protein [Yersinia enterocolitica subsp. enterocolitica
           8081]
          Length = 241

 Score = 89.0 bits (220), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 37/160 (23%), Positives = 63/160 (39%), Gaps = 8/160 (5%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVN 57
           M  WQ  A +L  R Y E +++L++ T   GR     +  +  R  ++  LQ    + V 
Sbjct: 1   MEGWQ-RAFVLHGRPYSETSLMLDLFTEGEGRMRVLAKGARGRRSNLKGCLQPFTPLLVR 59

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
           W  R  +       E +    A  L+ S+   GL     L R L  +     L+      
Sbjct: 60  WTGR-GEVKTLRSAEPVSL--ALPLTGSMLYSGLYVNELLSRVLEHQTNYSALFFDYLHC 116

Query: 118 LNCHKIPSVIGKIFVQ-IELMLLKNIGFGLDLTKCVVTGV 156
           L          +  ++  EL +L ++G+G+D   C  +G 
Sbjct: 117 LQSLAGSDGSPEYALRQFELAILAHLGYGVDFLHCAGSGQ 156


>gi|307260994|ref|ZP_07542676.1| DNA repair protein recO [Actinobacillus pleuropneumoniae serovar 12
           str. 1096]
 gi|306869296|gb|EFN01091.1| DNA repair protein recO [Actinobacillus pleuropneumoniae serovar 12
           str. 1096]
          Length = 240

 Score = 89.0 bits (220), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 29/157 (18%), Positives = 57/157 (36%), Gaps = 7/157 (4%)

Query: 2   YWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQ--SHRMQPILQAGNLVRVNWR 59
            W     +L  R Y E +++++  T ++GR     +  +     ++ +LQ    + + W 
Sbjct: 4   NWH-RGFVLHRREYSETSLLVDFFTEEHGRITLLAKGARRPHSPLKAVLQPFTPLLLRWS 62

Query: 60  SRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLN 119
            +        + E         + +     G      L R L  +    EL+      + 
Sbjct: 63  GK-GDLKTLTKAEPASLTLP--MQTLALYSGFYVNEVLARVLENQTAYPELFQHYLQCMT 119

Query: 120 CHK-IPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTG 155
                P  I  I    E  +LK +G+G++ + C  TG
Sbjct: 120 RLATQPEKIESILRTFEFQMLKVLGYGVNFSICAATG 156


>gi|198245563|ref|YP_002216646.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|238690360|sp|B5FRC3|RECO_SALDC RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|197940079|gb|ACH77412.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|326624401|gb|EGE30746.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Dublin str. 3246]
          Length = 242

 Score = 89.0 bits (220), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 42/169 (24%), Positives = 70/169 (41%), Gaps = 20/169 (11%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVN 57
           M  WQ  A +L  R + E +++L+V T + GR     +  +S R  ++ +LQ    + + 
Sbjct: 1   MEGWQ-RAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKRSNLKGVLQPFTPLLLR 59

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLF------RFLPEREPCLEL- 110
           +  R          EV     A+ +S +L L G+     L+      R L       EL 
Sbjct: 60  YSGR---------GEVKTLRSAEAVSLALPLSGITLYSGLYINELLSRVLEYETRFSELF 110

Query: 111 YDMLNIFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQD 159
           +D LN                 + EL LL ++G+G++ T C  +G   D
Sbjct: 111 FDYLNCIQALAGTTGSPEPALRRFELALLGHLGYGVNFTHCAGSGERVD 159


>gi|115351066|ref|YP_772905.1| DNA repair protein RecO [Burkholderia ambifaria AMMD]
 gi|172060071|ref|YP_001807723.1| DNA repair protein RecO [Burkholderia ambifaria MC40-6]
 gi|115281054|gb|ABI86571.1| DNA replication and repair protein RecO [Burkholderia ambifaria
           AMMD]
 gi|171992588|gb|ACB63507.1| DNA repair protein RecO [Burkholderia ambifaria MC40-6]
          Length = 279

 Score = 89.0 bits (220), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 34/173 (19%), Positives = 68/173 (39%), Gaps = 19/173 (10%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQ--SHRMQPILQAGNLVRVNWRSRLA 63
            A +L    Y E ++I++V+TR +GR     +  +     ++ +LQ    + ++W  +  
Sbjct: 50  PAFVLHSYPYRETSLIIDVLTRDHGRLALVAKGAKRPHSALRGVLQTFQPLLLSWSGKS- 108

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVP------LFRFLPEREPCLELYDMLNIF 117
                   EV     A+ +   L L G   +        L +F    +P   L++   + 
Sbjct: 109 --------EVRTLTGAEWVGGMLPLGGDGLLCGFYVNELLVKFCAREDPQPPLFNHYVLT 160

Query: 118 LNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQ-DLLWV-SPKSG 168
           L          ++    E +LL+  G+ + L + V     + D  +V  P+ G
Sbjct: 161 LTRLAHGEPAVQVLRSFERVLLRETGYAMALNRTVARRAVEPDRRYVFDPERG 213


>gi|238759684|ref|ZP_04620844.1| DNA repair protein recO [Yersinia aldovae ATCC 35236]
 gi|238702112|gb|EEP94669.1| DNA repair protein recO [Yersinia aldovae ATCC 35236]
          Length = 244

 Score = 89.0 bits (220), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 37/160 (23%), Positives = 63/160 (39%), Gaps = 8/160 (5%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVN 57
           M  WQ  A +L  R Y E +++L++ T   GR     +  +  R  ++  LQ    + V 
Sbjct: 4   MEGWQ-RAFVLHGRPYSETSLMLDLFTEGEGRIRVLAKGARGRRSNLKGCLQPFTPLLVR 62

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
           W  R  +       E +    A  L+ S+   GL     L R L  +     L+      
Sbjct: 63  WAGR-GEVKTLRSAEPVSL--ALPLTGSMLYSGLYVNELLSRVLEHQTNYSALFFDYLHC 119

Query: 118 LNCHKIPSVIGKIFVQ-IELMLLKNIGFGLDLTKCVVTGV 156
           L          +  ++  EL +L ++G+G+D   C  +G 
Sbjct: 120 LQALAGSDGSPEYALRQFELAILAHLGYGVDFLHCAGSGE 159


>gi|238788222|ref|ZP_04632017.1| DNA repair protein recO [Yersinia frederiksenii ATCC 33641]
 gi|238723809|gb|EEQ15454.1| DNA repair protein recO [Yersinia frederiksenii ATCC 33641]
          Length = 241

 Score = 89.0 bits (220), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 39/168 (23%), Positives = 67/168 (39%), Gaps = 10/168 (5%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVN 57
           M  WQ  A +L  R Y E +++L++ T   GR     +  +  R  ++  LQ    + V 
Sbjct: 1   MEGWQ-RAFVLHGRPYSETSLMLDLFTEGEGRMRVLAKGARGRRSNLKGCLQPFTPLLVR 59

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
           W  R  +       E +    A  LS S+   GL     L R L  +     L+      
Sbjct: 60  WTGR-GEVKTLRSAEPVSL--ALPLSGSMLYSGLYVNELLSRVLEHQTNYSALFFDYLHC 116

Query: 118 LNCHKIPSVIGKIFVQ-IELMLLKNIGFGLDLTKCVVTG--VTQDLLW 162
           L          +  ++  EL +L ++G+G+D   C  +G  V+  + +
Sbjct: 117 LQSLAGSDGSPEYALRQFELAILAHLGYGVDFLHCAGSGQPVSDSMTY 164


>gi|312795544|ref|YP_004028466.1| DNA repair protein recO [Burkholderia rhizoxinica HKI 454]
 gi|312167319|emb|CBW74322.1| DNA repair protein recO [Burkholderia rhizoxinica HKI 454]
          Length = 308

 Score = 89.0 bits (220), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 42/228 (18%), Positives = 79/228 (34%), Gaps = 27/228 (11%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQ--SHRMQPILQAGNLVRVNWRSRLA 63
              +L    Y E ++I++V TR +GR     +  +     ++ +LQ    + ++W  +  
Sbjct: 75  PGFVLHTYPYRETSLIIDVFTRMHGRLALVAKGAKRPHSALRGVLQTFQPLALSWTGKS- 133

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVP------LFRFLPEREPCLELYDMLNIF 117
                   E+     A+ +     L G   +        L RF    +P   L+D   + 
Sbjct: 134 --------EMRTLTRAEWVGGMRPLAGDALLCGFYVNELLVRFCAREDPHTALFDHYLLT 185

Query: 118 LNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVT-GVTQDLLWV-SPKSGGAVCRSV 175
           L          ++    E +LL+  G+ + L + V    V     +V  P+    VC   
Sbjct: 186 LTRLAHDEPAVQVLRSFERVLLRETGYAMSLDRTVARQNVVAGRSYVFDPE--RGVCDVE 243

Query: 176 GLPYAEKMLVLPSF------LWKEEQTIDADSLKSAFQLTDYFLNKYA 217
            L      L  P          + +    A ++  +  L  + LN Y 
Sbjct: 244 MLEPDAHALRGPVIAGQTLLDMERDDYSRAQTVAQSKTLMRFLLNTYL 291


>gi|325523760|gb|EGD02014.1| DNA repair protein RecO [Burkholderia sp. TJI49]
          Length = 279

 Score = 89.0 bits (220), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 30/156 (19%), Positives = 61/156 (39%), Gaps = 17/156 (10%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQ--SHRMQPILQAGNLVRVNWRSRLA 63
            A +L    Y E ++I++V+TR +GR     +  +     ++ +LQ    + ++W  +  
Sbjct: 50  PAFVLHSYPYRETSLIIDVLTRDHGRLALVAKGAKRPHSALRGVLQTFQPLLLSWSGKS- 108

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVP------LFRFLPEREPCLELYDMLNIF 117
                   EV     A+ +   L L G   +        L +F    +P   L++   + 
Sbjct: 109 --------EVRTLTGAEWVGGMLPLGGDALLCGFYANELLVKFCAREDPQPPLFNHYVLT 160

Query: 118 LNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVV 153
           L          ++    E +LL+  G+ + L + V 
Sbjct: 161 LTRLAHGEPAVQVLRSFERVLLRETGYAMALNRTVA 196


>gi|307730525|ref|YP_003907749.1| DNA repair protein RecO [Burkholderia sp. CCGE1003]
 gi|307585060|gb|ADN58458.1| DNA repair protein RecO [Burkholderia sp. CCGE1003]
          Length = 306

 Score = 89.0 bits (220), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 38/244 (15%), Positives = 87/244 (35%), Gaps = 33/244 (13%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQ--SHRMQPILQAGNLVRVNWRSRLA 63
            A +L    Y E ++I++V++R +GR     +  +     ++ +LQ    + ++W  +  
Sbjct: 77  PAFVLHSYPYRETSLIIDVLSRDHGRLALVAKGAKRPHSALRGVLQTFQPLALSWSGKS- 135

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVP------LFRFLPEREPCLELYDMLNIF 117
                   EV     A+ +   L L G   +        L +F    +P  +L+    + 
Sbjct: 136 --------EVRTLTGAEWVGGMLPLTGDALLCGFYVNELLVKFCAREDPHPQLFHHYVVT 187

Query: 118 LNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQ-DLLWV-SPKSG-GAVCRS 174
           +          ++    E +LL+  G+ + L + V     +    +V  P+ G       
Sbjct: 188 MTRLAHDEPPVQVLRSFERVLLRETGYAMSLDRTVTRKAVEAGSRYVFDPERGVREASDD 247

