BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780948|ref|YP_003065361.1| DNA repair protein RecO
[Candidatus Liberibacter asiaticus str. psy62]
         (240 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|239831498|ref|ZP_04679827.1| DNA repair protein RecO [Ochrobactrum intermedium LMG 3301]
 gi|239823765|gb|EEQ95333.1| DNA repair protein RecO [Ochrobactrum intermedium LMG 3301]
          Length = 245

 Score =  207 bits (526), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 106/241 (43%), Positives = 152/241 (63%), Gaps = 1/241 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D+ IILG R +GE + I+EVMTR++GRH+G VR G+S RMQP+LQ GN V V W +
Sbjct: 3   MEWRDEGIILGTRRHGETSAIVEVMTREHGRHMGMVRGGRSRRMQPLLQPGNHVDVTWWA 62

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL +++G F  E LE   A+L+ + + LYG+Q      R LPER+P   LY+ L + +  
Sbjct: 63  RLDEHMGSFTIEPLEFAAARLIETPVALYGIQLAASHLRLLPERDPHRGLYETLRLIIEH 122

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P   G++ ++ E+M+L+ +GFGLDL +C  TGV +DL++VSPKSG AVCR VG P+A
Sbjct: 123 FDDPLASGELVLRFEVMMLEELGFGLDLKECAATGVKEDLIYVSPKSGRAVCREVGAPWA 182

Query: 181 EKMLVLPSFLWKEE-QTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLEL 239
           +K+L+LP F+     +    D +  AF +T YFL ++  +   I     R  FL  L   
Sbjct: 183 DKLLLLPGFVNNTAVRAASYDDIDHAFTMTGYFLMRHVWEPRAITPPDARGGFLNALGRA 242

Query: 240 I 240
           I
Sbjct: 243 I 243


>gi|153009952|ref|YP_001371167.1| DNA repair protein RecO [Ochrobactrum anthropi ATCC 49188]
 gi|151561840|gb|ABS15338.1| DNA repair protein RecO [Ochrobactrum anthropi ATCC 49188]
          Length = 243

 Score =  206 bits (525), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 105/241 (43%), Positives = 151/241 (62%), Gaps = 1/241 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D+ IILG R +GE + I+EVMTR++GRH+G VR G+S RMQP+LQ GN V V W +
Sbjct: 1   MEWRDEGIILGTRRHGETSAIVEVMTREHGRHMGMVRGGRSRRMQPLLQPGNHVDVTWWA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL +++G F  E LE   A+L+ + + LYG+Q      R LPER+P   LY+ L + +  
Sbjct: 61  RLDEHMGSFTIEPLEFAAARLIETPVALYGIQLAASHLRLLPERDPHRGLYETLRLIIEH 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P   G++ ++ E+M+L+ +GFGLDL KC  TGV +DL++VSPKSG AVCR  G P+A
Sbjct: 121 FDDPLASGELVLRFEVMMLEELGFGLDLKKCAATGVKEDLIYVSPKSGRAVCRDAGAPWA 180

Query: 181 EKMLVLPSFLWKEE-QTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLEL 239
           +K+L+LP F+     +    D +  AF +T YFL ++  +   +     R  FL  L   
Sbjct: 181 DKLLLLPGFVNNTAVRASSYDDIDHAFTMTGYFLMRHVWEPRAVTPPDARGGFLNALGRA 240

Query: 240 I 240
           I
Sbjct: 241 I 241


>gi|260462318|ref|ZP_05810526.1| DNA repair protein RecO [Mesorhizobium opportunistum WSM2075]
 gi|259031812|gb|EEW33080.1| DNA repair protein RecO [Mesorhizobium opportunistum WSM2075]
          Length = 258

 Score =  203 bits (515), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 103/239 (43%), Positives = 151/239 (63%), Gaps = 1/239 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D+ IILG R +GE + ILEVMTR +GRHLG VR G+S + QP+LQ GN V + WR+
Sbjct: 1   MEWRDEGIILGTRKHGETSAILEVMTRTHGRHLGLVRGGRSRKQQPVLQPGNRVDLLWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG F+ E +E + A+L+ S++ +YGLQ++    R LPER+    LY+ L++ +  
Sbjct: 61  RLDEHLGTFQAEPIEMNAARLMDSAIAVYGLQTMAAHLRLLPERDAHGGLYEALSVMIVH 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
                  G++  + EL++L  +GFGLDL++C  TG  QDL +VSPKSG AV R  GLP+ 
Sbjct: 121 LDDADAAGELVARFELLILDELGFGLDLSRCAATGTQQDLAYVSPKSGRAVSREAGLPWR 180

Query: 181 EKMLVLPSFL-WKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLE 238
           +KML LP+FL        D  +++ AF+LT +F  ++  +   I     R  FL  L +
Sbjct: 181 DKMLALPAFLQRGSGLRADPGAVEDAFRLTGFFFTRHVYEPRAIEQPDARLGFLAALRK 239


>gi|13476445|ref|NP_108015.1| DNA repair protein RecO [Mesorhizobium loti MAFF303099]
 gi|20139624|sp|Q985A3|RECO_RHILO RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|14027206|dbj|BAB54160.1| DNA repair protein; RecO [Mesorhizobium loti MAFF303099]
          Length = 253

 Score =  201 bits (511), Expect = 7e-50,   Method: Composition-based stats.
 Identities = 102/239 (42%), Positives = 150/239 (62%), Gaps = 1/239 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D+ IILG R +GE + ILEVMTR +GRHLG VR G+S + QP+LQ GN V + WR+
Sbjct: 1   MEWRDEGIILGTRKHGETSAILEVMTRAHGRHLGLVRGGRSRKQQPVLQPGNRVDLLWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG F+ E +E + A+L+ S++ +YGLQ++    R LPER+    LY+ L++ +  
Sbjct: 61  RLDEHLGTFQAEAIEMNAARLMDSAVAVYGLQTMAAHLRLLPERDAHGGLYEALSVMIVH 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
                  G++  + EL++L  +GFGLDL++C  TG  QDL +VSPKSG AV R  G P+ 
Sbjct: 121 LDDADAAGELVARFELLILDELGFGLDLSQCAATGTRQDLAYVSPKSGRAVSREAGAPWR 180

Query: 181 EKMLVLPSFL-WKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLE 238
           +KML LP+FL        D  +++ AF+LT +F  ++  +   I     R  FL  L +
Sbjct: 181 DKMLALPAFLQRGSGLRADPAAVEDAFRLTGFFFTRHVYEPRAIEQPDARAGFLAALRK 239


>gi|90424142|ref|YP_532512.1| DNA repair protein RecO [Rhodopseudomonas palustris BisB18]
 gi|119361479|sp|Q214J3|RECO_RHOPB RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|90106156|gb|ABD88193.1| DNA repair protein RecO [Rhodopseudomonas palustris BisB18]
          Length = 254

 Score =  200 bits (507), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 97/242 (40%), Positives = 139/242 (57%), Gaps = 3/242 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W D+ I+LGVR +GE + I+E++TR +GRHLG VR G   +++P+LQ GN V   WR+
Sbjct: 1   MEWTDEGIVLGVRRHGESSAIVELLTRGHGRHLGLVRGGAGSKLRPLLQPGNSVSAVWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG +  E      A LL+SS  +YG+  +  L R LPER+P  E+Y+ L   L+ 
Sbjct: 61  RLDEHLGYYVLEGTRMRAAMLLASSHAVYGVTHLASLARLLPERDPQPEIYERLERTLDD 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
                      ++ EL +L  +GFGLDL  C  TGVT DL++VSPKSGGAV R+ G P+ 
Sbjct: 121 FDDVGEAAVHVIRFELTMLAELGFGLDLANCAATGVTSDLIYVSPKSGGAVSRAAGEPWR 180

Query: 181 EKMLVLPSFLWKEE---QTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLL 237
           +K+L LP FL +            L+  F LT  FL +  L+         R+ F+  ++
Sbjct: 181 DKLLRLPPFLREGSAQRNDWSDQDLQDGFLLTGRFLLRNVLEPRGQGHSDARDGFINAVV 240

Query: 238 EL 239
            L
Sbjct: 241 RL 242


>gi|85716281|ref|ZP_01047255.1| DNA repair protein RecO [Nitrobacter sp. Nb-311A]
 gi|85696953|gb|EAQ34837.1| DNA repair protein RecO [Nitrobacter sp. Nb-311A]
          Length = 260

 Score =  199 bits (505), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 98/241 (40%), Positives = 137/241 (56%), Gaps = 3/241 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W DD I+LGVR +GE + I+E++TR +GRHLG VR G   RM+P+LQ GN V   WR+
Sbjct: 1   MEWIDDGIVLGVRRHGESSAIVELLTRDHGRHLGLVRGGAGSRMRPLLQPGNSVNALWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG +  E      A LL+SS   YG+  +  L R LPER+P   ++ ML   L+ 
Sbjct: 61  RLDEHLGAYALEGTRMRAASLLASSHATYGVTHLAALARLLPERDPHEGIFTMLERTLDD 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
                      ++ EL +L  +GFGLDL+ C  TGVT DL++VSPKSGGAV R  G P+ 
Sbjct: 121 FDHAGGAAIHLIRFELAMLSELGFGLDLSACAATGVTGDLIYVSPKSGGAVSRQAGEPWR 180

Query: 181 EKMLVLPSFLW---KEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLL 237
           +++L LP FL     E+       L   F+LT  FL ++ L+         R  F+  ++
Sbjct: 181 DRLLPLPPFLRASHDEQNGCSEQDLLDGFELTGRFLLRHVLEPRGQGHSDARAGFINAVV 240

Query: 238 E 238
            
Sbjct: 241 R 241


>gi|6655025|gb|AAF22872.1| recO-like protein [Bradyrhizobium japonicum]
          Length = 250

 Score =  198 bits (503), Expect = 5e-49,   Method: Composition-based stats.
 Identities = 96/240 (40%), Positives = 138/240 (57%), Gaps = 2/240 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W D+ I+LGVR +GE + I+E++TR +GRHLG VR G   RM+P+LQ GN V   WR+
Sbjct: 1   MEWTDEGIVLGVRRHGESSAIVELLTRAHGRHLGLVRGGAGSRMRPLLQPGNSVTAVWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG +  E L+   A LL+SS  +YG+  +  + R LPER+P  E++ +L   L+ 
Sbjct: 61  RLDEHLGTYAVEGLKLRAATLLASSHGVYGVTHLASIARLLPERDPHEEIFGLLEHSLDD 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
                      +  EL +L  +GFGL L  C VTG T DL++VSPKSGGAV R  G P+ 
Sbjct: 121 FDDIGSAAVHVIHFELAMLAELGFGLALDNCAVTGETTDLIYVSPKSGGAVSRGAGEPWR 180

Query: 181 EKMLVLPSFLW--KEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLE 238
           +++L LP FL   +    +    L+  F+LT  FL ++ L+         R  F+  L  
Sbjct: 181 DRLLRLPPFLRHGETATELTDQDLQDGFRLTGLFLLRHVLEPRGQVHSDARAGFINALTR 240


>gi|27380169|ref|NP_771698.1| DNA repair protein RecO [Bradyrhizobium japonicum USDA 110]
 gi|30179751|sp|Q9RH67|RECO_BRAJA RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|27353323|dbj|BAC50323.1| recO-like protein [Bradyrhizobium japonicum USDA 110]
          Length = 250

 Score =  198 bits (503), Expect = 5e-49,   Method: Composition-based stats.
 Identities = 96/240 (40%), Positives = 138/240 (57%), Gaps = 2/240 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W D+ I+LGVR +GE + I+E++TR +GRHLG VR G   RM+P+LQ GN V   WR+
Sbjct: 1   MEWTDEGIVLGVRRHGESSAIVELLTRAHGRHLGLVRGGAGSRMRPLLQPGNSVSAVWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG +  E L+   A LL+SS  +YG+  +  + R LPER+P  E++ +L   L+ 
Sbjct: 61  RLDEHLGTYAVEGLKLRAATLLASSHGVYGVTHLASIARLLPERDPHEEIFGLLEHSLDD 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
                      +  EL +L  +GFGL L  C VTG T DL++VSPKSGGAV R  G P+ 
Sbjct: 121 FDDIGSAAVHVIHFELAMLAELGFGLALDNCAVTGETTDLIYVSPKSGGAVSRGAGEPWR 180

Query: 181 EKMLVLPSFLW--KEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLE 238
           +++L LP FL   +    +    L+  F+LT  FL ++ L+         R  F+  L  
Sbjct: 181 DRLLRLPPFLRHGETATELTDQDLQDGFRLTGLFLLRHVLEPRGQVHSDARAGFINALTR 240


>gi|149913474|ref|ZP_01902007.1| DNA repair protein RecO [Roseobacter sp. AzwK-3b]
 gi|149812594|gb|EDM72423.1| DNA repair protein RecO [Roseobacter sp. AzwK-3b]
          Length = 244

 Score =  198 bits (503), Expect = 6e-49,   Method: Composition-based stats.
 Identities = 83/244 (34%), Positives = 127/244 (52%), Gaps = 6/244 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D  I+L  R++GE ++I+EV T ++GRH G VR G S ++ P+LQ G  + + WR+
Sbjct: 1   MEWRDQGILLSTRTHGETSVIIEVFTPEHGRHAGVVRGGTSRKLAPVLQPGAQLDLRWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFR-FLPEREPCLELYDMLNIFLN 119
           RL  ++G F  E + S  A  +   L L GL ++  L    LP+RE    LY      L+
Sbjct: 61  RLEDHIGTFTVEPVRSRAAASMGDRLSLAGLNAVTALLLFCLPDREAHRRLYRRTEALLD 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVT-QDLLWVSPKSGGAVCRSVGLP 178
                 V    ++  E+ LL  +GFGLDL+ C V G    DL +VSP+SG AV R+    
Sbjct: 121 LLGQGDVWPLAYLNWEMALLDEMGFGLDLSGCAVMGPQANDLSYVSPRSGRAVSRAGAGE 180

Query: 179 YAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQH--NIIHCHLLRENFLGKL 236
           +A+++L LP+ L       DA  +   FQ+T +FL  + L            R+ F+ + 
Sbjct: 181 WADRLLPLPACLLGAGPAPDA-EVAEGFQVTGHFLQNH-LAPELGNKPLPAARQRFVDRF 238

Query: 237 LELI 240
              +
Sbjct: 239 RARL 242


>gi|319784500|ref|YP_004143976.1| DNA repair protein RecO [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
 gi|317170388|gb|ADV13926.1| DNA repair protein RecO [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
          Length = 258