Query: 175 VGLPYA----EKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRE 230
           +   +     + +L       +++    A ++  +  L  + LN Y            R+
Sbjct: 248 LPAQWPVVAGQTLL-----DMEKDDYHRAQTVAQSKTLMRFLLNTYL----GGTPLATRQ 298

Query: 231 NFLG 234
             + 
Sbjct: 299 ILID 302


>gi|171322521|ref|ZP_02911314.1| DNA repair protein RecO [Burkholderia ambifaria MEX-5]
 gi|171092148|gb|EDT37556.1| DNA repair protein RecO [Burkholderia ambifaria MEX-5]
          Length = 279

 Score = 89.0 bits (220), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 34/173 (19%), Positives = 68/173 (39%), Gaps = 19/173 (10%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQ--SHRMQPILQAGNLVRVNWRSRLA 63
            A +L    Y E ++I++V+TR +GR     +  +     ++ +LQ    + ++W  +  
Sbjct: 50  PAFVLHSYPYRETSLIIDVLTRDHGRLALVAKGAKRPHSALRGVLQTFQPLLLSWSGKS- 108

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVP------LFRFLPEREPCLELYDMLNIF 117
                   EV     A+ +   L L G   +        L +F    +P   L++   + 
Sbjct: 109 --------EVRTLTGAEWVGGMLPLGGDGLLCGFYANELLVKFCAREDPQPPLFNHYVLT 160

Query: 118 LNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQ-DLLWV-SPKSG 168
           L          ++    E +LL+  G+ + L + V     + D  +V  P+ G
Sbjct: 161 LTRLAHGEPAVQVLRSFERVLLRETGYAMALNRTVARRAVEPDRRYVFDPERG 213


>gi|54310185|ref|YP_131205.1| DNA repair protein RecO [Photobacterium profundum SS9]
 gi|61215025|sp|Q6LMS4|RECO_PHOPR RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|46914626|emb|CAG21403.1| putative DNA repair protein RecO [Photobacterium profundum SS9]
          Length = 236

 Score = 88.7 bits (219), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 37/168 (22%), Positives = 63/168 (37%), Gaps = 16/168 (9%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNW 58
           M       +L  R Y E ++IL+V +  YGR     +  +  R  ++  LQ    + + W
Sbjct: 1   MEGLQRCFVLHYRPYSETSLILDVFSEDYGRLTILSKGARRKRSNLKGTLQPFTPLFMKW 60

Query: 59  RSRLAQNLGEFR----FEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELY-DM 113
             R     G  +     E +       +   +          L R L    P   L+ D 
Sbjct: 61  TGR-----GSMKTLTHAEPISISLP--MRGYILYSAFYLNEVLVRVLENDTPYPVLFMDY 113

Query: 114 LNIFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGV-TQDL 160
           LN      +  +    +  + EL LL ++G+G+D   C  +G+   DL
Sbjct: 114 LNALRELAQADNPEPAL-RRFELALLHHLGYGIDFLHCAGSGLPIDDL 160


>gi|170699585|ref|ZP_02890625.1| DNA repair protein RecO [Burkholderia ambifaria IOP40-10]
 gi|170135536|gb|EDT03824.1| DNA repair protein RecO [Burkholderia ambifaria IOP40-10]
          Length = 279

 Score = 88.7 bits (219), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 34/173 (19%), Positives = 68/173 (39%), Gaps = 19/173 (10%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQ--SHRMQPILQAGNLVRVNWRSRLA 63
            A +L    Y E ++I++V+TR +GR     +  +     ++ +LQ    + ++W  +  
Sbjct: 50  PAFVLHSYPYRETSLIIDVLTRDHGRLALVAKGAKRPHSALRGVLQTFQPLLLSWSGKS- 108

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVP------LFRFLPEREPCLELYDMLNIF 117
                   EV     A+ +   L L G   +        L +F    +P   L++   + 
Sbjct: 109 --------EVRTLTGAEWVGGMLPLGGDGLLCGFYVNELLVKFCAREDPQPPLFNHYVLT 160

Query: 118 LNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQ-DLLWV-SPKSG 168
           L          ++    E +LL+  G+ + L + V     + D  +V  P+ G
Sbjct: 161 LTRLAHGEPAVQVLRSFERVLLRETGYAMALNRTVARRAVEPDRRYVFDPERG 213


>gi|323491196|ref|ZP_08096382.1| DNA repair protein RecO [Vibrio brasiliensis LMG 20546]
 gi|323314564|gb|EGA67642.1| DNA repair protein RecO [Vibrio brasiliensis LMG 20546]
          Length = 243

 Score = 88.7 bits (219), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 35/157 (22%), Positives = 59/157 (37%), Gaps = 17/157 (10%)

Query: 8   IILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNWRSRLAQN 65
            +L  R Y E ++IL+V + +YGR     +  +S R  ++  LQ    + + W       
Sbjct: 10  FVLHRRPYSESSLILDVFSEEYGRVTLMSKGARSKRSNLKGALQPFTPLLLKWSGN---- 65

Query: 66  LGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLF------RFLPEREPCLELYDMLNIFLN 119
            G  +        A+ +S  L L G+     ++      R L    P   L+      L 
Sbjct: 66  -GSMK----TLRQAEPISLGLPLSGINLYSAMYVNELVGRVLMAEVPMPALFHDYLHALT 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGV 156
                        + EL +L  +G+G+D   C  TG 
Sbjct: 121 ELAQCDNPEPALRRFELAMLSAMGYGVDFMHCAGTGE 157


>gi|251788700|ref|YP_003003421.1| DNA repair protein RecO [Dickeya zeae Ech1591]
 gi|247537321|gb|ACT05942.1| DNA repair protein RecO [Dickeya zeae Ech1591]
          Length = 244

 Score = 88.7 bits (219), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 39/160 (24%), Positives = 64/160 (40%), Gaps = 8/160 (5%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVN 57
           M  WQ  A +L  R Y E +++L++ +   GR     +  ++ R  ++  LQ    + V 
Sbjct: 1   MEGWQ-RAFVLHGRPYSETSLLLDLFSEDEGRVRVLAKGARARRSSLKGALQPFTPLLVR 59

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
           W  R  +       E +    A  LS SL   GL     L R L        L+      
Sbjct: 60  WGGR-GEVKTLRNAEPVSL--ALPLSGSLLYSGLYVNELLTRVLELETNYSALFFDYLHC 116

Query: 118 LNCHKIPSVIGK-IFVQIELMLLKNIGFGLDLTKCVVTGV 156
           L      +   +    + EL LL+++G+G+D   C  +G 
Sbjct: 117 LQQLAAANGSPEPALRRFELALLEHLGYGVDFLHCAGSGE 156


>gi|238750384|ref|ZP_04611885.1| DNA repair protein recO [Yersinia rohdei ATCC 43380]
 gi|238711315|gb|EEQ03532.1| DNA repair protein recO [Yersinia rohdei ATCC 43380]
          Length = 241

 Score = 88.7 bits (219), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 39/168 (23%), Positives = 68/168 (40%), Gaps = 10/168 (5%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVN 57
           M  WQ  A +L  R Y E +++L++ T   GR     +  +  R  ++  LQ    + V 
Sbjct: 1   MEGWQ-RAFVLHGRPYSETSLMLDLFTEGEGRMRVLAKGARGRRSNLKGCLQPFTPLLVR 59

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
           W  R  +       E +    A  LS S+   GL     L R L ++     L+      
Sbjct: 60  WVGR-GEIKTLRSAEPVSL--ALPLSGSMLYSGLYVNELLSRVLEQQTNYSALFFDYLHC 116

Query: 118 LNCHKIPSVIGKIFVQ-IELMLLKNIGFGLDLTKCVVTG--VTQDLLW 162
           L          +  ++  EL +L ++G+G+D   C  +G  V+  + +
Sbjct: 117 LQSLAGSDGSPEYALRQFELAILAHLGYGVDFLHCAGSGQPVSDSMTY 164


>gi|168232157|ref|ZP_02657215.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
 gi|194469835|ref|ZP_03075819.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|194456199|gb|EDX45038.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|205333544|gb|EDZ20308.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
          Length = 242

 Score = 88.7 bits (219), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 42/169 (24%), Positives = 70/169 (41%), Gaps = 20/169 (11%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVN 57
           M  WQ  A +L  R + E +++L+V T + GR     +  +S R  ++  LQ    + + 
Sbjct: 1   MEGWQ-RAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKRSNLKGALQPFTPLLLR 59

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLF------RFLPEREPCLEL- 110
           +  R          EV     A+ +S +L L G+     L+      R L       EL 
Sbjct: 60  YSGR---------GEVKTLRSAEAVSLALPLSGITLYSGLYINELLSRVLEYETRFSELF 110

Query: 111 YDMLNIFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQD 159
           +D LN                 + EL LL ++G+G++ T+C  +G   D
Sbjct: 111 FDYLNCIQALAGTTGSPEPALRRFELALLGHLGYGVNFTRCAGSGERVD 159


>gi|238793771|ref|ZP_04637392.1| DNA repair protein recO [Yersinia intermedia ATCC 29909]
 gi|238726835|gb|EEQ18368.1| DNA repair protein recO [Yersinia intermedia ATCC 29909]
          Length = 241

 Score = 88.7 bits (219), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 36/157 (22%), Positives = 62/157 (39%), Gaps = 7/157 (4%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNWRS 60
           WQ  A +L  R Y E +++L++ T   GR     +  +  R  ++  LQ    + V W  
Sbjct: 4   WQ-RAFVLHGRPYSETSLMLDLFTEGEGRMRVLAKGARGRRSNLKGCLQPFTPLLVRWAG 62

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           R  +       E +    A  L+ S+   GL     L R L  +     L+      L  
Sbjct: 63  R-GEVKTLRSAEPVSL--ALPLTGSMLYSGLYVNELLSRVLEHQTNYSALFFDYLHCLQA 119

Query: 121 HKIPSVIGKIFVQ-IELMLLKNIGFGLDLTKCVVTGV 156
                   +  ++  EL +L ++G+G+D   C  +G 
Sbjct: 120 LAGSDGSPEYALRQFELAILAHLGYGVDFLHCAGSGQ 156


>gi|78065720|ref|YP_368489.1| DNA repair protein RecO [Burkholderia sp. 383]
 gi|119361450|sp|Q39I71|RECO_BURS3 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|77966465|gb|ABB07845.1| DNA replication and repair protein RecO [Burkholderia sp. 383]
          Length = 278

 Score = 88.7 bits (219), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 34/173 (19%), Positives = 68/173 (39%), Gaps = 19/173 (10%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQ--SHRMQPILQAGNLVRVNWRSRLA 63
            A +L    Y E ++I++V+TR +GR     +  +     ++ +LQ    + ++W  +  
Sbjct: 49  PAYVLHSYPYRETSLIIDVLTRDHGRLALVAKGAKRPHSALRGVLQTFQPLLLSWSGKS- 107

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVP------LFRFLPEREPCLELYDMLNIF 117
                   EV     A+ +   L L G   +        L +F    +P   L++   + 
Sbjct: 108 --------EVRTLTGAEWVGGMLPLGGDGLLCGFYANELLVKFCAREDPQPPLFNHYVLT 159

Query: 118 LNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQ-DLLWV-SPKSG 168
           L          ++    E +LL+  G+ + L + V     + D  +V  P+ G
Sbjct: 160 LTRLAHGEPAVQVLRSFERVLLRETGYAMALNRTVARRAVEPDRRYVFDPERG 212


>gi|322514174|ref|ZP_08067239.1| recombination protein O [Actinobacillus ureae ATCC 25976]
 gi|322119960|gb|EFX91962.1| recombination protein O [Actinobacillus ureae ATCC 25976]
          Length = 240