 Score =  197 bits (501), Expect = 8e-49,   Method: Composition-based stats.
 Identities = 104/239 (43%), Positives = 151/239 (63%), Gaps = 1/239 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D+ IILG R +GE + ILEV+TR +GRHLG VR G+S + QP+LQ GN V + WR+
Sbjct: 1   MEWRDEGIILGTRKHGETSAILEVLTRAHGRHLGLVRGGRSRKQQPVLQPGNRVDLLWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG F+ E +E + A+L+ S++ +YGLQ++    R LPER+    LY+ L + +  
Sbjct: 61  RLDEHLGTFQAEAIEMNAARLMDSAVAVYGLQTMAAHLRLLPERDAHEGLYETLAVMIVH 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
                V G++  + EL++L  +GFGLDL++C  TG  QDL +VSPKSG AV R  GLP+ 
Sbjct: 121 LDDADVAGELVARFELLVLDELGFGLDLSQCAATGTRQDLAYVSPKSGRAVSREAGLPWR 180

Query: 181 EKMLVLPSFL-WKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLE 238
           ++ML LP+FL        DA  +  AF+LT +F N++  +   I     R  FL  L +
Sbjct: 181 DRMLALPAFLQRGSGLRADAADVDDAFRLTGFFFNRHVYEPRGIEPPDARTGFLAALRK 239


>gi|254718804|ref|ZP_05180615.1| DNA repair protein RecO [Brucella sp. 83/13]
 gi|265983786|ref|ZP_06096521.1| DNA repair protein recO [Brucella sp. 83/13]
 gi|264662378|gb|EEZ32639.1| DNA repair protein recO [Brucella sp. 83/13]
          Length = 247

 Score =  197 bits (501), Expect = 9e-49,   Method: Composition-based stats.
 Identities = 101/241 (41%), Positives = 145/241 (60%), Gaps = 1/241 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D+ +ILG R +GE + I+EVMT  +GRH+G VR G+S RMQP+LQ GN V V+W +
Sbjct: 1   MEWRDEGVILGTRRHGETSAIVEVMTCGHGRHMGMVRGGRSRRMQPLLQPGNHVDVSWWA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL +++G F  E L    A+L+ + + LYG+Q      R LPER+P   LY+ L + +  
Sbjct: 61  RLDEHMGTFTIEPLGFAAARLIETPVALYGIQLAAAHLRLLPERDPHRGLYETLRLIIEH 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P   G++ ++ E+M+L+ +GFGLDL +C  TG   DL++VSPKSG AVCR  G P+A
Sbjct: 121 FDDPLAAGELLLRFEVMMLEELGFGLDLKECAATGRKDDLIYVSPKSGRAVCREAGAPWA 180

Query: 181 EKMLVLPSFLWKEEQTID-ADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLEL 239
           +K+L LPSF+          D L  AF +T YFL ++  +         R  FL  +   
Sbjct: 181 DKLLALPSFVNDTALRASCYDDLDRAFTMTGYFLMRHVWEPRAQTPPDSRSGFLNAVGRA 240

Query: 240 I 240
           I
Sbjct: 241 I 241


>gi|162139842|ref|YP_318527.2| DNA repair protein RecO [Nitrobacter winogradskyi Nb-255]
 gi|119361470|sp|Q3SRB6|RECO_NITWN RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
          Length = 262

 Score =  197 bits (501), Expect = 9e-49,   Method: Composition-based stats.
 Identities = 97/241 (40%), Positives = 136/241 (56%), Gaps = 3/241 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W DD I+LGVR +GE + I+E++TR +GRHLG VR G   RM+P+LQ GN V   WR+
Sbjct: 1   MEWTDDGIVLGVRRHGESSAIVELLTRTHGRHLGLVRGGAGSRMRPLLQPGNSVSALWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG +  E      A LL+SS   YG+  +  L R LPER+P   ++ ML   L+ 
Sbjct: 61  RLDEHLGTYALEGTRMRAASLLASSHATYGVTHLAALARLLPERDPHEVIFAMLERTLDD 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
                      ++ EL +L  +GFGLDL+ C  TG T DL++VSPKSGGAV R  G P+ 
Sbjct: 121 FDRAGGAAIHLIRFELAMLSELGFGLDLSACAATGATGDLIYVSPKSGGAVSRQAGEPWR 180

Query: 181 EKMLVLPSFLW---KEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLL 237
           +++L LP FL     E+       L   F+LT  FL ++ L+         R  F+  ++
Sbjct: 181 DRLLPLPPFLRVTHDEQDGWSEQDLLDGFELTGRFLLRHVLEPRGQGHSDARAGFINAVV 240

Query: 238 E 238
            
Sbjct: 241 R 241


>gi|74420976|gb|ABA05175.1| DNA replication and repair protein RecO [Nitrobacter winogradskyi
           Nb-255]
          Length = 278

 Score =  197 bits (501), Expect = 9e-49,   Method: Composition-based stats.
 Identities = 97/241 (40%), Positives = 136/241 (56%), Gaps = 3/241 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W DD I+LGVR +GE + I+E++TR +GRHLG VR G   RM+P+LQ GN V   WR+
Sbjct: 17  MEWTDDGIVLGVRRHGESSAIVELLTRTHGRHLGLVRGGAGSRMRPLLQPGNSVSALWRA 76

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG +  E      A LL+SS   YG+  +  L R LPER+P   ++ ML   L+ 
Sbjct: 77  RLDEHLGTYALEGTRMRAASLLASSHATYGVTHLAALARLLPERDPHEVIFAMLERTLDD 136

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
                      ++ EL +L  +GFGLDL+ C  TG T DL++VSPKSGGAV R  G P+ 
Sbjct: 137 FDRAGGAAIHLIRFELAMLSELGFGLDLSACAATGATGDLIYVSPKSGGAVSRQAGEPWR 196

Query: 181 EKMLVLPSFLW---KEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLL 237
           +++L LP FL     E+       L   F+LT  FL ++ L+         R  F+  ++
Sbjct: 197 DRLLPLPPFLRVTHDEQDGWSEQDLLDGFELTGRFLLRHVLEPRGQGHSDARAGFINAVV 256

Query: 238 E 238
            
Sbjct: 257 R 257


>gi|90420864|ref|ZP_01228769.1| DNA repair protein recO [Aurantimonas manganoxydans SI85-9A1]
 gi|90334839|gb|EAS48611.1| DNA repair protein recO [Aurantimonas manganoxydans SI85-9A1]
          Length = 243

 Score =  197 bits (501), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 101/239 (42%), Positives = 150/239 (62%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+++AI+LGVR  GE +++ EVMTR  GRHLG VR G+S + QP+LQ GN V V+WR+
Sbjct: 1   MEWREEAIVLGVRRLGETSVVAEVMTRARGRHLGLVRGGRSRKQQPVLQPGNSVAVHWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL +++G F  E LE   A+L+ S + L G+Q +    R L ER+P   LYD L I ++ 
Sbjct: 61  RLDEHMGAFVLEPLELRAARLMESGVGLNGVQLVAAHLRLLAERDPHARLYDGLQIIVDH 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P ++ ++ ++ E+ LL+ +GFGLDL +C  TG   DL +VSP++G AV R  G P+ 
Sbjct: 121 LDRPELVAELMLRFEIALLEELGFGLDLERCAATGQRDDLAYVSPRTGRAVSRDAGAPWH 180

Query: 181 EKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLEL 239
           +K+L LP+FL       DA+SL + ++LT YFL ++  +   I     R  FL  L ++
Sbjct: 181 DKLLTLPAFLADAATASDAESLAAGYRLTGYFLGRHVYEPRGIDVPDARAGFLSALRKI 239


>gi|163842935|ref|YP_001627339.1| DNA repair protein RecO [Brucella suis ATCC 23445]
 gi|163673658|gb|ABY37769.1| DNA repair protein RecO [Brucella suis ATCC 23445]
          Length = 247

 Score =  197 bits (500), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 102/241 (42%), Positives = 145/241 (60%), Gaps = 1/241 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D+ +ILG R +GE + I+EVMT  +GRH+G VR G+S RMQP+LQ GN V V+W +
Sbjct: 1   MEWRDEGVILGTRRHGETSAIVEVMTCGHGRHMGMVRGGRSRRMQPLLQPGNHVDVSWWA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL +++G F  E L    A+L+ + + LYG+Q      R LPER+P   LY+ L + +  
Sbjct: 61  RLDEHMGTFTIEPLSFAAARLIETPVALYGIQLAAAHLRLLPERDPHRGLYETLRLIIEH 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P   G++ ++ E+M+L+ +GFGLDL +C  TG   DL++VSPKSG AVCR  G P+A
Sbjct: 121 FDDPLAAGELLLRFEVMMLEELGFGLDLKECAATGRKDDLIYVSPKSGRAVCREAGAPWA 180

Query: 181 EKMLVLPSFLWKEEQTID-ADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLEL 239
           EK+L LPSF+          D L  AF +T YFL ++  +         R  FL  +   
Sbjct: 181 EKLLSLPSFVNDTALRASCYDDLDRAFTMTGYFLMRHVWEPRAQTPPDSRSGFLNAVGRA 240

Query: 240 I 240
           I
Sbjct: 241 I 241


>gi|23501551|ref|NP_697678.1| DNA repair protein RecO [Brucella suis 1330]
 gi|62289624|ref|YP_221417.1| DNA repair protein RecO [Brucella abortus bv. 1 str. 9-941]
 gi|82699552|ref|YP_414126.1| DNA repair protein RecO [Brucella melitensis biovar Abortus 2308]
 gi|148559418|ref|YP_001258648.1| DNA repair protein RecO [Brucella ovis ATCC 25840]
 gi|161618634|ref|YP_001592521.1| DNA repair protein RecO [Brucella canis ATCC 23365]
 gi|189023877|ref|YP_001934645.1| DNA repair protein RecO [Brucella abortus S19]
 gi|225852185|ref|YP_002732418.1| DNA repair protein RecO [Brucella melitensis ATCC 23457]
 gi|237815119|ref|ZP_04594117.1| DNA repair protein RecO [Brucella abortus str. 2308 A]
 gi|254688939|ref|ZP_05152193.1| DNA repair protein RecO [Brucella abortus bv. 6 str. 870]
 gi|254693421|ref|ZP_05155249.1| DNA repair protein RecO [Brucella abortus bv. 3 str. Tulya]
 gi|254697074|ref|ZP_05158902.1| DNA repair protein RecO [Brucella abortus bv. 2 str. 86/8/59]
 gi|254701451|ref|ZP_05163279.1| DNA repair protein RecO [Brucella suis bv. 5 str. 513]
 gi|254703997|ref|ZP_05165825.1| DNA repair protein RecO [Brucella suis bv. 3 str. 686]
 gi|254707629|ref|ZP_05169457.1| DNA repair protein RecO [Brucella pinnipedialis M163/99/10]
 gi|254709789|ref|ZP_05171600.1| DNA repair protein RecO [Brucella pinnipedialis B2/94]
 gi|254713791|ref|ZP_05175602.1| DNA repair protein RecO [Brucella ceti M644/93/1]
 gi|254717152|ref|ZP_05178963.1| DNA repair protein RecO [Brucella ceti M13/05/1]
 gi|254729970|ref|ZP_05188548.1| DNA repair protein RecO [Brucella abortus bv. 4 str. 292]
 gi|256031279|ref|ZP_05444893.1| DNA repair protein RecO [Brucella pinnipedialis M292/94/1]
 gi|256060791|ref|ZP_05450953.1| DNA repair protein RecO [Brucella neotomae 5K33]
 gi|256113203|ref|ZP_05454071.1| DNA repair protein RecO [Brucella melitensis bv. 3 str. Ether]
 gi|256257187|ref|ZP_05462723.1| DNA repair protein RecO [Brucella abortus bv. 9 str. C68]
 gi|256264305|ref|ZP_05466837.1| recombination protein O [Brucella melitensis bv. 2 str. 63/9]
 gi|256369101|ref|YP_003106609.1| DNA repair protein RecO [Brucella microti CCM 4915]
 gi|260545621|ref|ZP_05821362.1| recombination protein O [Brucella abortus NCTC 8038]
 gi|260566756|ref|ZP_05837226.1| recombination protein O [Brucella suis bv. 4 str. 40]
 gi|260754426|ref|ZP_05866774.1| DNA repair protein recO [Brucella abortus bv. 6 str. 870]
 gi|260757645|ref|ZP_05869993.1| DNA repair protein recO [Brucella abortus bv. 4 str. 292]
 gi|260761472|ref|ZP_05873815.1| DNA repair protein recO [Brucella abortus bv. 2 str. 86/8/59]
 gi|260883454|ref|ZP_05895068.1| DNA repair protein recO [Brucella abortus bv. 9 str. C68]
 gi|261213672|ref|ZP_05927953.1| DNA repair protein recO [Brucella abortus bv. 3 str. Tulya]
 gi|261218967|ref|ZP_05933248.1| DNA repair protein recO [Brucella ceti M13/05/1]
 gi|261315121|ref|ZP_05954318.1| DNA repair protein recO [Brucella pinnipedialis M163/99/10]
 gi|261317324|ref|ZP_05956521.1| DNA repair protein recO [Brucella pinnipedialis B2/94]
 gi|261321534|ref|ZP_05960731.1| DNA repair protein recO [Brucella ceti M644/93/1]
 gi|261324782|ref|ZP_05963979.1| DNA repair protein recO [Brucella neotomae 5K33]
 gi|261751991|ref|ZP_05995700.1| DNA repair protein recO [Brucella suis bv. 5 str. 513]
 gi|261754650|ref|ZP_05998359.1| DNA repair protein recO [Brucella suis bv. 3 str. 686]
 gi|265988362|ref|ZP_06100919.1| DNA repair protein recO [Brucella pinnipedialis M292/94/1]
 gi|265994611|ref|ZP_06107168.1| DNA repair protein recO [Brucella melitensis bv. 3 str. Ether]
 gi|297248035|ref|ZP_06931753.1| DNA repair protein RecO [Brucella abortus bv. 5 str. B3196]
 gi|38258601|sp|Q8G1P8|RECO_BRUSU RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|75497079|sp|Q57E78|RECO_BRUAB RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|119361447|sp|Q2YMZ9|RECO_BRUA2 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|23347462|gb|AAN29593.1| DNA repair protein RecO, putative [Brucella suis 1330]
 gi|62195756|gb|AAX74056.1| putatiave DNA repair protein RecO [Brucella abortus bv. 1 str.
           9-941]
 gi|82615653|emb|CAJ10640.1| Cytochrome P450:Recombination protein O, RecO [Brucella melitensis
           biovar Abortus 2308]
 gi|148370675|gb|ABQ60654.1| DNA repair protein RecO [Brucella ovis ATCC 25840]
 gi|161335445|gb|ABX61750.1| DNA repair protein RecO [Brucella canis ATCC 23365]
 gi|189019449|gb|ACD72171.1| Recombination protein O, RecO [Brucella abortus S19]
 gi|225640550|gb|ACO00464.1| DNA repair protein RecO [Brucella melitensis ATCC 23457]
 gi|237789956|gb|EEP64166.1| DNA repair protein RecO [Brucella abortus str. 2308 A]
 gi|255999261|gb|ACU47660.1| DNA repair protein RecO [Brucella microti CCM 4915]
 gi|260097028|gb|EEW80903.1| recombination protein O [Brucella abortus NCTC 8038]
 gi|260156274|gb|EEW91354.1| recombination protein O [Brucella suis bv. 4 str. 40]
 gi|260667963|gb|EEX54903.1| DNA repair protein recO [Brucella abortus bv. 4 str. 292]
 gi|260671904|gb|EEX58725.1| DNA repair protein recO [Brucella abortus bv. 2 str. 86/8/59]
 gi|260674534|gb|EEX61355.1| DNA repair protein recO [Brucella abortus bv. 6 str. 870]
 gi|260872982|gb|EEX80051.1| DNA repair protein recO [Brucella abortus bv. 9 str. C68]
 gi|260915279|gb|EEX82140.1| DNA repair protein recO [Brucella abortus bv. 3 str. Tulya]
 gi|260924056|gb|EEX90624.1| DNA repair protein recO [Brucella ceti M13/05/1]
 gi|261294224|gb|EEX97720.1| DNA repair protein recO [Brucella ceti M644/93/1]
 gi|261296547|gb|EEY00044.1| DNA repair protein recO [Brucella pinnipedialis B2/94]
 gi|261300762|gb|EEY04259.1| DNA repair protein recO [Brucella neotomae 5K33]
 gi|261304147|gb|EEY07644.1| DNA repair protein recO [Brucella pinnipedialis M163/99/10]
 gi|261741744|gb|EEY29670.1| DNA repair protein recO [Brucella suis bv. 5 str. 513]
 gi|261744403|gb|EEY32329.1| DNA repair protein recO [Brucella suis bv. 3 str. 686]
 gi|262765724|gb|EEZ11513.1| DNA repair protein recO [Brucella melitensis bv. 3 str. Ether]
 gi|263094578|gb|EEZ18376.1| recombination protein O [Brucella melitensis bv. 2 str. 63/9]
 gi|264660559|gb|EEZ30820.1| DNA repair protein recO [Brucella pinnipedialis M292/94/1]
 gi|297175204|gb|EFH34551.1| DNA repair protein RecO [Brucella abortus bv. 5 str. B3196]
 gi|326408685|gb|ADZ65750.1| Recombination protein O, RecO [Brucella melitensis M28]
 gi|326538410|gb|ADZ86625.1| DNA repair protein RecO [Brucella melitensis M5-90]
          Length = 247