 Score = 88.7 bits (219), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 25/157 (15%), Positives = 55/157 (35%), Gaps = 7/157 (4%)

Query: 2   YWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNWR 59
            W     +L  R Y E +++++  T  +GR     +  +  R  ++ +LQ    + + W 
Sbjct: 4   NWH-RGFVLHRREYSETSLLVDFFTEDHGRITLLAKGARRPRSSLKAVLQPFTPLLLRWS 62

Query: 60  SRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLN 119
            +  +     + E         + +     G      L + L  +     L+      + 
Sbjct: 63  GK-GELKTLTKAEPASLTLP--MQTLALYSGFYVNEVLAKVLENQTAYPALFQHYLQCVT 119

Query: 120 CHKIPSVIGKIFVQ-IELMLLKNIGFGLDLTKCVVTG 155
                    +  ++  E   LK +G+G++   C  TG
Sbjct: 120 HLATQPDNLEAILRTFEFHTLKALGYGVNFGVCAATG 156


>gi|242240201|ref|YP_002988382.1| DNA repair protein RecO [Dickeya dadantii Ech703]
 gi|242132258|gb|ACS86560.1| DNA repair protein RecO [Dickeya dadantii Ech703]
          Length = 244

 Score = 88.3 bits (218), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 36/159 (22%), Positives = 59/159 (37%), Gaps = 6/159 (3%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNW 58
           M     A +L  R Y E +++L++ T   GR     +  ++ R  ++  LQ    + V W
Sbjct: 1   MEGWQRAFVLHGRPYSETSLLLDLFTENEGRVRVLAKGARARRSNLKGALQPFTPLLVRW 60

Query: 59  RSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFL 118
             R  +       E +    A  L  +L   GL     L R L        L+      L
Sbjct: 61  GGR-GEVKTLRNAEPVSL--ALPLHGALLYSGLYVNELLMRVLEFETDYSALFFDYLYCL 117

Query: 119 NCHKIPSVIGK-IFVQIELMLLKNIGFGLDLTKCVVTGV 156
                     +    + EL LL ++G+G+D   C  +G 
Sbjct: 118 QQLAAAQGSPEPALRRFELALLAHLGYGVDFLHCAGSGQ 156


>gi|312110186|ref|YP_003988502.1| DNA repair protein RecO [Geobacillus sp. Y4.1MC1]
 gi|311215287|gb|ADP73891.1| DNA repair protein RecO [Geobacillus sp. Y4.1MC1]
          Length = 264

 Score = 88.3 bits (218), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 38/187 (20%), Positives = 70/187 (37%), Gaps = 8/187 (4%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQ--SHRMQPILQAGNL-VRVNWRSRL 62
           +AI++    YGE N I+   TR++G+     R  +  S R+  + Q       +  RSR 
Sbjct: 6   EAIVIRATDYGETNKIVTFFTREWGKVAAMARGAKKPSSRLSAVTQLFTYGYYLIQRSR- 64

Query: 63  AQNLGEF-RFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCH 121
              +G   + ++++S  A         Y    +    +   E +    L+++L   L   
Sbjct: 65  --GVGVLQQGDIIDSMRATREDIFTAAYASYIVELTDKITEEHQRNPYLFELLLQTLQYM 122

Query: 122 KIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAE 181
                +  +    E  +L  +G    L  C + G T+     S K  G +C      Y  
Sbjct: 123 NEGRDLEILASIYETKMLSVMGIPPKLDYCAICGRTEGKFSFSIKEAGFLCHRC-EQYDP 181

Query: 182 KMLVLPS 188
             + L +
Sbjct: 182 HRIPLSA 188


>gi|311693677|gb|ADP96550.1| DNA repair protein RecO [marine bacterium HP15]
          Length = 242

 Score = 88.3 bits (218), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 29/159 (18%), Positives = 61/159 (38%), Gaps = 7/159 (4%)

Query: 2   YWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNWR 59
             Q+ A +L  R + E ++++++ +  +GR     R   S +  ++  LQ    + V+W 
Sbjct: 5   ELQEPAYVLHRRPWRETSLMVDLFSLNHGRMTVIARGANSAKSPLKAQLQPFQPLIVDWA 64

Query: 60  SRLAQNLGEFRFEVLESHCAKLLSSSLFLY-GLQSIVPLFRFLPEREPCLELYDMLNIFL 118
            R            ++      ++ ++ LY GL     L R LP  +P   L+      +
Sbjct: 65  GRGD----LKTLTQVDVRAGPTITRTVSLYSGLYLNELLQRILPAADPHPTLFAAYIDAI 120

Query: 119 NCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVT 157
                   +  +  + EL     +G+     +   TG +
Sbjct: 121 GQLSDTRDVEPVLRRFELAFASALGYDFAWDRATDTGQS 159


>gi|189425855|ref|YP_001953032.1| DNA repair protein RecO [Geobacter lovleyi SZ]
 gi|189422114|gb|ACD96512.1| DNA repair protein RecO [Geobacter lovleyi SZ]
          Length = 209

 Score = 88.3 bits (218), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 41/160 (25%), Positives = 65/160 (40%), Gaps = 8/160 (5%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQ--PILQAGNLVRVNWRSRLA 63
            AIIL   +YGE + I+ + T ++GR  GF ++ ++ R +    L+  N + V    R  
Sbjct: 7   QAIILSTLNYGESDRIVSLFTLEHGRLRGFAKSARASRKRFGGQLEPANRLAVTLSLRED 66

Query: 64  QNLGEFRFEVLE-SHCAKLLSSSLFLYGLQS-IVPLFRFL-PEREPCLELYDMLNIFLNC 120
              G  R E +E S+C   L   L    L      L   L PE  P   L+ +L+     
Sbjct: 67  ---GLSRIERVEQSNCYPELRERLESLALALYACELVEALTPEGHPLPRLFRLLSTLFEH 123

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDL 160
               S         E+ LL  +G+   L    +  ++  L
Sbjct: 124 LAGQSGSPTDRRFFEMNLLNILGYRPALDTAALQPLSDCL 163


>gi|83748441|ref|ZP_00945463.1| RecO [Ralstonia solanacearum UW551]
 gi|207743588|ref|YP_002259980.1| dna repair protein reco (recombination protein o) [Ralstonia
           solanacearum IPO1609]
 gi|83724852|gb|EAP72008.1| RecO [Ralstonia solanacearum UW551]
 gi|206594987|emb|CAQ61914.1| dna repair protein reco (recombination protein o) [Ralstonia
           solanacearum IPO1609]
          Length = 272

 Score = 88.3 bits (218), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 33/157 (21%), Positives = 58/157 (36%), Gaps = 17/157 (10%)

Query: 4   QDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQ--SHRMQPILQAGNLVRVNWRSR 61
           Q  A +L    Y E ++I++V TR +GR     +  +     ++ +LQ    + ++W  R
Sbjct: 41  QQPAFVLHSYPYRETSLIIDVFTRDHGRIALVAKGAKRPHSALRAVLQTFQPLSLSWSGR 100

Query: 62  LAQNLGEFRFEVLESHCAKLLSSSLFLY------GLQSIVPLFRFLPEREPCLELYDMLN 115
                     EV     A+ +   L L       G      L +F+   +    L+    
Sbjct: 101 ---------GEVKTLTRAEWVGGMLPLGGEGLLSGFYLNELLVKFVAREDGHAVLFSHYV 151

Query: 116 IFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCV 152
             LN       +       E +LL+  GF   L +C+
Sbjct: 152 DTLNKLAHGEPVAFTLRAFERVLLRETGFAAQLDRCI 188


>gi|297581083|ref|ZP_06943008.1| DNA repair protein recO [Vibrio cholerae RC385]
 gi|297534909|gb|EFH73745.1| DNA repair protein recO [Vibrio cholerae RC385]
          Length = 241

 Score = 88.3 bits (218), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 38/166 (22%), Positives = 61/166 (36%), Gaps = 22/166 (13%)

Query: 8   IILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNWRSRLAQN 65
            +L  R Y E ++IL+V + +YGR     +  +  R  ++  LQ    + + W       
Sbjct: 9   FVLHRRPYSESSLILDVFSEEYGRVTLMAKGARGKRSNLKGALQPFTPLLLKWSGN---- 64

Query: 66  LGEFRFEVLESHCAKLLSSSLFLYGLQSIVPL------FRFLPEREPCLELYDMLNIFLN 119
            G  +        A+ +S  L L G+     +       R L     C  L+      L 
Sbjct: 65  -GSMK----TLRQAEPISLGLPLSGVYLYSAMYINELVDRVLMPEVACPGLFHDYLFALT 119

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSP 165
                +       + EL LL  +G+G+D   C  TG       VSP
Sbjct: 120 ELAQSTNPEPALRRFELALLAAMGYGVDFLHCAGTGEP-----VSP 160


>gi|229521286|ref|ZP_04410706.1| DNA recombination and repair protein RecO [Vibrio cholerae TM
           11079-80]
 gi|229341818|gb|EEO06820.1| DNA recombination and repair protein RecO [Vibrio cholerae TM
           11079-80]
          Length = 241

 Score = 88.3 bits (218), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 38/166 (22%), Positives = 61/166 (36%), Gaps = 22/166 (13%)

Query: 8   IILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNWRSRLAQN 65
            +L  R Y E ++IL+V + +YGR     +  +  R  ++  LQ    + + W       
Sbjct: 9   FVLHRRPYSESSLILDVFSEEYGRVTLMAKGARGKRSNLKGALQPFTPLLLKWSGN---- 64

Query: 66  LGEFRFEVLESHCAKLLSSSLFLYGLQSIVPL------FRFLPEREPCLELYDMLNIFLN 119
            G  +        A+ +S  L L G+     +       R L     C  L+      L 
Sbjct: 65  -GSMK----TLRQAEPISLGLPLSGVYLYSAMYINELVDRVLMPEVACPGLFHDYLFALT 119

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSP 165
                +       + EL LL  +G+G+D   C  TG       VSP
Sbjct: 120 ELAQSTNPEPALRRFELALLAAMGYGVDFLHCAGTGEP-----VSP 160


>gi|271501619|ref|YP_003334645.1| DNA repair protein RecO [Dickeya dadantii Ech586]
 gi|270345174|gb|ACZ77939.1| DNA repair protein RecO [Dickeya dadantii Ech586]
          Length = 244

 Score = 87.9 bits (217), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 40/160 (25%), Positives = 64/160 (40%), Gaps = 8/160 (5%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVN 57
           M  WQ  A +L  R Y E +++L++ +   GR     +  ++ R  ++  LQ    + V 
Sbjct: 1   MEGWQ-RAFVLHGRPYSETSLLLDLFSENEGRVRVLAKGARARRSSLKGALQPFTPLLVR 59

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLEL-YDMLNI 116
           W  R  +       E +    A  LS SL   GL     L R L        L +D L+ 
Sbjct: 60  WGGR-GEVKTLRNAEPVSL--ALPLSGSLLYSGLYVNELLTRVLELETNYSALFFDYLHC 116

Query: 117 FLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGV 156
                           + EL LL+++G+G+D   C  +G 
Sbjct: 117 LQQLAGTNGSPEPALRRFELALLEHLGYGVDFLHCAGSGE 156


>gi|207725213|ref|YP_002255609.1| DNA repair protein RecO [Ralstonia solanacearum MolK2]
 gi|206590447|emb|CAQ37409.1| dna repair protein reco (recombination protein o) [Ralstonia
           solanacearum MolK2]
          Length = 272

 Score = 87.9 bits (217), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 33/157 (21%), Positives = 58/157 (36%), Gaps = 17/157 (10%)

Query: 4   QDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQ--SHRMQPILQAGNLVRVNWRSR 61
           Q  A +L    Y E ++I++V TR +GR     +  +     ++ +LQ    + ++W  R
Sbjct: 41  QQPAFVLHSYPYRETSLIIDVFTRDHGRIALVAKGAKRPHSALRAVLQTFQPLSLSWSGR 100

Query: 62  LAQNLGEFRFEVLESHCAKLLSSSLFLY------GLQSIVPLFRFLPEREPCLELYDMLN 115
                     EV     A+ +   L L       G      L +F+   +    L+    
Sbjct: 101 ---------GEVKTLTRAEWVGGMLPLGGEGLLSGFYLNELLVKFVAREDGHAVLFSHYV 151

Query: 116 IFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCV 152
             LN       +       E +LL+  GF   L +C+
Sbjct: 152 DTLNKLAHGEPVAFTLRAFERVLLRETGFAAQLDRCI 188


>gi|254481220|ref|ZP_05094465.1| DNA repair protein RecO [marine gamma proteobacterium HTCC2148]
 gi|214038383|gb|EEB79045.1| DNA repair protein RecO [marine gamma proteobacterium HTCC2148]
          Length = 243

 Score = 87.9 bits (217), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 47/238 (19%), Positives = 78/238 (32%), Gaps = 17/238 (7%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQ-----PILQAGNLVRVNWRS 60
            + IL  R Y + ++ILEV   ++GR    V  G   R +      +LQ    + +++  
Sbjct: 7   PSYILHSRPYRDSSLILEVFCAEHGRLS-LVSKGARRRSKGGSSVALLQPFIPLLLSFSG 65

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           R          E       +L    LF  G+     L R L   +P  +L+      L  
Sbjct: 66  RSEMKTLTH-VEPA-GVAPQLRGERLF-SGMYINELLMRLLHRHDPHPQLFANYGTALGE 122

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTG---VTQDLLWVSPKSGGAVCRSVGL 177
                 +     + EL LL  +G+G  L +  ++G           SP  G         
Sbjct: 123 LGDAEEVEVCLRRFELGLLDELGYGFSLAEDGLSGEAISEDGWYHFSPDCGLVAGVKGAN 182

Query: 178 PYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGK 235
           P           L   +     ++   A +L    L +Y            R+ F G+
Sbjct: 183 PARPA-YSGAELLLLSQGKYGGEARSVARRLMREVLAQYL----GSEPLKSRDLFHGR 235


>gi|134295166|ref|YP_001118901.1| DNA repair protein RecO [Burkholderia vietnamiensis G4]
 gi|134138323|gb|ABO54066.1| DNA replication and repair protein RecO [Burkholderia vietnamiensis
           G4]
          Length = 279

 Score = 87.9 bits (217), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 30/156 (19%), Positives = 61/156 (39%), Gaps = 17/156 (10%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQ--SHRMQPILQAGNLVRVNWRSRLA 63
            A +L    Y E ++I++V+TR +GR     +  +     ++ +LQ    + ++W  +  
Sbjct: 50  PAFVLHSYPYRETSLIIDVLTRDHGRLALVAKGAKRPHSALRGVLQTFQPLLLSWSGKS- 108

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVP------LFRFLPEREPCLELYDMLNIF 117
                   EV     A+ +   L L G   +        L +F    +P   L++   + 
Sbjct: 109 --------EVRTLTGAEWVGGMLPLGGDGLLCGFYVNELLVKFCAREDPQPPLFNHYVLT 160

Query: 118 LNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVV 153
           L          ++    E +LL+  G+ + L + V 
Sbjct: 161 LTRLAHGEPAVQVLRSFERVLLRETGYAMALNRTVA 196


>gi|238784189|ref|ZP_04628202.1| DNA repair protein recO [Yersinia bercovieri ATCC 43970]
 gi|238714898|gb|EEQ06897.1| DNA repair protein recO [Yersinia bercovieri ATCC 43970]
          Length = 241

 Score = 87.9 bits (217), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 37/157 (23%), Positives = 62/157 (39%), Gaps = 7/157 (4%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNWRS 60
           WQ  A +L  R Y E +++L++ T   GR     +  +  R  ++  LQ    + V W  
Sbjct: 4   WQ-RAFVLHGRPYSETSLMLDLFTEGEGRMRVLAKGARGRRSNLKGCLQPFTPLLVRWTG 62

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           R  +       E +    A  LS S+   GL     L R L  +     L+      L  
Sbjct: 63  R-GEVKTLRSAEPVSL--ALPLSGSMLYSGLYVNELLSRVLEHQTNYSALFFDYLHCLQS 119

Query: 121 HKIPSVIGKIFVQ-IELMLLKNIGFGLDLTKCVVTGV 156
                   +  ++  EL +L ++G+G+D   C  +G 
Sbjct: 120 LAGSDGTPEYALRQFELAILAHLGYGVDFLHCAGSGQ 156


>gi|107022212|ref|YP_620539.1| DNA repair protein RecO [Burkholderia cenocepacia AU 1054]
 gi|116689158|ref|YP_834781.1| DNA repair protein RecO [Burkholderia cenocepacia HI2424]
 gi|170732446|ref|YP_001764393.1| DNA repair protein RecO [Burkholderia cenocepacia MC0-3]
 gi|254245909|ref|ZP_04939230.1| Recombination protein O, RecO [Burkholderia cenocepacia PC184]
 gi|119361448|sp|Q1BXT9|RECO_BURCA RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|105892401|gb|ABF75566.1| DNA replication and repair protein RecO [Burkholderia cenocepacia
           AU 1054]
 gi|116647247|gb|ABK07888.1| DNA replication and repair protein RecO [Burkholderia cenocepacia
           HI2424]
 gi|124870685|gb|EAY62401.1| Recombination protein O, RecO [Burkholderia cenocepacia PC184]
 gi|169815688|gb|ACA90271.1| DNA repair protein RecO [Burkholderia cenocepacia MC0-3]
          Length = 278

 Score = 87.9 bits (217), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 30/156 (19%), Positives = 61/156 (39%), Gaps = 17/156 (10%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQ--SHRMQPILQAGNLVRVNWRSRLA 63
            A +L    Y E ++I++V+TR +GR     +  +     ++ +LQ    + ++W  +  
Sbjct: 49  PAFVLHSYPYRETSLIVDVLTRDHGRLALVAKGAKRPHSALRGVLQTFQPLLLSWSGKS- 107

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVP------LFRFLPEREPCLELYDMLNIF 117
                   EV     A+ +   L L G   +        L +F    +P   L++   + 
Sbjct: 108 --------EVRTLTGAEWVGGMLPLGGDGLLCGFYANELLVKFCAREDPQPPLFNHYVLT 159

Query: 118 LNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVV 153
           L          ++    E +LL+  G+ + L + V 
Sbjct: 160 LTRLAHGEPAVQVLRSFERVLLRETGYAMALNRTVA 195


>gi|320155322|ref|YP_004187701.1| DNA recombination and repair protein RecO [Vibrio vulnificus
           MO6-24/O]
 gi|319930634|gb|ADV85498.1| DNA recombination and repair protein RecO [Vibrio vulnificus
           MO6-24/O]
          Length = 243

 Score = 87.9 bits (217), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 35/157 (22%), Positives = 61/157 (38%), Gaps = 17/157 (10%)

Query: 8   IILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNWRSRLAQN 65
            +L  R Y E ++IL+V + ++GR     +  +S R  ++  LQ    + + W  + A  
Sbjct: 11  FVLHRRPYSESSLILDVFSEEFGRITLMSKGARSKRSNLKGALQPFTPLLLKWSGKGA-- 68

Query: 66  LGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLF------RFLPEREPCLELYDMLNIFLN 119
                  +     A+ +S  L L G+     ++      R L +  P   L+      L 
Sbjct: 69  -------MKTLRQAEPISLGLPLTGIYLYSAMYVNELVGRVLMQEVPMPGLFHDYLFALT 121

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGV 156
                        + EL LL  +G+G+D   C  TG 
Sbjct: 122 ELAQADNPEPALRRFELALLAAMGYGVDFLHCAGTGE 158


>gi|78224139|ref|YP_385886.1| recombination protein O, RecO [Geobacter metallireducens GS-15]
 gi|119361460|sp|Q39RG3|RECO_GEOMG RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|78195394|gb|ABB33161.1| DNA replication and repair protein RecO [Geobacter metallireducens
           GS-15]
          Length = 244

 Score = 87.5 bits (216), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 32/157 (20%), Positives = 62/157 (39%), Gaps = 5/157 (3%)

Query: 4   QDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQ--SHRMQPILQAGNLVRVNWRSR 61
           + +AI+L    Y E + I+ + T QYG+  G  +  +  + R  P L+    + V    R
Sbjct: 5   RTEAIVLAAMDYRESDRIVTLFTLQYGKVRGVAKGAKRSARRFGPALEPFARIGVELVVR 64

Query: 62  LAQNLGEFR-FEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
             + L   R  +++  +               ++  + R+LP+  P   L+ +L+ +L  
Sbjct: 65  --EGLSSLRGADIVTLYPGIRRDLRAIGLAGYAVELVDRYLPDGAPSPRLFRLLSSYLER 122

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVT 157
                 +       E   L  +G+ + L  C   GV 
Sbjct: 123 LDQGEPLPSDRRFFEANFLNILGYRISLDHCASCGVE 159


>gi|205353675|ref|YP_002227476.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|238690509|sp|B5RD47|RECO_SALG2 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|205273456|emb|CAR38433.1| DNA repair protein recO [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|326628779|gb|EGE35122.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 9]
          Length = 242

 Score = 87.5 bits (216), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 42/169 (24%), Positives = 69/169 (40%), Gaps = 20/169 (11%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVN 57
           M  WQ  A +L  R + E +++L+V T + GR     +  +S R  ++  LQ    + + 
Sbjct: 1   MEGWQ-RAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKRSNLKGALQPFTPLLLR 59

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLF------RFLPEREPCLEL- 110
           +  R          EV     A+ +S +L L G+     L+      R L       EL 
Sbjct: 60  YSGR---------GEVKTLRSAEAVSLALPLSGITLYSGLYINELLSRVLEYETRFSELF 110

Query: 111 YDMLNIFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQD 159
           +D LN                 + EL LL ++G+G++ T C  +G   D
Sbjct: 111 FDYLNCIQALAGTTGSPEPALRRFELALLGHLGYGVNFTHCAGSGERVD 159


>gi|323526857|ref|YP_004229010.1| DNA repair protein RecO [Burkholderia sp. CCGE1001]
 gi|323383859|gb|ADX55950.1| DNA repair protein RecO [Burkholderia sp. CCGE1001]
          Length = 306

 Score = 87.5 bits (216), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 28/156 (17%), Positives = 61/156 (39%), Gaps = 17/156 (10%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQ--SHRMQPILQAGNLVRVNWRSRLA 63
            A +L    Y E ++I++V++R +GR     +  +     ++ +LQ    + ++W  +  
Sbjct: 77  PAFVLHSYPYRETSLIIDVLSRDHGRLALVAKGAKRPHSALRGVLQTFQPLALSWSGKS- 135

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVP------LFRFLPEREPCLELYDMLNIF 117
                   EV     A+ +   L L G   +        L +F    +P  +L+    + 
Sbjct: 136 --------EVRTLTGAEWVGGMLPLTGDALLCGFYVNELLVKFCAREDPHPQLFHHYVVT 187