 Score =  197 bits (500), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 102/241 (42%), Positives = 145/241 (60%), Gaps = 1/241 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D+ +ILG R +GE + I+EVMT  +GRH+G VR G+S RMQP+LQ GN V V+W +
Sbjct: 1   MEWRDEGVILGTRRHGETSAIVEVMTCGHGRHMGMVRGGRSRRMQPLLQPGNHVDVSWWA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL +++G F  E L    A+L+ + + LYG+Q      R LPER+P   LY+ L + +  
Sbjct: 61  RLDEHMGTFTIEPLSFAAARLIETPVALYGIQLAAAHLRLLPERDPHRGLYETLRLIIEH 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P   G++ ++ E+M+L+ +GFGLDL +C  TG   DL++VSPKSG AVCR  G P+A
Sbjct: 121 FDDPLAAGELLLRFEVMMLEELGFGLDLKECAATGRKDDLIYVSPKSGRAVCREAGAPWA 180

Query: 181 EKMLVLPSFLWKEEQTID-ADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLEL 239
           EK+L LPSF+          D L  AF +T YFL ++  +         R  FL  +   
Sbjct: 181 EKLLSLPSFVNDTALRASCYDDLDRAFTMTGYFLMRHVWEPRAQTPPDSRSGFLNAVGRA 240

Query: 240 I 240
           I
Sbjct: 241 I 241


>gi|225627162|ref|ZP_03785200.1| DNA repair protein RecO [Brucella ceti str. Cudo]
 gi|256159389|ref|ZP_05457171.1| DNA repair protein RecO [Brucella ceti M490/95/1]
 gi|256254687|ref|ZP_05460223.1| DNA repair protein RecO [Brucella ceti B1/94]
 gi|260168417|ref|ZP_05755228.1| DNA repair protein RecO [Brucella sp. F5/99]
 gi|261221865|ref|ZP_05936146.1| DNA repair protein recO [Brucella ceti B1/94]
 gi|261757878|ref|ZP_06001587.1| recombination protein O [Brucella sp. F5/99]
 gi|265997829|ref|ZP_06110386.1| DNA repair protein recO [Brucella ceti M490/95/1]
 gi|225617997|gb|EEH15041.1| DNA repair protein RecO [Brucella ceti str. Cudo]
 gi|260920449|gb|EEX87102.1| DNA repair protein recO [Brucella ceti B1/94]
 gi|261737862|gb|EEY25858.1| recombination protein O [Brucella sp. F5/99]
 gi|262552297|gb|EEZ08287.1| DNA repair protein recO [Brucella ceti M490/95/1]
          Length = 247

 Score =  197 bits (500), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 102/241 (42%), Positives = 145/241 (60%), Gaps = 1/241 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D+ +ILG R +GE + I+EVMT  +GRH+G VR G+S RMQP+LQ GN V V+W +
Sbjct: 1   MEWRDEGVILGRRRHGETSAIVEVMTCGHGRHMGMVRGGRSRRMQPLLQPGNHVDVSWWA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL +++G F  E L    A+L+ + + LYG+Q      R LPER+P   LY+ L + +  
Sbjct: 61  RLDEHMGTFTIEPLSFAAARLIETPVALYGIQLAAAHLRLLPERDPHRGLYETLRLIIEH 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P   G++ ++ E+M+L+ +GFGLDL +C  TG   DL++VSPKSG AVCR  G P+A
Sbjct: 121 FDDPLAAGELLLRFEVMMLEELGFGLDLKECAATGRKDDLIYVSPKSGRAVCREAGAPWA 180

Query: 181 EKMLVLPSFLWKEEQTID-ADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLEL 239
           EK+L LPSF+          D L  AF +T YFL ++  +         R  FL  +   
Sbjct: 181 EKLLSLPSFVNDTALRASCYDDLDRAFTMTGYFLMRHVWEPRAQTPPDSRSGFLNAVGRA 240

Query: 240 I 240
           I
Sbjct: 241 I 241


>gi|294852027|ref|ZP_06792700.1| DNA repair protein RecO [Brucella sp. NVSL 07-0026]
 gi|294820616|gb|EFG37615.1| DNA repair protein RecO [Brucella sp. NVSL 07-0026]
          Length = 247

 Score =  196 bits (498), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 102/241 (42%), Positives = 145/241 (60%), Gaps = 1/241 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D+ +ILG R +GE + I+EVMT  +GRH+G VR G+S RMQP+LQ GN V V+W +
Sbjct: 1   MEWRDEGVILGTRRHGETSAIVEVMTCWHGRHMGMVRGGRSRRMQPLLQPGNHVDVSWWA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL +++G F  E L    A+L+ + + LYG+Q      R LPER+P   LY+ L + +  
Sbjct: 61  RLDEHMGTFTIEPLSFAAARLIETPVALYGIQLAAAHLRLLPERDPHRGLYETLRLIIEH 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P   G++ ++ E+M+L+ +GFGLDL +C  TG   DL++VSPKSG AVCR  G P+A
Sbjct: 121 FDDPLAAGELLLRFEVMMLEELGFGLDLKECAATGRKDDLIYVSPKSGRAVCREAGAPWA 180

Query: 181 EKMLVLPSFLWKEEQTID-ADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLEL 239
           EK+L LPSF+          D L  AF +T YFL ++  +         R  FL  +   
Sbjct: 181 EKLLSLPSFVNDTALRASCYDDLDRAFTMTGYFLMRHVWEPRAQTPPDSRSGFLNAVGRA 240

Query: 240 I 240
           I
Sbjct: 241 I 241


>gi|306842071|ref|ZP_07474743.1| DNA repair protein RecO [Brucella sp. BO2]
 gi|306287821|gb|EFM59244.1| DNA repair protein RecO [Brucella sp. BO2]
          Length = 247

 Score =  196 bits (497), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 100/241 (41%), Positives = 144/241 (59%), Gaps = 1/241 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D+ +ILG R +GE + I+EVMT  +GRH+G VR G+S RMQP+LQ GN V V+W +
Sbjct: 1   MEWRDEGVILGTRRHGETSAIVEVMTCGHGRHMGMVRGGRSRRMQPLLQPGNHVDVSWWA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL +++G F  E L    A+L+ + + LYG+Q      R LPER+P   LY+ L + +  
Sbjct: 61  RLDEHMGTFTIEPLGFAAARLIETPVALYGIQLAAAHLRLLPERDPHRGLYETLRLIIEH 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P   G++ ++ E+M+L+ +GFGLDL +C  TG    L++VSPKSG AVCR  G P+A
Sbjct: 121 FDDPLAAGELLLRFEVMMLEELGFGLDLKECAATGRKDGLIYVSPKSGRAVCREAGAPWA 180

Query: 181 EKMLVLPSFLWKEEQTID-ADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLEL 239
           +K+L LPSF+          D L  AF +T YFL ++  +         R  FL  +   
Sbjct: 181 DKLLALPSFVNDTALRASCYDDLDRAFTMTGYFLMRHVWEPRAQTPPDSRSGFLNAVGRA 240

Query: 240 I 240
           I
Sbjct: 241 I 241


>gi|86749733|ref|YP_486229.1| DNA repair protein RecO [Rhodopseudomonas palustris HaA2]
 gi|119361478|sp|Q2IWU2|RECO_RHOP2 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|86572761|gb|ABD07318.1| DNA replication and repair protein RecO [Rhodopseudomonas palustris
           HaA2]
          Length = 249

 Score =  196 bits (497), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 98/243 (40%), Positives = 142/243 (58%), Gaps = 3/243 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W D+ IILGVR +GE   I+E++TR +GRHLG VR G S R++P+LQ GN V   WR+
Sbjct: 1   MEWSDEGIILGVRRHGEAGAIVELLTRGHGRHLGLVRGGASSRLRPLLQPGNSVLAVWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG ++ E      A +L+SS  +YG+  +  L R LPER+P  ++Y+ML   L+ 
Sbjct: 61  RLDEHLGYYQLEGTRMRAATMLASSHAVYGITHLASLARLLPERDPHEDIYEMLERTLDD 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
                      ++ EL +L  +GFGLDL+ C  TG T DL++VSPKSGGAV R+ G P+ 
Sbjct: 121 FDDVGDAATHLIRFELAMLAELGFGLDLSACAATGATTDLIYVSPKSGGAVSRTAGEPWR 180

Query: 181 EKMLVLPSFLWKEE---QTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLL 237
           EK+L LP FL ++           L+  F LT  FL +  L+         R+ F+  + 
Sbjct: 181 EKLLRLPDFLREDNDGRNGWSDQDLRDGFDLTGRFLLRNVLEPRGQGHSDARDGFINAVA 240

Query: 238 ELI 240
           + +
Sbjct: 241 KHL 243


>gi|17987568|ref|NP_540202.1| DNA repair protein RecO [Brucella melitensis bv. 1 str. 16M]
 gi|256044360|ref|ZP_05447264.1| DNA repair protein RecO [Brucella melitensis bv. 1 str. Rev.1]
 gi|260563712|ref|ZP_05834198.1| DNA repair protein recO [Brucella melitensis bv. 1 str. 16M]
 gi|265990775|ref|ZP_06103332.1| DNA repair protein recO [Brucella melitensis bv. 1 str. Rev.1]
 gi|20139477|sp|Q8YG76|RECO_BRUME RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|17983272|gb|AAL52466.1| DNA repair protein reco [Brucella melitensis bv. 1 str. 16M]
 gi|260153728|gb|EEW88820.1| DNA repair protein recO [Brucella melitensis bv. 1 str. 16M]
 gi|263001559|gb|EEZ14134.1| DNA repair protein recO [Brucella melitensis bv. 1 str. Rev.1]
          Length = 247

 Score =  196 bits (497), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 101/241 (41%), Positives = 144/241 (59%), Gaps = 1/241 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D+ +ILG R +GE + I+EVMT  +GRH+G VR G+S RMQP+LQ GN V V+W +
Sbjct: 1   MEWRDEGVILGTRRHGETSAIVEVMTCGHGRHMGMVRGGRSRRMQPLLQPGNHVDVSWWA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL +++G F  E L    A+L+ + + LYG+Q      R LPER+P   LY+ L + +  
Sbjct: 61  RLDEHMGTFTIEPLSFAAARLIETPVALYGIQLAAAHLRLLPERDPHRGLYETLRLIIEH 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P   G++ ++ E+M+L+ +GFGLDL +C  TG   DL++VSP SG AVCR  G P+A
Sbjct: 121 FDDPLAAGELLLRFEVMMLEELGFGLDLKECAATGRKDDLIYVSPTSGRAVCREAGAPWA 180

Query: 181 EKMLVLPSFLWKEEQTID-ADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLEL 239
           EK+L LPSF+          D L  AF +T YFL ++  +         R  FL  +   
Sbjct: 181 EKLLSLPSFVNDTALRASCYDDLDRAFTMTGYFLMRHVWEPRAQTPPDSRSGFLNAVGRA 240

Query: 240 I 240
           I
Sbjct: 241 I 241


>gi|115525024|ref|YP_781935.1| DNA repair protein RecO [Rhodopseudomonas palustris BisA53]
 gi|122295836|sp|Q07M79|RECO_RHOP5 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|115518971|gb|ABJ06955.1| DNA repair protein RecO [Rhodopseudomonas palustris BisA53]
          Length = 258