Query: 118 LNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVV 153
           +          ++    E +LL+  G+ + L + V 
Sbjct: 188 MTRLAHDEPPVQVLRSFERVLLRETGYAMSLDRTVA 223


>gi|206559400|ref|YP_002230161.1| DNA repair protein RecO [Burkholderia cenocepacia J2315]
 gi|206561198|ref|YP_002231963.1| DNA repair protein RecO [Burkholderia cenocepacia J2315]
 gi|198035438|emb|CAR51314.1| DNA repair protein RecO 2 [Burkholderia cenocepacia J2315]
 gi|198037240|emb|CAR53162.1| DNA repair protein RecO 1 [Burkholderia cenocepacia J2315]
          Length = 278

 Score = 87.5 bits (216), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 30/156 (19%), Positives = 61/156 (39%), Gaps = 17/156 (10%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQ--SHRMQPILQAGNLVRVNWRSRLA 63
            A +L    Y E ++I++V+TR +GR     +  +     ++ +LQ    + ++W  +  
Sbjct: 49  PAFVLHSYPYRETSLIVDVLTRDHGRLALVAKGAKRPHSALRGVLQTFQPLLLSWSGKS- 107

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVP------LFRFLPEREPCLELYDMLNIF 117
                   EV     A+ +   L L G   +        L +F    +P   L++   + 
Sbjct: 108 --------EVRTLTGAEWVGGMLPLGGDGLLCGFYANELLVKFCAREDPQPPLFNHYVLT 159

Query: 118 LNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVV 153
           L          ++    E +LL+  G+ + L + V 
Sbjct: 160 LTRLAHGEPAVQVLRSFERVLLRETGYAMALNRTVA 195


>gi|1228148|gb|AAA92442.1| RecO [Salmonella enterica subsp. enterica serovar Typhimurium]
          Length = 241

 Score = 87.5 bits (216), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 42/169 (24%), Positives = 69/169 (40%), Gaps = 20/169 (11%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVN 57
           M  WQ  A +L  R + E +++L+V T + GR     +  +S R  ++  LQ    + + 
Sbjct: 1   MEGWQ-RAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKRSNLKGALQPFTPLLLR 59

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLF------RFLPEREPCLEL- 110
           +  R          EV     A+ +S +L L G+     L+      R L       EL 
Sbjct: 60  YSGR---------GEVKTLRSAEAVSLALPLSGITLYSGLYINELLSRVLEYETRFSELF 110

Query: 111 YDMLNIFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQD 159
           +D LN                 + EL LL ++G+G++ T C  +G   D
Sbjct: 111 FDYLNCIQALAGTTGSPEPALRRFELALLGHLGYGVNFTHCAGSGERVD 159


>gi|168238324|ref|ZP_02663382.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
 gi|194738093|ref|YP_002115642.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|238693669|sp|B4TS12|RECO_SALSV RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|194713595|gb|ACF92816.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|197288836|gb|EDY28209.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
 gi|322613349|gb|EFY10291.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315996572]
 gi|322620447|gb|EFY17312.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-1]
 gi|322625085|gb|EFY21914.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-3]
 gi|322629471|gb|EFY26247.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-4]
 gi|322633858|gb|EFY30597.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-1]
 gi|322635464|gb|EFY32175.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-2]
 gi|322639860|gb|EFY36539.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Montevideo str. 531954]
 gi|322644254|gb|EFY40798.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Montevideo str. NC_MB110209-0054]
 gi|322649946|gb|EFY46366.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Montevideo str. OH_2009072675]
 gi|322654871|gb|EFY51188.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Montevideo str. CASC_09SCPH15965]
 gi|322658201|gb|EFY54467.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Montevideo str. 19N]
 gi|322661727|gb|EFY57945.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Montevideo str. 81038-01]
 gi|322669708|gb|EFY65854.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Montevideo str. MD_MDA09249507]
 gi|322673285|gb|EFY69390.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Montevideo str. 414877]
 gi|322674926|gb|EFY71013.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Montevideo str. 366867]
 gi|322682949|gb|EFY78967.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Montevideo str. 413180]
 gi|322685610|gb|EFY81605.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Montevideo str. 446600]
 gi|323191962|gb|EFZ77200.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609458-1]
 gi|323200405|gb|EFZ85486.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556150-1]
 gi|323201305|gb|EFZ86372.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609460]
 gi|323208375|gb|EFZ93315.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Montevideo str. 507440-20]
 gi|323211549|gb|EFZ96387.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556152]
 gi|323215981|gb|EGA00713.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB101509-0077]
 gi|323221762|gb|EGA06170.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB102109-0047]
 gi|323225630|gb|EGA09857.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB110209-0055]
 gi|323229348|gb|EGA13472.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB111609-0052]
 gi|323235337|gb|EGA19421.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009083312]
 gi|323237477|gb|EGA21540.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009085258]
 gi|323245232|gb|EGA29233.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315731156]
 gi|323248806|gb|EGA32733.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2009159199]
 gi|323254014|gb|EGA37835.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008282]
 gi|323259062|gb|EGA42710.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008283]
 gi|323267768|gb|EGA51249.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008285]
 gi|323269673|gb|EGA53125.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008287]
          Length = 242

 Score = 87.5 bits (216), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 42/169 (24%), Positives = 69/169 (40%), Gaps = 20/169 (11%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVN 57
           M  WQ  A +L  R + E +++L+V T + GR     +  +S R  ++  LQ    + + 
Sbjct: 1   MEGWQ-RAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKRSNLKGALQPFTPLLLR 59

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLF------RFLPEREPCLEL- 110
           +  R          EV     A+ +S +L L G+     L+      R L       EL 
Sbjct: 60  YSGR---------GEVKTLRSAEAVSLALPLSGITLYSGLYINELLSRVLEYETRFSELF 110

Query: 111 YDMLNIFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQD 159
           +D LN                 + EL LL ++G+G++ T C  +G   D
Sbjct: 111 FDYLNCIQALAGTTGSPEPALRRFELALLGHLGYGVNFTHCAGSGERVD 159


>gi|323499983|ref|ZP_08104939.1| DNA repair protein RecO [Vibrio sinaloensis DSM 21326]
 gi|323314949|gb|EGA68004.1| DNA repair protein RecO [Vibrio sinaloensis DSM 21326]
          Length = 240

 Score = 87.5 bits (216), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 35/157 (22%), Positives = 60/157 (38%), Gaps = 17/157 (10%)

Query: 8   IILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNWRSRLAQN 65
            +L  R Y E ++IL+V + ++GR     +  +S R  ++  LQ    + + W       
Sbjct: 10  FVLHRRPYSESSLILDVFSEEFGRVTLMSKGARSKRSNLKGALQPFTPLLLKWSGN---- 65

Query: 66  LGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLF------RFLPEREPCLELYDMLNIFLN 119
            G  +        A+ +S  L L+G+     ++      R L    P   L+      L 
Sbjct: 66  -GSMK----TLRQAEPISLGLPLFGINLYSAMYVNELVGRVLMAEVPMPALFHDYLHALT 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGV 156
                        + EL LL  +G+G+D   C  TG 
Sbjct: 121 ELAQSDNPEPALRRFELALLSAMGYGVDFMHCAGTGE 157


>gi|168821431|ref|ZP_02833431.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|205342020|gb|EDZ28784.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|320087080|emb|CBY96849.1| DNA repair protein recO Recombination protein O [Salmonella
           enterica subsp. enterica serovar Weltevreden str.
           2007-60-3289-1]
          Length = 242

 Score = 87.5 bits (216), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 42/169 (24%), Positives = 69/169 (40%), Gaps = 20/169 (11%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVN 57
           M  WQ  A +L  R + E +++L+V T + GR     +  +S R  ++  LQ    + + 
Sbjct: 1   MEGWQ-RAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKRSNLKGALQPFTPLLLR 59

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLF------RFLPEREPCLEL- 110
           +  R          EV     A+ +S +L L G+     L+      R L       EL 
Sbjct: 60  YSGR---------GEVKTLRSAEAVSLALPLSGITLYSGLYINELLSRVLEYETRFSELF 110

Query: 111 YDMLNIFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQD 159
           +D LN                 + EL LL ++G+G++ T C  +G   D
Sbjct: 111 FDYLNCIQALAGTTGSPEPALRRFELALLGHLGYGVNFTHCAGSGERVD 159


>gi|240949698|ref|ZP_04754033.1| DNA repair protein RecO [Actinobacillus minor NM305]
 gi|240295956|gb|EER46632.1| DNA repair protein RecO [Actinobacillus minor NM305]
          Length = 241

 Score = 87.5 bits (216), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 35/164 (21%), Positives = 70/164 (42%), Gaps = 13/164 (7%)

Query: 2   YWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNWR 59
            WQ    +L  R Y E ++++++ T  YGR     +  +  R  ++ +LQ    + + W 
Sbjct: 5   QWQ-RGFVLHKREYSETSLLVDLFTENYGRITLLAKGARRPRSPLKALLQPFTPLLLRWS 63

Query: 60  SRLAQNLGEFRFEVLESHCAKL---LSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNI 116
            +     G+ +  + +   A L   +++     G      L R L  +    EL+     
Sbjct: 64  GK-----GDLKV-LTKVEAAALTLPMNTKALYSGFYINEVLVRVLENQTAYQELFHHYLQ 117

Query: 117 FLNCHKIPSVIGKIFVQ-IELMLLKNIGFGLDLTKCVVTGVTQD 159
            +    + S   +  ++  E  +LK +G+G+D T C+ TG+  D
Sbjct: 118 CVTHLALRSEELEPILRTFEFHVLKALGYGVDFTHCMATGLEVD 161


>gi|91784705|ref|YP_559911.1| DNA repair protein RecO [Burkholderia xenovorans LB400]
 gi|91688659|gb|ABE31859.1| DNA replication and repair protein RecO [Burkholderia xenovorans
           LB400]
          Length = 306

 Score = 87.5 bits (216), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 28/156 (17%), Positives = 61/156 (39%), Gaps = 17/156 (10%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQ--SHRMQPILQAGNLVRVNWRSRLA 63
            A +L    Y E ++I++V++R +GR     +  +     ++ +LQ    + ++W  +  
Sbjct: 77  PAFVLHSYPYRETSLIIDVLSRDHGRLALVAKGAKRPHSALRGVLQTFQPLALSWSGKS- 135

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVP------LFRFLPEREPCLELYDMLNIF 117
                   EV     A+ +   L L G   +        L +F    +P  +L+    + 
Sbjct: 136 --------EVRTLTGAEWVGGMLPLTGGALLCGFYVNELLVKFCAREDPHPQLFHHYVVT 187

Query: 118 LNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVV 153
           +          ++    E +LL+  G+ + L + V 
Sbjct: 188 MTRLAHDEPPVQVLRSFERVLLRETGYAMALDRTVA 223


>gi|238796737|ref|ZP_04640243.1| DNA repair protein recO [Yersinia mollaretii ATCC 43969]
 gi|238719468|gb|EEQ11278.1| DNA repair protein recO [Yersinia mollaretii ATCC 43969]
          Length = 241

 Score = 87.5 bits (216), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 37/157 (23%), Positives = 62/157 (39%), Gaps = 7/157 (4%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNWRS 60
           WQ  A +L  R Y E +++L++ T   GR     +  +  R  ++  LQ    + V W  
Sbjct: 4   WQ-RAFVLHGRPYSETSLMLDLFTEGEGRMRVLAKGARGRRSNLKGCLQPFTPLLVRWSG 62

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           R  +       E +    A  LS S+   GL     L R L  +     L+      L  
Sbjct: 63  R-GEVKTLRSAEPVSL--ALPLSGSMLYSGLYVNELLSRVLEHQTNYSALFFDYLHCLQS 119

Query: 121 HKIPSVIGKIFVQ-IELMLLKNIGFGLDLTKCVVTGV 156
                   +  ++  EL +L ++G+G+D   C  +G 
Sbjct: 120 LAGSDGTPEYALRQFELAILAHLGYGVDFLHCSGSGQ 156


>gi|330815988|ref|YP_004359693.1| DNA repair protein RecO [Burkholderia gladioli BSR3]
 gi|327368381|gb|AEA59737.1| DNA repair protein RecO [Burkholderia gladioli BSR3]
          Length = 295

 Score = 87.5 bits (216), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 27/153 (17%), Positives = 57/153 (37%), Gaps = 17/153 (11%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQ--SHRMQPILQAGNLVRVNWRSRLA 63
              +L    Y E ++I++V+TR +GR     +  +     ++ +LQ    + ++W  +  
Sbjct: 66  PGFVLHSYPYRETSLIIDVLTRDHGRVALVAKGAKRPHSALRGVLQTFQPLSLSWSGKS- 124

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVP------LFRFLPEREPCLELYDMLNIF 117
                   E+     A+ +   L L G   +        L +F    +P   L+    + 
Sbjct: 125 --------EMRTLTGAEWVGGMLPLGGDALLCGFYVNELLVKFCAREDPFPPLFQHYLVT 176

Query: 118 LNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTK 150
           L          ++    E +LL+  G+   L +
Sbjct: 177 LARLAHDEPAVQVLRSFERVLLRETGYARALNR 209


>gi|311031642|ref|ZP_07709732.1| DNA repair protein RecO [Bacillus sp. m3-13]
          Length = 258

 Score = 87.5 bits (216), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 38/178 (21%), Positives = 71/178 (39%), Gaps = 5/178 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQ--SHRMQPILQAGNLVRVNW 58
           M  + + I++   +YGE N I+ + +++ G+     R     S R   + Q  +     +
Sbjct: 1   MLHKCEGIVIRTNAYGENNKIVTIYSKELGKVGVMARGANKPSSRFTAVSQLFSHATFVF 60

Query: 59  RSRLAQNLGEFR-FEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
           + R +  LG  +  E+++S  +      L  Y    +  + R   E +    LYD+L   
Sbjct: 61  Q-R-STGLGSLQQGEIMDSMRSIREDIFLTAYASFIVELMDRTTDEGKRNPALYDLLYQV 118

Query: 118 LNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSV 175
           L+          +    E+ +   IG   +L +C   G T+     S K GG +C   
Sbjct: 119 LHYINDGFDAEILTFIFEMKMCDVIGITPELNRCASCGATEGSFAFSIKEGGFLCNRC 176


>gi|207857986|ref|YP_002244637.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|238690389|sp|B5QTU6|RECO_SALEP RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|206709789|emb|CAR34141.1| DNA repair protein recO [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
          Length = 242

 Score = 87.5 bits (216), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 42/169 (24%), Positives = 69/169 (40%), Gaps = 20/169 (11%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVN 57
           M  WQ  A +L  R + E +++L+V T + GR     +  +S R  ++  LQ    + + 
Sbjct: 1   MEGWQ-RAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKRSNLKGALQPFTPLLLR 59

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLF------RFLPEREPCLEL- 110
           +  R          EV     A+ +S +L L G+     L+      R L       EL 
Sbjct: 60  YSGR---------GEVKTLRSAEAVSLALPLSGITLYSGLYINELLSRVLEYETRFSELF 110

Query: 111 YDMLNIFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQD 159
           +D LN                 + EL LL ++G+G++ T C  +G   D
Sbjct: 111 FDYLNCIQALAGTTGSPEPALRRFELALLGHLGYGVNFTHCAGSGERVD 159


>gi|16761491|ref|NP_457108.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Typhi str. CT18]
 gi|16765899|ref|NP_461514.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|29140812|ref|NP_804154.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|56412545|ref|YP_149620.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|62181144|ref|YP_217561.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|161612651|ref|YP_001586616.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Paratyphi B str. SPB7]
 gi|167549389|ref|ZP_02343148.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
 gi|167992710|ref|ZP_02573806.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|168243369|ref|ZP_02668301.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|194446629|ref|YP_002041842.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|194451401|ref|YP_002046641.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|197248854|ref|YP_002147537.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|197265533|ref|ZP_03165607.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|197361480|ref|YP_002141116.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|204929727|ref|ZP_03220801.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
 gi|213425278|ref|ZP_03358028.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Typhi str. E02-1180]
 gi|213583125|ref|ZP_03364951.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-0664]
 gi|213646355|ref|ZP_03376408.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Typhi str. J185]
 gi|224582879|ref|YP_002636677.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|238912697|ref|ZP_04656534.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Tennessee str. CDC07-0191]
 gi|289804219|ref|ZP_06534848.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Typhi str. AG3]
 gi|289825503|ref|ZP_06544710.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-3139]
 gi|61230222|sp|P0A285|RECO_SALTY RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|61230223|sp|P0A286|RECO_SALTI RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|62287383|sp|Q5PIG3|RECO_SALPA RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|75481600|sp|Q57LD2|RECO_SALCH RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|189039772|sp|A9N1T3|RECO_SALPB RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|238689917|sp|B5BAT2|RECO_SALPK RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|238690022|sp|B5F1F9|RECO_SALA4 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|238690622|sp|B4TE13|RECO_SALHS RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|238693589|sp|B4T1F6|RECO_SALNS RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|25300564|pir||AI0828 DNA repair protein RecO [imported] - Salmonella enterica subsp.
           enterica serovar Typhi (strain CT18)
 gi|16421126|gb|AAL21473.1| gap repair gene [Salmonella enterica subsp. enterica serovar
           Typhimurium str. LT2]
 gi|16503791|emb|CAD02781.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Typhi]
 gi|29136437|gb|AAO68003.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|56126802|gb|AAV76308.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|62128777|gb|AAX66480.1| gap repair gene [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. SC-B67]
 gi|161362015|gb|ABX65783.1| hypothetical protein SPAB_00347 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194405292|gb|ACF65514.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|194409705|gb|ACF69924.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|197092956|emb|CAR58386.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|197212557|gb|ACH49954.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|197243788|gb|EDY26408.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|204321446|gb|EDZ06646.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
 gi|205325288|gb|EDZ13127.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
 gi|205329107|gb|EDZ15871.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|205337667|gb|EDZ24431.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|224467406|gb|ACN45236.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|261247774|emb|CBG25602.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Typhimurium str. D23580]
 gi|267994705|gb|ACY89590.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 14028S]
 gi|301159127|emb|CBW18641.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Typhimurium str. SL1344]
 gi|312913568|dbj|BAJ37542.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Typhimurium str. T000240]
 gi|321222716|gb|EFX47787.1| DNA recombination and repair protein RecO [Salmonella enterica
           subsp. enterica serovar Typhimurium str. TN061786]
 gi|322715634|gb|EFZ07205.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. A50]
 gi|323130910|gb|ADX18340.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 4/74]
 gi|332989506|gb|AEF08489.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Typhimurium str. UK-1]
          Length = 242

 Score = 87.5 bits (216), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 42/169 (24%), Positives = 69/169 (40%), Gaps = 20/169 (11%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVN 57
           M  WQ  A +L  R + E +++L+V T + GR     +  +S R  ++  LQ    + + 
Sbjct: 1   MEGWQ-RAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKRSNLKGALQPFTPLLLR 59

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLF------RFLPEREPCLEL- 110
           +  R          EV     A+ +S +L L G+     L+      R L       EL 
Sbjct: 60  YSGR---------GEVKTLRSAEAVSLALPLSGITLYSGLYINELLSRVLEYETRFSELF 110

Query: 111 YDMLNIFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQD 159
           +D LN                 + EL LL ++G+G++ T C  +G   D
Sbjct: 111 FDYLNCIQALAGTTGSPEPALRRFELALLGHLGYGVNFTHCAGSGERVD 159


>gi|261867311|ref|YP_003255233.1| DNA repair protein RecO [Aggregatibacter actinomycetemcomitans
           D11S-1]
 gi|261412643|gb|ACX82014.1| DNA repair protein RecO [Aggregatibacter actinomycetemcomitans
           D11S-1]
          Length = 228

 Score = 87.5 bits (216), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 34/154 (22%), Positives = 63/154 (40%), Gaps = 10/154 (6%)

Query: 9   ILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNWRSRLAQNL 66
           +L  +SY E +++++++T  +GR     +  ++ R  ++ +LQ    + + W  R     
Sbjct: 1   MLHRKSYSETSLLIDLLTEDFGRISVLAKGARAKRSMLKGVLQPFTPLLLRWSGR----- 55

Query: 67  GEFRFEVLESHCAKLL-SSSLFLY-GLQSIVPLFRFLPEREPCLELYDMLNIFLNCHK-I 123
           GE +        A  L   ++ LY G      L R L       +L+      L      
Sbjct: 56  GELKILTKAEPAAIALPLQNIALYSGFYLNELLCRVLEPETAYPQLFQQYLQCLTQLAMN 115

Query: 124 PSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVT 157
              +       E  LL+ +G+G+D T C  +G T
Sbjct: 116 QQQVEPALRTFEFQLLRTLGYGIDFTHCAGSGNT 149


>gi|168466660|ref|ZP_02700514.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|195630758|gb|EDX49350.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
          Length = 242

 Score = 87.5 bits (216), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 42/169 (24%), Positives = 69/169 (40%), Gaps = 20/169 (11%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVN 57
           M  WQ  A +L  R + E +++L+V T + GR     +  +S R  ++  LQ    + + 
Sbjct: 1   MEGWQ-RAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKRSNLKGALQPFTPLLLR 59

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLF------RFLPEREPCLEL- 110
           +  R          EV     A+ +S +L L G+     L+      R L       EL 
Sbjct: 60  YSGR---------GEVKTLRSAEAVSLALPLSGITLYSGLYINELLSRVLEYETRFSELF 110

Query: 111 YDMLNIFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQD 159
           +D LN                 + EL LL ++G+G++ T C  +G   D
Sbjct: 111 FDYLNCIQALAGTTGSPEPALRRFELALLGHLGYGVNFTHCAGSGKRVD 159


>gi|168261370|ref|ZP_02683343.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
 gi|200388266|ref|ZP_03214878.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|199605364|gb|EDZ03909.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|205349603|gb|EDZ36234.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
          Length = 242

 Score = 87.1 bits (215), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 42/169 (24%), Positives = 69/169 (40%), Gaps = 20/169 (11%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVN 57
           M  WQ  A +L  R + E +++L+V T + GR     +  +S R  ++  LQ    + + 
Sbjct: 1   MEGWQ-RAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKRSNLKGALQPFTPLLLR 59

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLF------RFLPEREPCLEL- 110
           +  R          EV     A+ +S +L L G+     L+      R L       EL 
Sbjct: 60  YSGR---------GEVKTLRSAEAVSLALPLSGITLYSGLYINELLSRVLEYETRFSELF 110

Query: 111 YDMLNIFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQD 159
           +D LN                 + EL LL ++G+G++ T C  +G   D
Sbjct: 111 FDYLNCIQALAGTTGSPEPALRRFELALLGHLGYGVNFTHCAGSGERVD 159


>gi|167854944|ref|ZP_02477719.1| DNA repair protein RecO [Haemophilus parasuis 29755]
 gi|167853901|gb|EDS25140.1| DNA repair protein RecO [Haemophilus parasuis 29755]
          Length = 239

 Score = 87.1 bits (215), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 35/168 (20%), Positives = 59/168 (35%), Gaps = 12/168 (7%)