 Score =  196 bits (497), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 99/240 (41%), Positives = 142/240 (59%), Gaps = 2/240 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W DD I+LGVR +GE + I+E++TR +GRHLG VR G   +++P+LQ GN V   WR+
Sbjct: 1   MEWTDDGIVLGVRRHGESSAIVELLTRAHGRHLGLVRGGAGSKLRPVLQPGNSVHAGWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG +  E +    A LL+     YG+  +  L R LPER+P  E+Y+ +   L  
Sbjct: 61  RLDEHLGYYALEGMRLRAATLLAVPHAAYGITHLAALARLLPERDPHPEMYETVERILED 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
               ++ G   V+ EL +L  +GFGLDL+ C  TGVT DL++VSPKSGGAV R+ G P+ 
Sbjct: 121 FDDATMAGAHLVRFELAMLGELGFGLDLSACAATGVTSDLIYVSPKSGGAVSRTAGEPWR 180

Query: 181 EKMLVLPSFLWKEEQT--IDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLE 238
           +K+L LP FL ++E      AD L+  F LT  FL +  L+         R+ F+  +  
Sbjct: 181 DKLLRLPPFLREDEDAAGCTADDLRDGFALTGRFLLRNVLEPRGQGHSDARDGFINAVTR 240


>gi|114765537|ref|ZP_01444645.1| DNA repair protein RecO [Pelagibaca bermudensis HTCC2601]
 gi|114542130|gb|EAU45162.1| DNA repair protein RecO [Roseovarius sp. HTCC2601]
          Length = 242

 Score =  196 bits (497), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 80/241 (33%), Positives = 119/241 (49%), Gaps = 5/241 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D  I+L  R +GE + ILEV T ++GRH+G +R G S ++ P LQ G  + + WR+
Sbjct: 1   MDWRDTGILLSTRRHGETSAILEVFTAEHGRHMGVLRGGTSRKIAPSLQPGAQLDLTWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFR-FLPEREPCLELYDMLNIFLN 119
           RL  ++G +  E   S  A  +S  L L GL ++V L    LPERE    LY      L+
Sbjct: 61  RLEDHMGAWTVEPQRSRAASAMSDRLSLAGLNAVVALLSFCLPEREAHPALYARTESLLD 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                 +    +++ E+ LL  +GFGLDL+ C VTG  + L +VSP++G AV       +
Sbjct: 121 LLAERELWPLAYMRWEMALLDEMGFGLDLSACAVTGTNEPLDYVSPRTGRAVSAFGAGDW 180

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQH--NIIHCHLLRENFLGKLL 237
             ++L LP  +       D   +  A + T +FL    L            R  FL +L 
Sbjct: 181 VARLLPLPPVMLGRGSAPD-GEILDALRTTGHFLENR-LAPALGDRPLPAARGLFLDRLA 238

Query: 238 E 238
            
Sbjct: 239 R 239


>gi|146341374|ref|YP_001206422.1| DNA repair protein RecO [Bradyrhizobium sp. ORS278]
 gi|166221887|sp|A4YWC5|RECO_BRASO RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|146194180|emb|CAL78201.1| putative DNA repair protein RecO (Recombination protein O)
           [Bradyrhizobium sp. ORS278]
          Length = 248

 Score =  195 bits (494), Expect = 6e-48,   Method: Composition-based stats.
 Identities = 96/241 (39%), Positives = 141/241 (58%), Gaps = 2/241 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W DD I+LG+R +GE + ++E++TR++GRHLG VR     RM+P+LQ GN VR  WR+
Sbjct: 1   MEWTDDGIVLGLRRHGESSAVVELLTREHGRHLGLVRGAAGKRMRPVLQPGNTVRAIWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG +  + L    A+L+S+S   YG+  +  L R LPER+P  ++Y  L   L+ 
Sbjct: 61  RLDEHLGMYAVDGLTLRAAELMSASHGAYGVTHLASLARLLPERDPHEDMYFRLEHALDD 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
                      V+ EL +L  +GFGLDL  C  TG T DL++VSPKSGGAV R+ G P+A
Sbjct: 121 FADAGAAAAHIVRFELAILTELGFGLDLESCAATGETSDLIYVSPKSGGAVSRTAGAPWA 180

Query: 181 EKMLVLPSFLWKEEQT--IDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLE 238
           +++L LP FL + ++        L   F+LT  FL ++ L+         RE F+  +  
Sbjct: 181 DRLLPLPPFLRESDEDHGWSDQDLLDGFRLTGLFLLRHVLEPRGQGHSDAREGFINAVTR 240

Query: 239 L 239
            
Sbjct: 241 A 241


>gi|192291353|ref|YP_001991958.1| DNA repair protein RecO [Rhodopseudomonas palustris TIE-1]
 gi|238692599|sp|B3QJH7|RECO_RHOPT RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|192285102|gb|ACF01483.1| DNA repair protein RecO [Rhodopseudomonas palustris TIE-1]
          Length = 250

 Score =  194 bits (493), Expect = 8e-48,   Method: Composition-based stats.
 Identities = 98/244 (40%), Positives = 139/244 (56%), Gaps = 4/244 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W D+ IILGVR +GE   I+E++TR +GRHLG VR G S RM+P+LQ GN V  +WR+
Sbjct: 1   MEWSDEGIILGVRRHGESAAIVELLTRGHGRHLGMVRGGASARMRPLLQPGNSVLASWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG ++ E  +   A LL SS  +YG+  +  L R LPER+P  E+Y  L + L+ 
Sbjct: 61  RLDEHLGYYQLEATKMRAATLLGSSHAVYGVTHLASLARLLPERDPHEEIYQRLVLTLDD 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
                V     ++ EL +L  +GFGLDL+ C  TG T +L++VSPKSG AV RS G P+ 
Sbjct: 121 FDDFGVAAAHLIRFELAILAELGFGLDLSACAATGSTTELIYVSPKSGSAVSRSAGEPWR 180

Query: 181 EKMLVLPSFLWK----EEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKL 236
           +++L LP+FL               L   F+LT  FL +  L+         R  F+  +
Sbjct: 181 DRLLRLPAFLRDDEAESGNGWSGQDLFDGFELTGRFLLRNVLEPRGQSHSDARAGFINAI 240

Query: 237 LELI 240
              +
Sbjct: 241 TRAL 244


>gi|254512349|ref|ZP_05124416.1| DNA repair protein RecO [Rhodobacteraceae bacterium KLH11]
 gi|221536060|gb|EEE39048.1| DNA repair protein RecO [Rhodobacteraceae bacterium KLH11]
          Length = 241

 Score =  193 bits (491), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 93/243 (38%), Positives = 130/243 (53%), Gaps = 5/243 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D  I+L  R +GE   I+EV T  +GRH G VR G S ++ PILQ G  + V WR+
Sbjct: 1   MDWRDHGILLTARRHGETAAIIEVFTEGHGRHAGVVRGGTSRKIAPILQPGAQLDVLWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFR-FLPEREPCLELYDMLNIFLN 119
           RL +++G F+ E L S  A   S  L L GL ++V L    LPEREP   +Y      ++
Sbjct: 61  RLEEHIGTFQVEPLRSRAAAAFSGRLALAGLNAVVALLSFCLPEREPHPAIYKQTEQLMD 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                 V    +++ EL LL+ +GFGLDL+ C VTGVT  L++VSPK+G AV R+    +
Sbjct: 121 LLGQDEVWPLAYLRWELALLEELGFGLDLSACAVTGVTDGLVYVSPKTGRAVSRAGAGEW 180

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQH--NIIHCHLLRENFLGKLL 237
           A+K+L LP  L  E    DA  +  A + T YFL  + L            R  F+ +  
Sbjct: 181 ADKLLPLPPCLRGEGAAPDAG-IAEALRTTGYFLENH-LAPSLGHTPLPDARARFVAQFT 238

Query: 238 ELI 240
             +
Sbjct: 239 RRL 241


>gi|39935766|ref|NP_948042.1| DNA repair protein RecO [Rhodopseudomonas palustris CGA009]
 gi|61215044|sp|Q6N6B8|RECO_RHOPA RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|39649619|emb|CAE28141.1| putative DNA repair protein RecO [Rhodopseudomonas palustris
           CGA009]
          Length = 250

 Score =  193 bits (491), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 98/244 (40%), Positives = 139/244 (56%), Gaps = 4/244 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W D+ IILGVR +GE   I+E++TR +GRHLG VR G S RM+P+LQ GN V  +WR+
Sbjct: 1   MEWSDEGIILGVRRHGESAAIVELLTRGHGRHLGMVRGGASARMRPLLQPGNSVLASWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG ++ E  +   A LL SS  +YG+  +  L R LPER+P  E+Y  L + L+ 
Sbjct: 61  RLDEHLGYYQLEATKMRAATLLGSSHAVYGVTHLASLARLLPERDPHEEIYQRLVLTLDD 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
                V     ++ EL +L  +GFGLDL+ C  TG T +L++VSPKSG AV RS G P+ 
Sbjct: 121 FDDFGVAAAHLIRFELAILAELGFGLDLSACAATGSTTELIYVSPKSGSAVSRSAGEPWR 180

Query: 181 EKMLVLPSFLWK----EEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKL 236
           +++L LP+FL               L   F+LT  FL +  L+         R  F+  +
Sbjct: 181 DRLLRLPAFLRDDEAESGHGWSGQDLFDGFELTGRFLLRNVLEPRGQSHSDARAGFINAI 240

Query: 237 LELI 240
              +
Sbjct: 241 TRAL 244


>gi|91977125|ref|YP_569784.1| DNA repair protein RecO [Rhodopseudomonas palustris BisB5]
 gi|119361480|sp|Q136V6|RECO_RHOPS RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|91683581|gb|ABE39883.1| DNA replication and repair protein RecO [Rhodopseudomonas palustris
           BisB5]
          Length = 249

 Score =  193 bits (491), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 96/243 (39%), Positives = 140/243 (57%), Gaps = 3/243 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W D+ IILGVR +GE   I+E++TR +GRHLG VR G S RM+P+LQ GN V   WR+
Sbjct: 1   MEWSDEGIILGVRRHGEAGAIVELLTRSHGRHLGLVRGGASSRMRPLLQPGNSVLAVWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG ++ E      A +L+SS  +YG+  +  L R LPER+P  ++Y+ML   L+ 
Sbjct: 61  RLDEHLGYYQLEGTRMRAATMLASSHAVYGVTHLASLARLLPERDPHEDIYEMLERTLDD 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
                      ++ EL +L  +GFGLDL+ C  TG T +L++VSPKSG AV R+ G P+ 
Sbjct: 121 FDDVGDAATHLIRFELAMLAELGFGLDLSACAATGATVELIYVSPKSGSAVSRAAGEPWR 180

Query: 181 EKMLVLPSFLWKEE---QTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLL 237
           +K+L LP+FL  +           L+  F LT  FL +  L+         R+ F+  + 
Sbjct: 181 DKLLRLPAFLRDDNDGRNGWSDQDLRDGFDLTGRFLLRNVLEPRGQGHSDARDGFINAVT 240

Query: 238 ELI 240
             +
Sbjct: 241 RHL 243


>gi|163760593|ref|ZP_02167674.1| DNA repair protein [Hoeflea phototrophica DFL-43]
 gi|162282208|gb|EDQ32498.1| DNA repair protein [Hoeflea phototrophica DFL-43]
          Length = 256

 Score =  193 bits (490), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 101/241 (41%), Positives = 160/241 (66%), Gaps = 1/241 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D+ IILG+R +GE ++I EVMT  +GRH+G VR G+S R+QP+LQ GN V + WR+
Sbjct: 1   MEWRDEGIILGLRKHGETSVIAEVMTHAHGRHMGIVRGGRSKRLQPVLQPGNSVDLVWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG+++ E++ +   +L+ S++ ++G+Q++  L R LPER+    L+D   + L+ 
Sbjct: 61  RLDEHLGQYQVELINARAGRLMQSAIGVHGVQAMAALLRLLPERDSHPRLHDAFAVILDS 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P   G ++V+ EL +L+++GFGLDLT C  TG ++DL++VSPKSG AV  + G P+A
Sbjct: 121 FDAPEEAGALYVRFELAVLEDLGFGLDLTACAATGASEDLVYVSPKSGRAVSAAAGAPWA 180

Query: 181 EKMLVLPSFLWKEEQTI-DADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLEL 239
           E+ML LP+FL    Q   DA  L   F+L+ YFL+++  +   I   + RE+F    L+ 
Sbjct: 181 ERMLALPAFLADRSQACGDAQMLAHGFKLSGYFLDRHVFEPRGIEAPISRESFCTAALKA 240

Query: 240 I 240
           +
Sbjct: 241 M 241


>gi|92117771|ref|YP_577500.1| DNA repair protein RecO [Nitrobacter hamburgensis X14]
 gi|119361468|sp|Q1QL57|RECO_NITHX RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|91800665|gb|ABE63040.1| DNA replication and repair protein RecO [Nitrobacter hamburgensis
           X14]
          Length = 253

 Score =  193 bits (490), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 94/241 (39%), Positives = 138/241 (57%), Gaps = 3/241 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W DD I+LGVR +GE + I+E++TR +GRHLG VR G   RM+P+LQ GN V   WR+
Sbjct: 1   MEWTDDGIVLGVRRHGESSAIVELLTRGHGRHLGLVRGGAGSRMRPLLQPGNSVSALWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG +  E      A LL +S   YG+  +  L R LPER+P   +++ L   L+ 
Sbjct: 61  RLDEHLGAYALEGTRMRAANLLGASHATYGVTHLASLARLLPERDPHDGIFERLERTLDD 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
                      ++ EL +L  +GFGLDL+ CV TG T +L++VSPKSGGAV R  G P+ 
Sbjct: 121 FDTAGEAAIHLIRFELAMLTELGFGLDLSTCVATGTTTELIYVSPKSGGAVSRQAGEPWR 180

Query: 181 EKMLVLPSFLWKEEQT---IDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLL 237
           +++L LP FL + ++         L   F+LT  FL ++ L+         R  F+  ++
Sbjct: 181 DRLLRLPPFLREADEEQSGWSDQDLLDGFELTGRFLLRHVLEPRGQGHSDARAGFINAVV 240

Query: 238 E 238
           +
Sbjct: 241 K 241


>gi|240850199|ref|YP_002971592.1| DNA repair protein RecO [Bartonella grahamii as4aup]
 gi|240267322|gb|ACS50910.1| DNA repair protein RecO [Bartonella grahamii as4aup]
          Length = 248

 Score =  192 bits (488), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 100/239 (41%), Positives = 147/239 (61%), Gaps = 1/239 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W++ A+ILG R YGE ++ILEVMTR++GR++G V+ G+S RM  +LQ GN V   W +
Sbjct: 1   MKWKEQAVILGTRQYGETSVILEVMTREHGRYMGVVKGGRSRRMAALLQPGNFVEAEWWA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG FR E L+ H A+L+     LY LQ I    R LPER+P   LYD+L++F+  
Sbjct: 61  RLEEHLGLFRLEALDLHAARLICLPEALYALQLIAFHLRLLPERDPHPVLYDILHLFMQN 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P V  ++ V+ E+ LL+ +GFGLDL+ C  TG  + L +VSPKSG AVC   G P+ 
Sbjct: 121 FDEPFVNAELLVRFEMRLLEELGFGLDLSCCAATGRQERLHYVSPKSGRAVCEEAGEPWK 180

Query: 181 EKMLVLPSFLWKE-EQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLE 238
           +K+L+LP FL +   +  D+  + + F LT +FL ++  +   I    +R N +     
Sbjct: 181 KKLLILPQFLVQRTTRPTDSSDIINGFILTGFFLMRHVWEPRDIKQPSVRMNLIQLFER 239


>gi|148256029|ref|YP_001240614.1| DNA repair protein RecO [Bradyrhizobium sp. BTAi1]
 gi|166221886|sp|A5EKL4|RECO_BRASB RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|146408202|gb|ABQ36708.1| DNA replication and repair protein RecO [Bradyrhizobium sp. BTAi1]
          Length = 248

 Score =  192 bits (487), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 99/241 (41%), Positives = 139/241 (57%), Gaps = 2/241 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W DD I+LG+R +GE + +LE++TR++GRHLG VR     RM+P+LQ GN VR  WR+
Sbjct: 1   MEWTDDGIVLGLRRHGESSAVLELLTREHGRHLGLVRGASGARMRPMLQPGNTVRAVWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG +  + L    A+L+S +   YG+  +  L R LPER+P  E+Y  L   L+ 
Sbjct: 61  RLDEHLGMYAIDGLTLRAAELMSVAHGAYGVTHLAALARLLPERDPHQEMYLRLEHALDD 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
                      V+ EL +L  +GFGLDL  C  TG T DL++VSPKSGGAV RS G P+A
Sbjct: 121 FAEAGGAAVHIVRFELAILAELGFGLDLESCAATGETTDLVYVSPKSGGAVSRSAGAPWA 180

Query: 181 EKMLVLPSFLWKEEQT--IDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLE 238
           +++L LP FL + E         L   F+LT  FL ++ L+         RE F+  +  
Sbjct: 181 DRLLPLPPFLRESEDDHGFSDQDLLDGFRLTGLFLLRHVLEPRGQGHSDAREGFINAVTR 240

Query: 239 L 239
            
Sbjct: 241 A 241


>gi|254469353|ref|ZP_05082758.1| DNA repair protein RecO [Pseudovibrio sp. JE062]
 gi|211961188|gb|EEA96383.1| DNA repair protein RecO [Pseudovibrio sp. JE062]
          Length = 253

 Score =  191 bits (486), Expect = 6e-47,   Method: Composition-based stats.
 Identities = 102/244 (41%), Positives = 147/244 (60%), Gaps = 6/244 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M WQ + I++G R  GE NI+LEV+T   GR LG VR G+S R QP LQ GN + + WR+
Sbjct: 1   MQWQAEGIVIGTRKQGENNILLEVLTPDRGRCLGLVRGGRSRRQQPALQLGNHLNLTWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG F  E L+   A L+ ++  ++GLQS+    R LPER+P   L+  L++ L+ 
Sbjct: 61  RLDEHLGFFTVEPLQLRAAHLMQTARAIHGLQSLCAQIRLLPERDPHPNLFHALDVILDH 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
            + P +   + ++ EL LL  +GFGLDLT+C  TG T +L+WVSPKSG AVC++ G PYA
Sbjct: 121 LEDPQIGAALVLRFELELLNELGFGLDLTECAATGATDELIWVSPKSGRAVCKTAGQPYA 180

Query: 181 EKMLVLPSFL------WKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLG 234
            K+L LP FL        +   I    +++ F LT YFL KY  +   I     R++++ 
Sbjct: 181 SKLLTLPEFLKAPQARLSQNIQISKGDMEAGFSLTGYFLFKYIYEPRSIPWPPARDSYVT 240

Query: 235 KLLE 238
            L +
Sbjct: 241 ALKK 244


>gi|316934141|ref|YP_004109123.1| DNA repair protein RecO [Rhodopseudomonas palustris DX-1]
 gi|315601855|gb|ADU44390.1| DNA repair protein RecO [Rhodopseudomonas palustris DX-1]
          Length = 250

 Score =  191 bits (484), Expect = 8e-47,   Method: Composition-based stats.
 Identities = 96/244 (39%), Positives = 138/244 (56%), Gaps = 4/244 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W D+ IILGVR +GE   I+E++TR +GRHLG VR   S RM+P+LQ GN V  +WR+
Sbjct: 1   MDWSDEGIILGVRRHGEAGAIVELLTRSHGRHLGMVRGAASARMRPLLQPGNSVLASWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG ++ E  +   A LL+SS  +YG+  +  L R LPER+P  E+Y  L + L+ 
Sbjct: 61  RLDEHLGYYQLEATKMRAATLLASSHAVYGVTHLASLARLLPERDPHEEIYHRLILTLDD 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
                +     ++ EL +L  +GFGLDL+ C  TG T +L++VSPKSG AV R  G P+ 
Sbjct: 121 FDDLGIAAAHLIRFELAILAELGFGLDLSACAATGATTELIYVSPKSGSAVSRIAGEPWR 180

Query: 181 EKMLVLPSFLWKEEQT----IDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKL 236
           +++L LP FL  +E           L   F LT  FL +  L+         R  F+  +
Sbjct: 181 DRLLRLPPFLRDDEAASESGWSGQDLFDGFALTGRFLLRNVLEPRGQGHSDARAGFINAV 240

Query: 237 LELI 240
              +
Sbjct: 241 TRAL 244


>gi|86135730|ref|ZP_01054309.1| DNA repair protein RecO [Roseobacter sp. MED193]
 gi|85826604|gb|EAQ46800.1| DNA repair protein RecO [Roseobacter sp. MED193]
          Length = 244

 Score =  191 bits (484), Expect = 8e-47,   Method: Composition-based stats.
 Identities = 79/243 (32%), Positives = 123/243 (50%), Gaps = 5/243 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D  I+L  R +GE   I++V T  +GRH G V  G S +  P+LQ G  + + WR+
Sbjct: 1   MEWRDHGILLTRRRHGEGAAIIDVFTEHHGRHAGIVHGGASRKKAPVLQPGAQLDLLWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLF-RFLPEREPCLELYDMLNIFLN 119
           RL ++LG ++ E L S  A  LS  L L GL ++  L    LPER    +LY      L+
Sbjct: 61  RLQEHLGSYQAEPLRSRAAAALSGRLALAGLNAVTGLLGFCLPERAAYPDLYKQSEQLLD 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
             +   +    +++ E+ LL  +GFGLDL+ C V+G  +DL ++SPK+G AV R     +
Sbjct: 121 LLEQEEIWPLAYLRWEMALLAAMGFGLDLSACAVSGSNEDLAYISPKTGRAVSRQEAGQW 180

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHN--IIHCHLLRENFLGKLL 237
             ++L LP  L    +  D   +    + T +FL++  L  N         R  F+   +
Sbjct: 181 VNRLLPLPPVLRGLGEAPD-HEVAEGLRTTGFFLSER-LAPNLGNQPLPEARGRFIDAFM 238

Query: 238 ELI 240
             +
Sbjct: 239 RRL 241


>gi|254450984|ref|ZP_05064421.1| DNA repair protein RecO [Octadecabacter antarcticus 238]
 gi|198265390|gb|EDY89660.1| DNA repair protein RecO [Octadecabacter antarcticus 238]
          Length = 242

 Score =  191 bits (484), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 79/242 (32%), Positives = 127/242 (52%), Gaps = 4/242 (1%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWR 59
           M  W+D+  ++ VR +GE + I+EV T   G   G VR G S ++ P LQ G  + V W+
Sbjct: 1   MIEWRDEGALIRVRKHGESSAIIEVFTPSRGLTAGIVRGGTSRKIAPTLQPGAQLDVTWK 60

Query: 60  SRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFL 118
           +RL  +LG F  E + S  A+++   L L GL ++  L  F LP+RE   +LY      L
Sbjct: 61  ARLEDHLGSFTVEPIRSRTAQVMQDRLALAGLNAVTGLLSFLLPDREAHAQLYARTIQLL 120

Query: 119 NCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
           +      V    ++Q E+ LL  +GFG+DL+ C V+G+  DL +VSP++G AV R     
Sbjct: 121 DLLGQNDVWPLAYLQWEIALLDEMGFGMDLSACAVSGLNDDLFYVSPRTGRAVSRLAAGE 180

Query: 179 YAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQH-NIIHCHLLRENFLGKLL 237
           +A+++L LP  L  +    D + +  A + T +FLN +  +    +     R+  +  + 
Sbjct: 181 WADRLLPLPHVLLGKGDA-DLNEIVLALRTTGHFLNNHLAKSLGNLPIPEARQRLIDAMK 239

Query: 238 EL 239
            L
Sbjct: 240 RL 241


>gi|254466686|ref|ZP_05080097.1| DNA repair protein RecO [Rhodobacterales bacterium Y4I]
 gi|206687594|gb|EDZ48076.1| DNA repair protein RecO [Rhodobacterales bacterium Y4I]
          Length = 241

 Score =  190 bits (483), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 88/243 (36%), Positives = 125/243 (51%), Gaps = 5/243 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D  I+L VR +GE + I++V T  +GRH G VR G   RM PILQ G  + V WR+
Sbjct: 1   MEWRDHGILLSVRRHGESSAIIDVFTEGHGRHAGVVRGGAGRRMAPILQPGAQLDVTWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFR-FLPEREPCLELYDMLNIFLN 119
           RL  +LG +  E L S  A  LS  L L GL ++  L    LPEREP  +LY      L+
Sbjct: 61  RLEDHLGSYHAEPLRSRAAAALSGRLALAGLNTVTALLSFCLPEREPHPDLYTRSEQLLD 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                 +    +++ EL LL+ +GFGLDL+ C VTG    L ++SPK+G AV R     +
Sbjct: 121 LLGNEDLWPLAYLRWELALLEEMGFGLDLSACAVTGSRFGLAYISPKTGRAVSREGAGDW 180

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQH--NIIHCHLLRENFLGKLL 237
           A+++L LP  +  +    DA  +  A + T +FL  + L            R   +  L 
Sbjct: 181 ADRLLPLPPVMLGQGSAADA-EIVQALRATGFFLEAH-LAPSLGNHPLPEARGRLMDLLS 238

Query: 238 ELI 240
             +
Sbjct: 239 RRL 241


>gi|254485777|ref|ZP_05098982.1| DNA repair protein RecO [Roseobacter sp. GAI101]
 gi|214042646|gb|EEB83284.1| DNA repair protein RecO [Roseobacter sp. GAI101]
          Length = 241

 Score =  190 bits (482), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 92/242 (38%), Positives = 127/242 (52%), Gaps = 3/242 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D  I+L  R +GE + I+EV T   GRH G VR G S ++ PILQ G  + V WR+
Sbjct: 1   MEWRDQGILLSARRHGETSAIIEVFTPTQGRHAGIVRGGTSRKIAPILQPGAQLDVAWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFR-FLPEREPCLELYDMLNIFLN 119
           RL  ++G F  E + S     +S  L L GL ++  L    LPEREP   LY      L+
Sbjct: 61  RLEGHIGAFTVEPVRSRAVSAMSDRLSLAGLNTVTALLSFCLPEREPHPPLYHRTQALLD 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                 +    ++Q EL LL+ +G+GLDLT C VTG T  L++VSPKSG AV R     +
Sbjct: 121 LLDQGDLWPLAYLQWELSLLEEMGYGLDLTACAVTGATDALVFVSPKSGRAVTREGAGEW 180

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQH-NIIHCHLLRENFLGKLLE 238
           A+KML LP  L  E +  D D +   F+ T YFL ++  ++         R  ++     
Sbjct: 181 ADKMLPLPPVLLGEGEARD-DEILQGFKTTGYFLEQHLARNLGGRPLPEARARYVDAFSR 239

Query: 239 LI 240
            I
Sbjct: 240 QI 241


>gi|85705116|ref|ZP_01036216.1| DNA repair protein RecO [Roseovarius sp. 217]
 gi|85670438|gb|EAQ25299.1| DNA repair protein RecO [Roseovarius sp. 217]
          Length = 244

 Score =  190 bits (482), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 81/239 (33%), Positives = 118/239 (49%), Gaps = 5/239 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D  I+L  R +GE  +I+EV T + GRH G VR G S +M PILQ G  + + WR+
Sbjct: 1   MDWRDQGILLSSRRHGESAVIIEVFTPERGRHAGVVRGGASRKMAPILQPGAQLDLEWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL  ++G FR E + S    L +             L   LPERE    LY+     L+ 
Sbjct: 61  RLEDHIGTFRVEPVRSRAGVLGNPLTLAGLNAVCALLLFALPEREAHGALYERTETLLDL 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVT-QDLLWVSPKSGGAVCRSVGLPY 179
                V    ++  EL LL+++GFGLDL+ C V G    DL ++SP++G AV R+    +
Sbjct: 121 LAESEVWPLAYLHWELALLEDLGFGLDLSTCAVMGEKANDLSYISPRTGRAVSRAGAGEW 180

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQH--NIIHCHLLRENFLGKL 236
            +K+L LP  L       DA  +     +T +FL +  L            RE F+ ++
Sbjct: 181 VDKLLPLPPCLMGHGPAPDA-EILQGLTVTGHFL-RTHLAPQMRNKPLPEARERFVARM 237


>gi|158423630|ref|YP_001524922.1| recombination protein O [Azorhizobium caulinodans ORS 571]
 gi|158330519|dbj|BAF88004.1| recombination protein O [Azorhizobium caulinodans ORS 571]
          Length = 245

 Score =  190 bits (482), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 92/240 (38%), Positives = 134/240 (55%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W D  I+LGVR +GE + I+++MTR+ GRH G VR G S R+  +LQ GN +   WR+
Sbjct: 1   MEWTDAGIVLGVRRHGETSAIVDLMTRERGRHAGLVRGGGSRRLAALLQPGNTLHATWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL   LG    E L      ++ S+   +G+  +V L R LPER+P   L+  L+  L+ 
Sbjct: 61  RLEGQLGLMTVEPLTLRSDAIMRSAHGSFGVTHLVGLMRLLPERDPHPGLFASLDAILDA 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P+  G++  + E+ LL  +GFGLDLT C  TG   DL +VSP+SG AV RS G PYA
Sbjct: 121 FDEPAHAGELLARFEMALLVELGFGLDLTTCAATGGNNDLAYVSPRSGRAVSRSAGEPYA 180