Query: 2   YWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNWR 59
            WQ    +L  R Y E +++++  T  +GR     +  +  R  ++ +LQ    + + W 
Sbjct: 4   QWQ-RGFVLHRREYSESSLLVDFFTENHGRITLLAKGVRRPRSPLKSVLQPFTPLLLKWT 62

Query: 60  SRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLN 119
            +        + E         + +     G      L R L       EL+      + 
Sbjct: 63  GK-GDLKTLTKAEPASLTLP--MQTLALYSGFYVNEVLARVLENHTAYPELFQHYLQCMT 119

Query: 120 CHK-IPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPK 166
                P+ I  I    E   LK +G+G+D   C  TG       V PK
Sbjct: 120 KLASQPNEIEPILRTFEFQTLKALGYGVDFCHCAATGKP-----VDPK 162


>gi|119361452|sp|Q13VN0|RECO_BURXL RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
          Length = 299

 Score = 87.1 bits (215), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 28/156 (17%), Positives = 61/156 (39%), Gaps = 17/156 (10%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQ--SHRMQPILQAGNLVRVNWRSRLA 63
            A +L    Y E ++I++V++R +GR     +  +     ++ +LQ    + ++W  +  
Sbjct: 70  PAFVLHSYPYRETSLIIDVLSRDHGRLALVAKGAKRPHSALRGVLQTFQPLALSWSGKS- 128

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVP------LFRFLPEREPCLELYDMLNIF 117
                   EV     A+ +   L L G   +        L +F    +P  +L+    + 
Sbjct: 129 --------EVRTLTGAEWVGGMLPLTGGALLCGFYVNELLVKFCAREDPHPQLFHHYVVT 180

Query: 118 LNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVV 153
           +          ++    E +LL+  G+ + L + V 
Sbjct: 181 MTRLAHDEPPVQVLRSFERVLLRETGYAMALDRTVA 216


>gi|14195092|sp|P57974|RECO_PASMU RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
          Length = 240

 Score = 87.1 bits (215), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 36/167 (21%), Positives = 65/167 (38%), Gaps = 11/167 (6%)

Query: 2   YWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNWR 59
            WQ    +L  ++Y E ++++E+ T + GR     +  ++ R  ++ ILQ    + + W 
Sbjct: 7   NWQ-RGFVLHRKAYSETSLLVELFTEETGRLTVLAKGARAKRSALKGILQPFTPLLLRWS 65

Query: 60  SRLAQNLGEFR-FEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELY-DMLNIF 117
            R    L      E   +  A  L  +    G      L R L        L+ D L   
Sbjct: 66  GRSE--LKTLTKVEP--AAIALPLQQTALYSGFYVNELLCRVLEPETGYPHLFQDYLRCL 121

Query: 118 LNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTG--VTQDLLW 162
                   +I       E  LL+ +G+G+D   C  +G  V +++ +
Sbjct: 122 TGLASAEHLIEPSLRHFEFQLLQTLGYGVDFCHCAGSGELVDENMTY 168


>gi|219870404|ref|YP_002474779.1| DNA repair protein RecO [Haemophilus parasuis SH0165]
 gi|254764635|sp|B8F3C9|RECO_HAEPS RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|219690608|gb|ACL31831.1| recombinational DNA repair protein (RecF pathway) [Haemophilus
           parasuis SH0165]
          Length = 239

 Score = 87.1 bits (215), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 35/168 (20%), Positives = 59/168 (35%), Gaps = 12/168 (7%)

Query: 2   YWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNWR 59
            WQ    +L  R Y E +++++  T  +GR     +  +  R  ++ +LQ    + + W 
Sbjct: 4   QWQ-RGFVLHRREYSESSLLVDFFTENHGRITLLAKGVRRPRSPLKSVLQPFTPLLLKWT 62

Query: 60  SRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLN 119
            +        + E         + +     G      L R L       EL+      + 
Sbjct: 63  GK-GDLKTLTKAEPASLTLP--MQTLALYSGFYVNEVLARVLENHTAYPELFQHYLHCMT 119

Query: 120 CHK-IPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPK 166
                P+ I  I    E   LK +G+G+D   C  TG       V PK
Sbjct: 120 KLASQPNEIEPILRTFEFQTLKALGYGVDFCHCAATGKP-----VDPK 162


>gi|257464704|ref|ZP_05629075.1| DNA repair protein RecO [Actinobacillus minor 202]
 gi|257450364|gb|EEV24407.1| DNA repair protein RecO [Actinobacillus minor 202]
          Length = 241

 Score = 87.1 bits (215), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 35/164 (21%), Positives = 70/164 (42%), Gaps = 13/164 (7%)

Query: 2   YWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNWR 59
            WQ    +L  R Y E ++++++ T  YGR     +  +  R  ++ +LQ    + + W 
Sbjct: 5   QWQ-RGFVLHKREYSETSLLVDLFTENYGRITLLAKGARRPRSPLKALLQPFTPLLLRWS 63

Query: 60  SRLAQNLGEFRFEVLESHCAKL---LSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNI 116
            +     G+ +  + +   A L   +++     G      L R L  +    EL+     
Sbjct: 64  GK-----GDLKV-LTKVEAAALTLPMNTKALYSGFYINEVLVRVLENQTAYQELFHHYLQ 117

Query: 117 FLNCHKIPSVIGKIFVQ-IELMLLKNIGFGLDLTKCVVTGVTQD 159
            +    + S   +  ++  E  +LK +G+G+D T C+ TG+  D
Sbjct: 118 CVTHLALRSEELEPILRTFEFHVLKALGYGVDFTHCMATGLDVD 161


>gi|289578135|ref|YP_003476762.1| DNA repair protein RecO [Thermoanaerobacter italicus Ab9]
 gi|289527848|gb|ADD02200.1| DNA repair protein RecO [Thermoanaerobacter italicus Ab9]
          Length = 248

 Score = 87.1 bits (215), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 39/180 (21%), Positives = 72/180 (40%), Gaps = 20/180 (11%)

Query: 4   QDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPI-----LQAGNLVRVNW 58
           + +AI+L   S GE + +  + T+ YG+     +  +  + + +         N V    
Sbjct: 5   KTEAIVLKNNSIGETDKMATLFTKNYGKLRAVAKGARRSKSRFVNAIRPFMVANYVIF-- 62

Query: 59  RSRLAQNLGEFRF---EVLESHCAKLLSSSLFLYGLQSIVP--LFRFLPEREPCLELYDM 113
                +    +     E++ESH  K +   L  + + S +   + + L E +   +LY  
Sbjct: 63  -----EGQNYYYIDQWELIESH--KNIEKDLVKFSVASYISETVNKILEENQKSEKLYQF 115

Query: 114 LNIFLNCHKIPSVIGKIFV-QIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVC 172
           L           +   IF+    L L+  +G+   L  C+V G  +DL + S   GG VC
Sbjct: 116 LKHSFKAVDELQIDPLIFIASYNLKLVSLLGYMPQLDNCIVCGKREDLKYFSNSCGGVVC 175


>gi|327484951|gb|AEA79358.1| DNA recombination and repair protein RecO [Vibrio cholerae
           LMA3894-4]
          Length = 241

 Score = 86.7 bits (214), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 36/166 (21%), Positives = 60/166 (36%), Gaps = 22/166 (13%)

Query: 8   IILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNWRSRLAQN 65
            +L  R Y E ++IL+V + +YGR     +  +  R  ++  LQ    + + W    +  
Sbjct: 9   FVLHRRPYSESSLILDVFSEEYGRVSLMAKGARGKRSNLKGALQPFTPLLLKWSGNSS-- 66

Query: 66  LGEFRFEVLESHCAKLLSSSLFLYGLQSIVPL------FRFLPEREPCLELYDMLNIFLN 119
                  +     A+ +S  L L G+     +       R L        L+      L 
Sbjct: 67  -------MKTLRQAEPISLGLPLSGVYLYSAMYINELVDRVLMPEVASPGLFHDYLFALT 119

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSP 165
                +       + EL LL  +G+G+D   C  TG       VSP
Sbjct: 120 ELAQSTNPEPALRRFELALLAAMGYGVDFLHCAGTGEP-----VSP 160


>gi|15603732|ref|NP_246806.1| DNA repair protein RecO [Pasteurella multocida subsp. multocida
           str. Pm70]
 gi|12722295|gb|AAK03951.1| RecO [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 236

 Score = 86.7 bits (214), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 37/169 (21%), Positives = 66/169 (39%), Gaps = 12/169 (7%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVN 57
           M  WQ    +L  ++Y E ++++E+ T + GR     +  ++ R  ++ ILQ    + + 
Sbjct: 1   MENWQ-RGFVLHRKAYSETSLLVELFTEETGRLTVLAKGARAKRSALKGILQPFTPLLLR 59

Query: 58  WRSRLAQNLGEFR-FEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELY-DMLN 115
           W  R    L      E   +  A  L  +    G      L R L        L+ D L 
Sbjct: 60  WSGRSE--LKTLTKVEP--AAIALPLQQTALYSGFYVNELLCRVLEPETGYPHLFQDYLR 115

Query: 116 IFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTG--VTQDLLW 162
                     +I       E  LL+ +G+G+D   C  +G  V +++ +
Sbjct: 116 CLTGLASAEHLIEPSLRHFEFQLLQTLGYGVDFCHCAGSGELVDENMTY 164


>gi|218710567|ref|YP_002418188.1| DNA repair protein RecO [Vibrio splendidus LGP32]
 gi|254790741|sp|B7VK77|RECO_VIBSL RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|218323586|emb|CAV19825.1| DNA repair protein recO [Vibrio splendidus LGP32]
          Length = 242

 Score = 86.7 bits (214), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 35/160 (21%), Positives = 58/160 (36%), Gaps = 17/160 (10%)

Query: 8   IILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNWRSRLAQN 65
            +L  R Y E ++IL+V + +YGR     +  +S R  ++  LQ    + + W       
Sbjct: 9   FVLHRRPYSESSLILDVFSEEYGRVTLMSKGARSKRSNLKGALQPFTPLLLKWSGN---- 64

Query: 66  LGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLF------RFLPEREPCLELYDMLNIFLN 119
            G  +        A+ +S  L L G+     ++      R L         +      L 
Sbjct: 65  -GSMK----TLRQAEPISLGLPLAGINLYSAMYVNELVGRVLMAEVAMPAFFHDYLHALT 119

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQD 159
                        + EL LL  +G+G+D   C  TG   D
Sbjct: 120 ELAHNENPEPALRRFELALLSAMGYGVDFLHCAGTGEAID 159


>gi|312173246|emb|CBX81501.1| DNA repair protein recO (Recombination protein O) [Erwinia
           amylovora ATCC BAA-2158]
          Length = 245

 Score = 86.7 bits (214), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 38/164 (23%), Positives = 65/164 (39%), Gaps = 19/164 (11%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNWRS 60
           WQ  A +L  R + E +++L++ + Q GR     +  +S R  ++  LQ    + V W  
Sbjct: 4   WQ-RAFVLHGRPWSETSLLLDLFSEQCGRVRVLAKGARSKRSSLKGALQPFTPLLVRWSG 62

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLF------RFLPEREPCLELYDML 114
           R          EV     A+ +S +L L G      L+      R L       EL+   
Sbjct: 63  R---------GEVKTLRAAEPVSLALPLSGTTLYCGLYVNELLSRVLQHETAFSELFFDY 113

Query: 115 NIFLNCHKIPSVIGK-IFVQIELMLLKNIGFGLDLTKCVVTGVT 157
              +      S   +    + EL +L ++G+G+D   C  +G  
Sbjct: 114 LQCIQTLAADSGSPEPALRRFELSMLGHLGYGVDFLHCAGSGEE 157