Query: 181 EKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLELI 240
           +K+  LP+FL           ++ A ++T +FL+   L+   +     R +FL  L   +
Sbjct: 181 DKLFGLPTFLIGGIVPPSLPDMEEALRMTGFFLSTRVLEPRGLALGEARASFLAALRRAL 240


>gi|163744852|ref|ZP_02152212.1| DNA repair protein RecO [Oceanibulbus indolifex HEL-45]
 gi|161381670|gb|EDQ06079.1| DNA repair protein RecO [Oceanibulbus indolifex HEL-45]
          Length = 240

 Score =  190 bits (482), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 83/242 (34%), Positives = 120/242 (49%), Gaps = 4/242 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D  I+L  R +GE + I+EV T + GRH G VR G S ++ P LQ G  + + WR+
Sbjct: 1   MEWRDQGILLSARRHGETSAIIEVFTPEQGRHAGIVRGGTSRKIAPSLQPGAQLDLAWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFR-FLPEREPCLELYDMLNIFLN 119
           RL  ++G F  E L S  A  +   L L GL ++  L    LPEREP   LY      L+
Sbjct: 61  RLEDHIGAFTVEPLRSRAAVAMQDRLALAGLNAVTALLSFCLPEREPHPALYRRTETLLD 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                 V    +++ EL LL+ +G+ LDL  C VTGV++DL++VSPKSG AV       +
Sbjct: 121 MLGQGDVWPLAYLKWELRLLEEMGYALDLESCAVTGVSEDLIYVSPKSGRAVSAKGAGEW 180

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQH-NIIHCHLLRENFLGKLLE 238
           AE++L LP+ L           +      T +FL  +  +          R  F+     
Sbjct: 181 AERLLPLPAVL--RGGAGSDAEIAQGLVTTGHFLTAHLARDLGGKPLPESRARFIDAFSR 238

Query: 239 LI 240
            +
Sbjct: 239 RL 240


>gi|56698028|ref|YP_168399.1| DNA repair protein RecO [Ruegeria pomeroyi DSS-3]
 gi|61214680|sp|Q5LNK7|RECO_SILPO RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|56679765|gb|AAV96431.1| DNA repair protein RecO, putative [Ruegeria pomeroyi DSS-3]
          Length = 241

 Score =  190 bits (481), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 89/241 (36%), Positives = 123/241 (51%), Gaps = 3/241 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D  I+L VR +GE + I++  T  +GRH G VR G S R+ PILQ G  + ++WR+
Sbjct: 1   MDWRDQGILLAVRRHGETSAIIDTFTASHGRHAGVVRGGTSRRIAPILQPGAQLDLSWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFR-FLPEREPCLELYDMLNIFLN 119
           RL  +LG F  E L S  A  +S  L L GL ++V L    LPERE    LY      L+
Sbjct: 61  RLEDHLGSFTVEPLRSRAAAAMSGRLALAGLNAVVSLLSFCLPEREAHPRLYKQSEQLLD 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                 +    +++ EL LL  +GFGLDL+ C VTG + DL++VSP+SG AV       +
Sbjct: 121 LLGQDEIWPLAYLRWELALLDTLGFGLDLSSCAVTGNSDDLVYVSPRSGRAVSAGAAGEW 180

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYAL-QHNIIHCHLLRENFLGKLLE 238
           AE++L LP  L  E    D   +  A + T +FL                R   L  +  
Sbjct: 181 AERLLPLPPCLRGEGPAPDP-EIAQALRTTGHFLEHRVAPALGHAPLPQARGRLLDLISR 239

Query: 239 L 239
           L
Sbjct: 240 L 240


>gi|114705890|ref|ZP_01438793.1| DNA repair protein RecO [Fulvimarina pelagi HTCC2506]
 gi|114538736|gb|EAU41857.1| DNA repair protein RecO [Fulvimarina pelagi HTCC2506]
          Length = 241

 Score =  189 bits (480), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 92/236 (38%), Positives = 147/236 (62%), Gaps = 1/236 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+++ ++LGVR +GE ++I E+MTR  GRHLG VR G+S  M+P+LQ GN V  +WR+
Sbjct: 1   MEWREEGVVLGVRRHGETSVIAELMTRSRGRHLGLVRGGRSKAMRPVLQPGNSVMAHWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL +++G F  E + S    L+ S++ L+G+Q      R L ER+P   LYD L + +  
Sbjct: 61  RLDEHMGAFALEPVASRAGGLMESTVGLHGVQLAASHLRLLAERDPHPRLYDGLIVLIEN 120

Query: 121 HKIPSVIG-KIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                +   ++ ++ EL +L+ +GFGLDL +C  +G  +DL++VSPKSG AV R  G PY
Sbjct: 121 LNADRLTAGELMLRFELAVLEELGFGLDLARCAASGTKEDLVYVSPKSGRAVSREPGEPY 180

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGK 235
            +K+L LP+FL   ++  D ++L++ F LT YFL+++  +   +     R +F+  
Sbjct: 181 HDKLLALPAFLTDTDRAADGETLRTGFTLTRYFLSRHVYEPRGLDEPHSRTSFISA 236


>gi|121601946|ref|YP_988791.1| DNA repair protein RecO [Bartonella bacilliformis KC583]
 gi|166221884|sp|A1US38|RECO_BARBK RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|120614123|gb|ABM44724.1| DNA repair protein RecO [Bartonella bacilliformis KC583]
          Length = 245

 Score =  189 bits (480), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 102/239 (42%), Positives = 150/239 (62%), Gaps = 1/239 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W++ AIILG R YGE ++ILEV+TRQ+GR++G V+ G+S RM  +LQ GN V   W +
Sbjct: 1   MKWKEQAIILGARQYGETSVILEVVTRQHGRYMGVVKGGRSRRMAALLQPGNFVEAEWWA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG F+ E L+   ++L+     LYGLQ +   FR LPER+P   LYD+L++F+  
Sbjct: 61  RLDEHLGLFKLEALDLCASRLMFLPEALYGLQLMASHFRLLPERDPHPILYDILHLFMQN 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
                V  ++ V+ E+ LL+ +GFGLDL+ C VTG  + L +VSPKSG AVC  VGLP+ 
Sbjct: 121 FDEQFVNAELLVRFEMRLLEELGFGLDLSHCAVTGRQEKLYYVSPKSGRAVCEEVGLPWK 180

Query: 181 EKMLVLPSFLWKEEQ-TIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLE 238
            K+L+LP FL +     +D D +++ F LTD+FL ++  +   I    +R   +     
Sbjct: 181 NKLLLLPKFLIERTNRPVDFDDIRNGFTLTDFFLTRHVWEPRGIKQPSVRAILIQLFER 239


>gi|260432760|ref|ZP_05786731.1| DNA repair protein RecO [Silicibacter lacuscaerulensis ITI-1157]
 gi|260416588|gb|EEX09847.1| DNA repair protein RecO [Silicibacter lacuscaerulensis ITI-1157]
          Length = 241

 Score =  189 bits (479), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 88/242 (36%), Positives = 127/242 (52%), Gaps = 3/242 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D  I+L  R +GE   I+EV T  +GRH G VR G S ++ PILQ G  + V WR+
Sbjct: 1   MDWRDHGILLTARRHGETAAIIEVFTETHGRHAGVVRGGASRKIAPILQPGAQLDVLWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFR-FLPEREPCLELYDMLNIFLN 119
           RL +++G F+ E L S  A   S  L L GL ++V L   FLPEREP   +Y      ++
Sbjct: 61  RLQEHIGTFQVEPLRSRAAAAFSGRLALSGLNAVVALLSFFLPEREPHPGIYRQTEQLMD 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                 +    +++ EL LL+ +GFGLDLT+C VTG T+ L +VSPK+G AV       +
Sbjct: 121 LLGQDEIWPLAYLRWELALLEELGFGLDLTRCAVTGTTEGLAYVSPKTGRAVSAEGAGDW 180

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYAL-QHNIIHCHLLRENFLGKLLE 238
           A+++L LP  L  +    D D + +  + T YFL                R  F+ +   
Sbjct: 181 ADRLLPLPPVLRGQGGAPD-DEIAAGLRTTGYFLAHRVAPSLGHTPLPEARARFVDQFTR 239

Query: 239 LI 240
            +
Sbjct: 240 RL 241


>gi|299135099|ref|ZP_07028290.1| DNA repair protein RecO [Afipia sp. 1NLS2]
 gi|298590076|gb|EFI50280.1| DNA repair protein RecO [Afipia sp. 1NLS2]
          Length = 249

 Score =  189 bits (479), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 92/241 (38%), Positives = 133/241 (55%), Gaps = 3/241 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W D+ IILG R +GE + I+E++TR +GRHLG VR G   RM+P+LQ GN V   WR+
Sbjct: 1   MEWTDEGIILGTRRHGESSAIVELLTRSHGRHLGLVRGGAGTRMRPLLQPGNSVSAVWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG +  E  +   A +L+     YG+  +  L R LPER P   +Y++L   L+ 
Sbjct: 61  RLDEHLGYYAIEGTQLRAATMLACPHAAYGITHLAALARLLPERAPHDGIYELLEAILDD 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P V     V+ E+ +L  +GFGLDL+ C  TG   DL++VSPKSG AV R+ G P+ 
Sbjct: 121 FDEPVVAATHVVRFEMAMLDELGFGLDLSSCAATGAQADLIYVSPKSGCAVSRAAGEPWR 180

Query: 181 EKMLVLPSFLWKEEQT---IDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLL 237
           E++L LP FL    +         +   F+LT  FL +  L+         R+ F+  + 
Sbjct: 181 ERLLPLPPFLRAGHEDSGAETERDMMEGFRLTGLFLLRNVLEPRGQGHSDARDGFIAAVA 240

Query: 238 E 238
            
Sbjct: 241 R 241


>gi|254461391|ref|ZP_05074807.1| DNA repair protein RecO [Rhodobacterales bacterium HTCC2083]
 gi|206677980|gb|EDZ42467.1| DNA repair protein RecO [Rhodobacteraceae bacterium HTCC2083]
          Length = 244

 Score =  189 bits (479), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 89/243 (36%), Positives = 129/243 (53%), Gaps = 5/243 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D  I+L VR +GE N I++V T ++GRH G VR G S ++ PILQ G  + V+WR+
Sbjct: 1   MEWRDQGILLSVRRHGETNAIIDVFTIEHGRHAGIVRGGTSRKIAPILQPGAQLDVSWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLN 119
           RL  +LG +  E L S  A  L   L L GL ++  L  F LPERE    LY      L+
Sbjct: 61  RLEDHLGTYTVEPLRSRAAAALGDRLSLAGLNAVTALLAFALPEREANTRLYKQSEQLLD 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                 V    +++ E+ LL+  G GLDL+ C VTG  ++L+++SP++G AV   V  P+
Sbjct: 121 LLGQHEVWPLAYLRFEMALLEACGMGLDLSACAVTGTNENLIYISPRTGRAVSEQVAGPW 180

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQH--NIIHCHLLRENFLGKLL 237
             K+L LP  L  +    DA  ++ A + T YFL++  L            R  ++    
Sbjct: 181 VNKLLPLPPILIGQGMGSDA-EIEQALRTTGYFLSQK-LAPSLGNRSLPEARGRYVDLFS 238

Query: 238 ELI 240
            LI
Sbjct: 239 RLI 241


>gi|254476248|ref|ZP_05089634.1| DNA repair protein RecO [Ruegeria sp. R11]
 gi|214030491|gb|EEB71326.1| DNA repair protein RecO [Ruegeria sp. R11]
          Length = 241

 Score =  188 bits (478), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 81/241 (33%), Positives = 128/241 (53%), Gaps = 5/241 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D  I+L +R +GE + I+++ T ++GRH G +R G S +M PILQ G  + + WR+
Sbjct: 1   MEWRDQGILLRMRRHGEGSAIVDMFTAEHGRHAGVIRGGASRKMAPILQPGAQLDLLWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFR-FLPEREPCLELYDMLNIFLN 119
           RL  +LG ++ E++ S     LS  L L GL ++  L    LP+REP  +LY      L+
Sbjct: 61  RLEDHLGSYQAELMRSRAGAALSGRLALAGLNAVTGLLAFCLPDREPHPDLYLRSERLLD 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                 +    ++Q E+ LL+ +GFGLDL+ C V+G   +L+++SPKSG AV R+    +
Sbjct: 121 LLGQDEIWPLAYLQWEMALLEELGFGLDLSCCAVSGALDELIYISPKSGRAVSRASAGEW 180

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQH--NIIHCHLLRENFLGKLL 237
           A ++L LP+ +  E +      +      T +FL  + L            R  FL  L 
Sbjct: 181 AHRLLPLPAVMRGEGEAGT-GEILQGLSTTGFFLE-HRLAPSLGNTPLPEARGRFLDVLT 238

Query: 238 E 238
            
Sbjct: 239 R 239


>gi|49475306|ref|YP_033347.1| DNA repair protein RecO [Bartonella henselae str. Houston-1]
 gi|61215010|sp|Q6G457|RECO_BARHE RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|49238112|emb|CAF27319.1| DNA repair protein reco [Bartonella henselae str. Houston-1]
          Length = 256

 Score =  188 bits (478), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 101/239 (42%), Positives = 148/239 (61%), Gaps = 1/239 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W++ AIILG R YGE ++ILEVMTRQ+GR++G V+ G+S RM  +LQ GN V   W +
Sbjct: 1   MKWKEQAIILGTRQYGETSVILEVMTRQHGRYMGVVKGGRSRRMAVLLQPGNFVEAEWWA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG FR E L+ H A+L+     LY LQ IV     LPER+P   LYD+L++F+  
Sbjct: 61  RLDEHLGLFRLEALDLHAARLILFPEALYALQLIVFHLHLLPERDPHPILYDILHLFMQS 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P +  ++ V+ E+  L+ +GFGLDL++C  TG  + L +VSPKSG AVC   G P+ 
Sbjct: 121 FDEPFINAELLVRFEMRFLEELGFGLDLSRCAATGRLEKLCYVSPKSGRAVCEEAGHPWR 180

Query: 181 EKMLVLPSFLWKEE-QTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLE 238
           EK+L LP FL +   + +D   +K+ F LT +FL ++  +   I    +R + +    +
Sbjct: 181 EKLLNLPQFLVQRTVRPVDFSDIKNGFILTGFFLMRHVWEPRNIKQPSVRISLIQLFEQ 239


>gi|218461899|ref|ZP_03501990.1| DNA repair protein RecO [Rhizobium etli Kim 5]
          Length = 256

 Score =  188 bits (477), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 113/241 (46%), Positives = 161/241 (66%), Gaps = 1/241 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M WQD AIILGV+ +GE ++I+EVMTR  GRHLG VR+G+S  MQP+LQ GN V V WR+
Sbjct: 1   MQWQDHAIILGVKRHGETSVIVEVMTRDRGRHLGLVRSGRSRAMQPVLQPGNAVEVIWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LGEFR E +    A+L+ ++  +YG+Q++  L R LPER+P   L+D L + L+ 
Sbjct: 61  RLDEHLGEFRVEPVTLRAARLMETATAVYGVQAMGALLRLLPERDPHPHLFDALEVILDH 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P+  G++FV+ EL +L ++GFGLDL +C  TG   DL +VSPKSG AV RS G P+A
Sbjct: 121 LHNPADAGELFVRFELAVLNDLGFGLDLAECAATGARSDLAYVSPKSGRAVSRSAGAPWA 180

Query: 181 EKMLVLPSFL-WKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLEL 239
           +KML+LP FL        D DSL +AF+LT +FL+++  +   +     R+ F+   L+ 
Sbjct: 181 DKMLLLPPFLGVDGNHAADFDSLAAAFRLTGFFLHRHVYEPRGMEASAARDGFVQAALKA 240

Query: 240 I 240
           +
Sbjct: 241 L 241


>gi|110633306|ref|YP_673514.1| DNA repair protein RecO [Mesorhizobium sp. BNC1]
 gi|119361464|sp|Q11JS6|RECO_MESSB RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|110284290|gb|ABG62349.1| DNA replication and repair protein RecO [Chelativorans sp. BNC1]
          Length = 248

 Score =  188 bits (477), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 100/241 (41%), Positives = 147/241 (60%), Gaps = 1/241 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W D+ I+LG R +GE ++ILE +T  +GRHLG VR G+S RMQP+LQ GN V + WR+
Sbjct: 1   MEWHDEGIVLGTRRHGESSVILEAITAAHGRHLGLVRGGRSKRMQPVLQPGNRVDLTWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG F+ E LE + A+LL+S++ +YG+Q +    R LPER+P   L++ L +    
Sbjct: 61  RLDEHLGLFQVEPLELNAARLLNSAVAIYGIQLLAAHLRLLPERDPHPGLFEALGVIAAH 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P   G +  + EL +L  +GFGLDL +C VTG  +DL +VSPK+G AV R  G P+A
Sbjct: 121 LDEPETAGVLVARFELAVLDALGFGLDLARCAVTGSREDLAYVSPKTGRAVTREAGAPWA 180

Query: 181 EKMLVLPSFLWKEEQT-IDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLEL 239
           +K+L LP+FL    +   D   L  AF LT +F  ++  +   +     R  FL  ++  
Sbjct: 181 DKLLPLPTFLTAGNEALYDRAILSQAFALTGFFFARHVYEPRGLTEPEARAGFLAAVMRN 240

Query: 240 I 240
           +
Sbjct: 241 L 241


>gi|83855024|ref|ZP_00948554.1| DNA repair protein RecO [Sulfitobacter sp. NAS-14.1]
 gi|83842867|gb|EAP82034.1| DNA repair protein RecO [Sulfitobacter sp. NAS-14.1]
          Length = 245

 Score =  188 bits (477), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 86/240 (35%), Positives = 123/240 (51%), Gaps = 3/240 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D  I+L  R +GE + I+EV T + GRH G VR G S ++ PILQ G  + + WR+
Sbjct: 1   MEWRDQGILLSARRHGETSAIIEVFTPERGRHAGIVRGGTSRKIAPILQPGAQLDIAWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLN 119
           RL  ++G F  E + S  A  +   L L GL ++  L  F LPERE    LY      L+
Sbjct: 61  RLEDHIGAFTVEPVRSRAALAMHDRLSLAGLNAVTGLLAFALPEREAHPPLYRRTEALLD 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                 +    ++Q E+ LL  +G+GLDL+ C VTG T  L++VSPK+G AV R     +
Sbjct: 121 LLGQGDLWPLAYLQWEISLLDELGYGLDLSACAVTGRTSGLVFVSPKTGRAVTREGAGEW 180

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNI-IHCHLLRENFLGKLLE 238
            +KML L   L  E    DA  +  AF+ T YFL ++  +          R  ++     
Sbjct: 181 VDKMLPLSPVLRGEGDASDA-DIALAFKTTGYFLERHLARDLGDKPLPEARARYVEAFSR 239


>gi|149200802|ref|ZP_01877777.1| DNA repair protein RecO [Roseovarius sp. TM1035]
 gi|149145135|gb|EDM33161.1| DNA repair protein RecO [Roseovarius sp. TM1035]
          Length = 244

 Score =  188 bits (476), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 80/239 (33%), Positives = 119/239 (49%), Gaps = 5/239 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D  I+L  R +GE ++I+EV T + GRH G VR G S +M P+LQ G  + + WR+
Sbjct: 1   MDWRDQGILLNSRRHGESSVIIEVFTPERGRHAGVVRGGASRKMAPVLQPGAQLDLEWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL  ++G FR E L+S    +               L   LPERE   ELY    I L+ 
Sbjct: 61  RLEDHIGTFRVEPLKSRAWTMGDRMALAGLNAVCALLLFVLPEREAHAELYRKTLILLDI 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVT-QDLLWVSPKSGGAVCRSVGLPY 179
              P +    ++  E+ LL+ +GFGLDL +C V G    DL ++SPK+G AV R+    +
Sbjct: 121 LDQPEIWTLAYLNWEMALLEEMGFGLDLRRCAVLGEKANDLSYISPKTGRAVSRAGAGEW 180

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQH--NIIHCHLLRENFLGKL 236
           A+++L LP  L       D   +   F++T  FL +  L            R  ++ + 
Sbjct: 181 ADRLLPLPPCLMGHGPAPD-GEILQGFEVTGQFL-RNHLAPQLGNRPLPEARARYVARF 237


>gi|209884979|ref|YP_002288836.1| DNA repair protein RecO [Oligotropha carboxidovorans OM5]
 gi|229470366|sp|B6JGG5|RECO_OLICO RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|209873175|gb|ACI92971.1| DNA repair protein RecO [Oligotropha carboxidovorans OM5]
          Length = 249

 Score =  187 bits (475), Expect = 9e-46,   Method: Composition-based stats.
 Identities = 96/241 (39%), Positives = 132/241 (54%), Gaps = 3/241 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W DD IILG R +GE N I+E++TR +GRHLG VR G   RM+P+LQ GN V   WR+
Sbjct: 1   MEWTDDGIILGTRRHGEANAIVELLTRSHGRHLGLVRGGAGTRMRPLLQPGNSVGAVWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG +  E      A +LS S   YG+  +  L R LPER P   +Y+     L  
Sbjct: 61  RLDEHLGYYALEGTRLRAATMLSYSHAAYGITHLAALARLLPERAPHDGIYEQFEAILED 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P +     V+ E+ +L+ +GFGLDL+ C  TG   DL++VSPKSG AV RS G P+ 
Sbjct: 121 FDDPVIAATHVVRFEMAMLEELGFGLDLSCCAATGTHTDLIYVSPKSGCAVSRSAGEPWR 180

Query: 181 EKMLVLPSFLWKEEQTIDAD---SLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLL 237
           E++L LP+FL    +    D    +   F+LT  FL +  L+         R  F+  + 
Sbjct: 181 ERLLPLPAFLRAGNEESSPDGEADIMEGFRLTGMFLLRNVLEPRGQAHSDARAGFIAAVA 240

Query: 238 E 238
            
Sbjct: 241 R 241


>gi|49474068|ref|YP_032110.1| DNA repair protein RecO [Bartonella quintana str. Toulouse]
 gi|61215004|sp|Q6G080|RECO_BARQU RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|49239572|emb|CAF25929.1| DNA repair protein recO [Bartonella quintana str. Toulouse]
          Length = 243

 Score =  187 bits (474), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 101/239 (42%), Positives = 145/239 (60%), Gaps = 1/239 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W++ A+ILG R YGE +IILEVMTRQ+GR++G V+ G S RM  +LQ GN V   W +
Sbjct: 1   MKWKEQAVILGTRQYGETSIILEVMTRQHGRYMGIVKGGHSRRMAGLLQPGNFVEAEWWA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG FR E L+ + A+L+     LY LQ IV   R LPER+P   LYD+L++F+  
Sbjct: 61  RLDEHLGLFRLEALDLYAARLILLPEALYALQLIVFHLRLLPERDPYPSLYDILHLFMQN 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
                V  ++ V+ E+ LL+ +GFGLDL++C  TG  + L +VSPKSG AVC   G P+ 
Sbjct: 121 FDESFVNAELLVRFEMRLLEELGFGLDLSRCAATGRQERLFYVSPKSGRAVCEEAGRPWK 180

Query: 181 EKMLVLPSFLWKEEQ-TIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLE 238
           EK+L LP FL +     ++   + + F LT +FL ++  +   I    +R N +     
Sbjct: 181 EKLLTLPQFLVRRAIRPVNFSDIINGFILTGFFLMRHVWEPRGIKQPSVRVNLIQLFER 239


>gi|86357032|ref|YP_468924.1| DNA repair protein RecO [Rhizobium etli CFN 42]
 gi|119361475|sp|Q2KAD9|RECO_RHIEC RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|86281134|gb|ABC90197.1| DNA repair protein [Rhizobium etli CFN 42]
          Length = 256

 Score =  187 bits (474), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 113/241 (46%), Positives = 161/241 (66%), Gaps = 1/241 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M WQD AIILGV+ +GE ++I EVMTR  GRHLG VR+G+S  M+P+LQ GN V V WR+
Sbjct: 1   MQWQDQAIILGVKRHGETSVIAEVMTRGRGRHLGLVRSGRSRAMRPVLQPGNAVEVVWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LGEFR E +    A+L+ ++  +YG+Q++  L R LPER+P   L+D L + L+ 
Sbjct: 61  RLDEHLGEFRVEPVTLRAARLMDTATAVYGVQAMGALLRLLPERDPHPHLFDALEVILDH 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P+  G++FV+ EL +L ++GFGLDL +C  TG   DL +VSPKSG AV RS G P+A
Sbjct: 121 LHNPADAGELFVRFELAVLNDLGFGLDLAECAATGARSDLAYVSPKSGRAVSRSAGAPWA 180

Query: 181 EKMLVLPSFL-WKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLEL 239
           +KML+LP FL  +     D DSL +AF+LT +FL+++  +   I     R+ F+   L+ 
Sbjct: 181 DKMLLLPPFLGVEGNHAADVDSLAAAFRLTGFFLHRHVYEPRGIEAVAARDGFVQAALKA 240

Query: 240 I 240
           +
Sbjct: 241 L 241


>gi|222085393|ref|YP_002543923.1| DNA repair protein RecO [Agrobacterium radiobacter K84]
 gi|254790503|sp|B9JC76|RECO_AGRRK RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|221722841|gb|ACM25997.1| DNA repair protein RecO [Agrobacterium radiobacter K84]
          Length = 259

 Score =  186 bits (473), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 113/241 (46%), Positives = 161/241 (66%), Gaps = 1/241 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M WQD AIILGV+  GE ++I EVMTR  GRH+G VR+G+S  MQP+LQ GNLV V WR+
Sbjct: 1   MQWQDHAIILGVKRLGETSVIAEVMTRDRGRHMGLVRSGRSRSMQPVLQPGNLVEVTWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LGEFR E +    A+L+ ++  +YG+Q++  L R LPER+P   LYD L++ L  
Sbjct: 61  RLHEHLGEFRMEPVRLRAARLMETATAVYGVQAMGALLRLLPERDPHPYLYDALDVILEN 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
            + P   G++FV+ EL +L  +G+GLDL +C  TGV  DL +VSPK+G AVCR+ G P+A
Sbjct: 121 MQNPMDAGELFVRFELAVLNELGYGLDLGECAATGVRDDLAFVSPKTGRAVCRTAGAPWA 180

Query: 181 EKMLVLPSFLWKEE-QTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLEL 239
           +KML LP FL     +  + +SL +AF+LT +FL+++  +   I     RE F+   L+ 
Sbjct: 181 DKMLALPPFLAAGTVEAANGESLAAAFRLTGFFLHRHVYEPRGIEIAAAREGFIQAALKA 240

Query: 240 I 240
           +
Sbjct: 241 V 241


>gi|221234572|ref|YP_002517008.1| DNA repair protein RecO [Caulobacter crescentus NA1000]
 gi|254790515|sp|B8GVD0|RECO_CAUCN RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|220963744|gb|ACL95100.1| DNA repair protein recO [Caulobacter crescentus NA1000]
          Length = 243

 Score =  186 bits (472), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 74/240 (30%), Positives = 117/240 (48%), Gaps = 1/240 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D+A +L  RS+GE   I+E++T   G+    V    S RM+P LQ G  V V +R+
Sbjct: 1   MEWEDEAYVLSARSHGETGAIVELLTEARGKVAAHVAGAASRRMKPFLQPGARVIVRYRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREP-CLELYDMLNIFLN 119
           ++   LG    E +    + L    L L GL +   +              +  L   + 
Sbjct: 61  KVEGQLGSATLEPMGEGPSSLFDDRLALAGLSAAAAVAAAALPEREAHPGAFHALEALIR 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
             +IP +   ++V+ E  LL+ +GFGLDL+KC  TG   DL++VSP++G AV R  G PY
Sbjct: 121 VLEIPEIWPAVYVRYEAGLLQELGFGLDLSKCAATGAFDDLVYVSPRTGRAVSREAGKPY 180

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLEL 239
            +K+L LP F+   +  +    +K+   +T +FL ++            R   L +L E 
Sbjct: 181 HDKLLPLPPFMLSSQGGLAEGDVKAGLDITGHFLEQFVFGPLNRPLPPARLWLLDRLAEA 240


>gi|126739720|ref|ZP_01755412.1| DNA repair protein RecO [Roseobacter sp. SK209-2-6]
 gi|126719366|gb|EBA16076.1| DNA repair protein RecO [Roseobacter sp. SK209-2-6]
          Length = 251

 Score =  186 bits (472), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 81/242 (33%), Positives = 124/242 (51%), Gaps = 5/242 (2%)

Query: 2   YWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSR 61
            W+D  I+L  R +GE + I++V T ++GRH G VR G S R+ PILQ G  + + WR+R
Sbjct: 12  EWRDHGILLSARRHGESSAIIDVFTEEHGRHAGVVRGGASRRLAPILQPGAQLDLLWRAR 71