>gi|254252843|ref|ZP_04946161.1| Recombinational DNA repair protein (RecF pathway) [Burkholderia
           dolosa AUO158]
 gi|124895452|gb|EAY69332.1| Recombinational DNA repair protein (RecF pathway) [Burkholderia
           dolosa AUO158]
          Length = 278

 Score = 86.7 bits (214), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 33/173 (19%), Positives = 67/173 (38%), Gaps = 19/173 (10%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQ--SHRMQPILQAGNLVRVNWRSRLA 63
            A +L    Y E ++I++V+TR +GR     +  +     ++ +LQ    + ++W  +  
Sbjct: 49  PAFVLHSYPYRETSLIIDVLTRDHGRLALVAKGAKRPHSALRGVLQTFQPLLLSWSGKS- 107

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVP------LFRFLPEREPCLELYDMLNIF 117
                   EV     A+ +   L L G   +        L +F    +    L++   + 
Sbjct: 108 --------EVRTLTGAEWVGGMLPLGGDALLCGFYANELLVKFCAREDSQPPLFNHYVLT 159

Query: 118 LNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQ-DLLWV-SPKSG 168
           L          ++    E +LL+  G+ + L + V     + D  +V  P+ G
Sbjct: 160 LTRLAHGEPAVQVLRSFERVLLRETGYAMALNRTVARRAVEPDRRYVFDPERG 212


>gi|229514085|ref|ZP_04403547.1| DNA recombination and repair protein RecO [Vibrio cholerae TMA 21]
 gi|229349266|gb|EEO14223.1| DNA recombination and repair protein RecO [Vibrio cholerae TMA 21]
          Length = 241

 Score = 86.3 bits (213), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 36/166 (21%), Positives = 60/166 (36%), Gaps = 22/166 (13%)

Query: 8   IILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNWRSRLAQN 65
            +L  R Y E ++IL+V + +YGR     +  +  R  ++  LQ    + + W    +  
Sbjct: 9   FVLHRRPYSESSLILDVFSEEYGRVTLMAKGARGKRSNLKGALQPFTPLLLKWSGNSS-- 66

Query: 66  LGEFRFEVLESHCAKLLSSSLFLYGLQSIVPL------FRFLPEREPCLELYDMLNIFLN 119
                  +     A+ +S  L L G+     +       R L        L+      L 
Sbjct: 67  -------MKTLRQAEPISLGLPLSGVYLYSAMYINELVDRVLMPEVASPGLFHDYLFALT 119

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSP 165
                +       + EL LL  +G+G+D   C  TG       VSP
Sbjct: 120 ELAQSTNPEPALRRFELALLAAMGYGVDFLHCAGTGEP-----VSP 160


>gi|229524446|ref|ZP_04413851.1| DNA recombination and repair protein RecO [Vibrio cholerae bv.
           albensis VL426]
 gi|262190711|ref|ZP_06048942.1| DNA recombination and repair protein RecO [Vibrio cholerae CT
           5369-93]
 gi|229338027|gb|EEO03044.1| DNA recombination and repair protein RecO [Vibrio cholerae bv.
           albensis VL426]
 gi|262033423|gb|EEY51930.1| DNA recombination and repair protein RecO [Vibrio cholerae CT
           5369-93]
          Length = 241

 Score = 86.3 bits (213), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 36/166 (21%), Positives = 60/166 (36%), Gaps = 22/166 (13%)

Query: 8   IILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNWRSRLAQN 65
            +L  R Y E ++IL+V + +YGR     +  +  R  ++  LQ    + + W    +  
Sbjct: 9   FVLHRRPYSESSLILDVFSEEYGRVTLMAKGARGKRSNLKGALQPFTPLLLKWSGNSS-- 66

Query: 66  LGEFRFEVLESHCAKLLSSSLFLYGLQSIVPL------FRFLPEREPCLELYDMLNIFLN 119
                  +     A+ +S  L L G+     +       R L        L+      L 
Sbjct: 67  -------MKTLRQAEPISLGLPLSGVYLYSAMYINELVDRVLMPEVASPGLFHDYLFALT 119

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSP 165
                +       + EL LL  +G+G+D   C  TG       VSP
Sbjct: 120 ELAQSTNPEPALRRFELALLAAMGYGVDFLHCAGTGEP-----VSP 160


>gi|260913269|ref|ZP_05919751.1| recombination protein O [Pasteurella dagmatis ATCC 43325]
 gi|260632856|gb|EEX51025.1| recombination protein O [Pasteurella dagmatis ATCC 43325]
          Length = 237

 Score = 86.3 bits (213), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 33/163 (20%), Positives = 64/163 (39%), Gaps = 11/163 (6%)

Query: 2   YWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNWR 59
            WQ    +L  ++Y E ++++++ T + GR     +  ++ R  ++ +LQ    + + W 
Sbjct: 4   NWQ-RGFVLHRKAYSETSLLVDLFTEESGRLTVIAKGARAKRSSLKSVLQPFTPLLLRWT 62

Query: 60  SRLAQNLGEFRFEVLESHCAKLL-SSSLFLY-GLQSIVPLFRFLPEREPCLELYDMLNIF 117
            +     GE +        A  L      LY G      L R L       +L+      
Sbjct: 63  GK-----GELKTLTKAEPAAIALPLQHTALYSGFYVNELLSRVLEPETAYPQLFQNYLRC 117

Query: 118 LNCHKIPSVIGKIFVQ-IELMLLKNIGFGLDLTKCVVTGVTQD 159
           L      +   + +++  E  LL  +G+G+D   C  +G   D
Sbjct: 118 LTGLASNTQQVEPYLRHFEFELLHTLGYGVDFCHCAGSGKIVD 160


>gi|213161853|ref|ZP_03347563.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Typhi str. E00-7866]
          Length = 221

 Score = 86.0 bits (212), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 42/169 (24%), Positives = 69/169 (40%), Gaps = 20/169 (11%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVN 57
           M  WQ  A +L  R + E +++L+V T + GR     +  +S R  ++  LQ    + + 
Sbjct: 1   MEGWQ-RAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKRSNLKGALQPFTPLLLR 59

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLF------RFLPEREPCLEL- 110
           +  R          EV     A+ +S +L L G+     L+      R L       EL 
Sbjct: 60  YSGR---------GEVKTLRSAEAVSLALPLSGITLYSGLYINELLSRVLEYETRFSELF 110

Query: 111 YDMLNIFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQD 159
           +D LN                 + EL LL ++G+G++ T C  +G   D
Sbjct: 111 FDYLNCIQALAGTTGSPEPALRRFELALLGHLGYGVNFTHCAGSGERVD 159


>gi|33152640|ref|NP_873993.1| DNA repair protein RecO [Haemophilus ducreyi 35000HP]
 gi|42559454|sp|Q7VL77|RECO_HAEDU RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|33148864|gb|AAP96382.1| DNA repair protein RecO [Haemophilus ducreyi 35000HP]
          Length = 240

 Score = 86.0 bits (212), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 32/158 (20%), Positives = 58/158 (36%), Gaps = 7/158 (4%)

Query: 2   YWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNWR 59
            WQ    +L  R Y E +++++  T Q+GR     +  +  R  ++ +LQ    + + W 
Sbjct: 4   QWQ-RGFVLHRREYRETSLLVDFFTEQHGRITLLAKGAKRVRSPLKAVLQPFTPLLLRWS 62

Query: 60  SRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELY-DMLNIFL 118
            +        + E         +  +    GL     L R L  +     L+   L    
Sbjct: 63  GK-GDLKVLTKAEPAALTLP--MHHTALYSGLYVNEILIRVLENQTAYTALFQHYLQCIT 119

Query: 119 NCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGV 156
                P  +       E  LLK +G+G++ + C  TG 
Sbjct: 120 QLATQPEKLQVTLRTFEFHLLKALGYGVNFSICAATGQ 157


>gi|297544410|ref|YP_003676712.1| DNA repair protein RecO [Thermoanaerobacter mathranii subsp.
           mathranii str. A3]
 gi|296842185|gb|ADH60701.1| DNA repair protein RecO [Thermoanaerobacter mathranii subsp.
           mathranii str. A3]
          Length = 248

 Score = 86.0 bits (212), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 39/180 (21%), Positives = 72/180 (40%), Gaps = 20/180 (11%)

Query: 4   QDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPI-----LQAGNLVRVNW 58
           + +AI+L   S GE + +  + T+ YG+     +  +  + + +         N V    
Sbjct: 5   KTEAIVLKNNSIGETDKMATLFTKNYGKLRAVAKGARRSKSRFVNAIRPFMVANYVIF-- 62

Query: 59  RSRLAQNLGEFRF---EVLESHCAKLLSSSLFLYGLQSIVP--LFRFLPEREPCLELYDM 113
                +    +     E++ESH  K +   L  + + S +   + + L E +   +LY  
Sbjct: 63  -----EGQNYYYIDQWELIESH--KNIEKDLVKFSVASYISETVNKILEENQKSEKLYQF 115

Query: 114 LNIFLNCHKIPSVIGKIFV-QIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVC 172
           L           +   IF+    L L+  +G+   L  C+V G  +DL + S   GG VC
Sbjct: 116 LKHSFKAVNELQIDPLIFIVSYNLKLVSLLGYMPQLDNCIVCGKREDLKYFSNSCGGVVC 175


>gi|153826906|ref|ZP_01979573.1| DNA repair protein RecO [Vibrio cholerae MZO-2]
 gi|229527067|ref|ZP_04416462.1| DNA recombination and repair protein RecO [Vibrio cholerae
           12129(1)]
 gi|254291659|ref|ZP_04962447.1| DNA repair protein RecO [Vibrio cholerae AM-19226]
 gi|149739269|gb|EDM53531.1| DNA repair protein RecO [Vibrio cholerae MZO-2]
 gi|150422431|gb|EDN14390.1| DNA repair protein RecO [Vibrio cholerae AM-19226]
 gi|229335464|gb|EEO00946.1| DNA recombination and repair protein RecO [Vibrio cholerae
           12129(1)]
          Length = 241

 Score = 86.0 bits (212), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 37/166 (22%), Positives = 60/166 (36%), Gaps = 22/166 (13%)

Query: 8   IILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNWRSRLAQN 65
            +L  R Y E ++IL+V + +YGR     +  +  R  ++  LQ    + + W       
Sbjct: 9   FVLHRRPYSESSLILDVFSEEYGRVSLMAKGARGKRSNLKGALQPFTPLLLKWSGN---- 64

Query: 66  LGEFRFEVLESHCAKLLSSSLFLYGLQSIVPL------FRFLPEREPCLELYDMLNIFLN 119
            G  +        A+ +S  L L G+     +       R L        L+      L 
Sbjct: 65  -GSMK----TLRQAEPISLGLPLSGVYLYSAMYINELVDRVLMPEVASPGLFHDYLFALT 119

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSP 165
                +       + EL LL  +G+G+D   C  TG       VSP
Sbjct: 120 ELAQSTNPEPALRRFELALLAAMGYGVDFLHCAGTGEP-----VSP 160


>gi|153803097|ref|ZP_01957683.1| DNA repair protein RecO [Vibrio cholerae MZO-3]
 gi|153830872|ref|ZP_01983539.1| DNA repair protein RecO [Vibrio cholerae 623-39]
 gi|124121379|gb|EAY40122.1| DNA repair protein RecO [Vibrio cholerae MZO-3]
 gi|148873641|gb|EDL71776.1| DNA repair protein RecO [