Query: 62  LAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLF-RFLPEREPCLELYDMLNIFLNC 120
           L ++LG ++ E L S     +S  L L GL ++  L    LPEREP   LY      L+ 
Sbjct: 72  LEEHLGSYQAEPLRSRAVAAMSGRLALSGLNAVTALLGFCLPEREPHPALYASSERLLDL 131

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
            +   +    +++ E+ LL+ +GFGLDL  C V+G  ++L +VSP++G AV R    P+ 
Sbjct: 132 LEQEELWPLAYLRWEMELLEEMGFGLDLLACAVSGRNEELAYVSPRTGRAVSRQEAGPWV 191

Query: 181 EKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQH--NIIHCHLLRENFLGKLLE 238
            ++L LP  +  + +  D   +    + T YFL    L            R  FL     
Sbjct: 192 ARLLPLPPVMLGKGEAPD-HEIAEGLKTTGYFLETR-LAPALGNRPLPEARGRFLDAFSR 249

Query: 239 LI 240
            +
Sbjct: 250 RL 251


>gi|83941547|ref|ZP_00954009.1| DNA repair protein RecO, putative [Sulfitobacter sp. EE-36]
 gi|83847367|gb|EAP85242.1| DNA repair protein RecO, putative [Sulfitobacter sp. EE-36]
          Length = 245

 Score =  186 bits (472), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 86/240 (35%), Positives = 123/240 (51%), Gaps = 3/240 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D  I+L  R +GE + I+EV T + GRH G VR G S ++ PILQ G  + + WR+
Sbjct: 1   MEWRDQGILLSARRHGETSAIIEVFTPERGRHAGIVRGGTSRKIAPILQPGAQLDIAWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLN 119
           RL  ++G F  E + S  A  +   L L GL ++  L  F LPERE    LY      L+
Sbjct: 61  RLEDHIGAFTVEPVRSRAALAMHDRLSLAGLNAVTGLLAFALPEREAHAPLYRRTEALLD 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                 +    ++Q E+ LL  +G+GLDL+ C VTG T  L++VSPK+G AV R     +
Sbjct: 121 LLGQGDLWPLAYLQWEISLLDELGYGLDLSACAVTGRTSGLVFVSPKTGRAVTREGAGEW 180

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNI-IHCHLLRENFLGKLLE 238
            +KML L   L  E    DA  +  AF+ T YFL ++  +          R  ++     
Sbjct: 181 VDKMLPLSPVLRGEGDASDA-DIALAFKTTGYFLERHLARDLGDKPLPEARARYVEAFSR 239


>gi|110678689|ref|YP_681696.1| DNA repair protein RecO [Roseobacter denitrificans OCh 114]
 gi|119361483|sp|Q16AI3|RECO_ROSDO RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|109454805|gb|ABG31010.1| DNA repair protein RecO [Roseobacter denitrificans OCh 114]
          Length = 241

 Score =  186 bits (471), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 81/242 (33%), Positives = 120/242 (49%), Gaps = 3/242 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+++ I+L  R +GE   I+EV T  +GRH G VR G S ++ PILQ G  + + WR+
Sbjct: 1   MEWREEGILLSTRRHGESAAIIEVFTPSHGRHAGVVRGGTSRKIAPILQPGAQLDLTWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLF-RFLPEREPCLELYDMLNIFLN 119
           RL  ++G F  E + S  A  +   L L GL ++  L    LPERE    LY      L+
Sbjct: 61  RLEDHIGSFLVEPVRSRAAAAMGDRLALAGLNAVTALLGFCLPEREAHRPLYVETERLLD 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                 +    +++ E+ LL ++G+ L L  C VTG   DL++VSPKSG AV       +
Sbjct: 121 LLGEGEIWPLAYLRWEVQLLHDMGYALALEACAVTGQRDDLIYVSPKSGRAVSAKGAGDW 180

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQH-NIIHCHLLRENFLGKLLE 238
           A+++L LP  L       DA  +  AF  T YFL ++  +          R  F+     
Sbjct: 181 ADRLLPLPPILRGIGGGPDA-EIAQAFITTGYFLTEHLARDLGGKPLPEARARFVETFSR 239

Query: 239 LI 240
            +
Sbjct: 240 RL 241


>gi|241203893|ref|YP_002974989.1| DNA repair protein RecO [Rhizobium leguminosarum bv. trifolii
           WSM1325]
 gi|240857783|gb|ACS55450.1| DNA repair protein RecO [Rhizobium leguminosarum bv. trifolii
           WSM1325]
          Length = 256

 Score =  185 bits (470), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 113/241 (46%), Positives = 164/241 (68%), Gaps = 1/241 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M WQD AIILGV+ +GE ++I+EVMTR  GRHLG VR+G+S  MQP+LQAGN V V WR+
Sbjct: 1   MQWQDHAIILGVKRHGETSVIVEVMTRDRGRHLGLVRSGRSRAMQPVLQAGNAVEVIWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LGEFR E +    A+L+ ++  +YG+Q++  L R LPER+P   L+D L + L+ 
Sbjct: 61  RLDEHLGEFRVEPVTLRAARLMETATAVYGVQAMGALLRLLPERDPHPHLFDALEVILDH 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P+  G++FV+ EL +L ++GFGLDL +C  TG   DL++VSPKSG AV R+ G P+A
Sbjct: 121 LHNPADAGELFVRFELAVLNDLGFGLDLAECAATGARSDLVYVSPKSGRAVSRAAGAPWA 180

Query: 181 EKMLVLPSFL-WKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLEL 239
           +KML+LP FL  +     D +SL +AF+LT +FL+++  +   I     R+ F+   L+ 
Sbjct: 181 DKMLLLPPFLRIEGNHAADFESLSAAFRLTGFFLHRHVYEPRGIEAVAARDGFVQAALKA 240

Query: 240 I 240
           +
Sbjct: 241 L 241


>gi|254436668|ref|ZP_05050162.1| DNA repair protein RecO [Octadecabacter antarcticus 307]
 gi|198252114|gb|EDY76428.1| DNA repair protein RecO [Octadecabacter antarcticus 307]
          Length = 242

 Score =  185 bits (470), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 79/242 (32%), Positives = 125/242 (51%), Gaps = 4/242 (1%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWR 59
           M  W+D+  ++ VR +GE + I+EV T   G   G VR G S ++ P LQ G  + V W+
Sbjct: 1   MIEWRDEGALVRVRKHGESSAIIEVFTASRGLTAGIVRGGTSRKIAPTLQPGAQLDVTWK 60

Query: 60  SRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFL 118
           +RL  +LG F  E + S  A+++   L L GL ++  L  F LP+RE    LY      L
Sbjct: 61  ARLEDHLGSFTVEPIRSRTAQVMQDRLALAGLNAVTGLLSFLLPDREAHAPLYARTIQLL 120

Query: 119 NCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
           +      V    ++Q E+ LL  +GFG+DL+ C V+G+  DL +VSP++G AV R     
Sbjct: 121 DLLGQNDVWPLAYLQWEVALLDEMGFGMDLSACAVSGLNDDLFYVSPRTGRAVSRLAAGE 180

Query: 179 YAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNI-IHCHLLRENFLGKLL 237
           +A+++L LP  L  +    D + +  A + T +FLN +  +          R+  +  + 
Sbjct: 181 WADRLLPLPHVLLGKGDA-DLNEIVLALRTTGHFLNNHLAKSLGDRPIPEARQRLIDAMK 239

Query: 238 EL 239
            L
Sbjct: 240 RL 241


>gi|300023747|ref|YP_003756358.1| DNA repair protein RecO [Hyphomicrobium denitrificans ATCC 51888]
 gi|299525568|gb|ADJ24037.1| DNA repair protein RecO [Hyphomicrobium denitrificans ATCC 51888]
          Length = 239

 Score =  185 bits (469), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 90/237 (37%), Positives = 131/237 (55%), Gaps = 1/237 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W D+AI+L V+ +GE   ++E+ TR +GRHLG V  G+S R++PILQ GN V   W++
Sbjct: 1   MQWTDEAIVLSVKPHGETAAVIELWTRTHGRHLGLVHGGRSRRLRPILQPGNHVDATWKA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL+  LG    E+  +  A+ L  +  L  L ++  L   LPER+P   LY++    L  
Sbjct: 61  RLSDQLGHVTIEMRRAFAAETLDDAAALAALSTLTTLTHLLPERDPHPNLYEITLFVLGF 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
               +V   + V+ EL LL+ +GFGLDL++C  TG    L++VSP++G AV  S G PY 
Sbjct: 121 LNDATVWPALLVRWELALLEELGFGLDLSQCAATGSNDQLIYVSPRTGRAVSASAGEPYR 180

Query: 181 EKMLVLPSFLWKE-EQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKL 236
           +K+L LP+FL K     +  D ++  F LT +FL    L          R   L  L
Sbjct: 181 DKLLPLPAFLTKHRSGHVTEDDIRLGFALTGHFLETRVLLPRGQSLPQPRSRLLAHL 237


>gi|163867994|ref|YP_001609198.1| DNA repair protein RecO [Bartonella tribocorum CIP 105476]
 gi|189039650|sp|A9IRN6|RECO_BART1 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|161017645|emb|CAK01203.1| DNA repair protein RecO [Bartonella tribocorum CIP 105476]
          Length = 248

 Score =  185 bits (469), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 101/239 (42%), Positives = 146/239 (61%), Gaps = 1/239 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W++ A+ILGVR YGE ++ILE++TR+ GR++G V+ G+S RM  +LQ GN V   W +
Sbjct: 1   MKWKEQAVILGVRQYGETSVILEIITRERGRYMGVVKGGRSRRMAALLQPGNFVEAEWSA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG FR E L+ H A+L+     LY LQ I    R LPER+P   LYD+L++F+  
Sbjct: 61  RLEEHLGLFRLEALDFHAARLICLPEALYALQLIAFHLRLLPERDPHPVLYDILHLFMQN 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P V  ++ V+ E+ LL+ +GFGLDL+ C  TG  Q L +VSPKSG AVC   G P+ 
Sbjct: 121 FDEPFVNAELLVRFEMRLLEELGFGLDLSCCAATGRKQKLYYVSPKSGRAVCEEAGEPWK 180

Query: 181 EKMLVLPSFLWKE-EQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLE 238
           +K+L+LP FL +   +  D   + + F LT +FL +Y  +   I    +R N +     
Sbjct: 181 KKLLILPQFLVQRATRPADFRDIINGFNLTSFFLMRYVWEPRDIKQPSVRTNLIQLFER 239


>gi|126728495|ref|ZP_01744311.1| DNA repair protein RecO [Sagittula stellata E-37]
 gi|126711460|gb|EBA10510.1| DNA repair protein RecO [Sagittula stellata E-37]
          Length = 241

 Score =  185 bits (469), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 83/241 (34%), Positives = 124/241 (51%), Gaps = 5/241 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D  I+L  R +GE ++IL+V T + GRH G +R G S +M P LQ G  + ++WR+
Sbjct: 1   MEWRDTGILLATRRHGETSLILDVFTPERGRHSGVLRGGTSRKMAPHLQPGAQLDLSWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFR-FLPEREPCLELYDMLNIFLN 119
           RL  ++G F  E   S  A+ L   L L GL ++V L R  LPER P  +LY      L+
Sbjct: 61  RLEDHMGAFTVEPQRSRAAQALGDRLALAGLNAVVALLRFCLPERVPHPDLYTFSEQLLD 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
               P +    +++ E+ LL+ +GF LDL+ C VTG T+ L++VSPKSG AV       +
Sbjct: 121 LLDQPDLWPLAYLRWEMALLEEMGFALDLSCCAVTGRTEGLVYVSPKSGRAVTAEGAGNW 180

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQH--NIIHCHLLRENFLGKLL 237
              +L LP  +       D   + +A   T YFL  + L            R   + ++ 
Sbjct: 181 VHHLLPLPEVMLGRGAA-DNPEVATALGTTGYFLE-HRLAPQMGDKPVPEARARLIERIR 238

Query: 238 E 238
           +
Sbjct: 239 Q 239


>gi|327191326|gb|EGE58359.1| DNA repair protein (recombination protein O) [Rhizobium etli
           CNPAF512]
          Length = 281

 Score =  185 bits (468), Expect = 6e-45,   Method: Composition-based stats.
 Identities = 112/241 (46%), Positives = 161/241 (66%), Gaps = 1/241 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M WQD AIILG++ +GE ++I EVMTR  GRHLG VR+G+S  MQP+LQ GN V V WR+
Sbjct: 26  MQWQDHAIILGIKRHGETSVIAEVMTRDRGRHLGLVRSGRSRAMQPVLQPGNAVEVIWRA 85

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LGEFR E +    A+L+ ++  +YG+Q++  L R LPER+P   L+D L + L+ 
Sbjct: 86  RLDEHLGEFRVEPVTLRAARLMETATAVYGVQAMGALLRLLPERDPHPHLFDALEVILDH 145

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P+  G++FV+ EL +L ++GFGLDL +C  TG   DL +VSPKSG AV RS G P+A
Sbjct: 146 LHNPADAGELFVRFELAVLNDLGFGLDLGECAATGARSDLAYVSPKSGRAVSRSAGAPWA 205

Query: 181 EKMLVLPSFL-WKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLEL 239
           +KML+LP FL  +     D DSL +AF+LT +FL+++  +   +     R+ F+   L+ 
Sbjct: 206 DKMLLLPPFLGVEGNHAADFDSLAAAFRLTGFFLHRHVYEPRGMEAAAARDGFVQAALKA 265

Query: 240 I 240
           +
Sbjct: 266 L 266


>gi|218509904|ref|ZP_03507782.1| DNA repair protein RecO [Rhizobium etli Brasil 5]
          Length = 245

 Score =  185 bits (468), Expect = 6e-45,   Method: Composition-based stats.
 Identities = 112/241 (46%), Positives = 161/241 (66%), Gaps = 1/241 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M WQD AIILG++ +GE ++I EVMTR  GRHLG VR+G+S  MQP+LQ GN V V WR+
Sbjct: 1   MQWQDHAIILGIKRHGETSVIAEVMTRDRGRHLGLVRSGRSRAMQPVLQPGNAVEVIWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LGEFR E +    A+L+ ++  +YG+Q++  L R LPER+P   L+D L + L+ 
Sbjct: 61  RLDEHLGEFRVEPVTLRAARLMETATAVYGVQAMGALLRLLPERDPHPHLFDALEVILDH 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P+  G++FV+ EL +L ++GFGLDL +C  TG   DL +VSPKSG AV RS G P+A
Sbjct: 121 LHNPADAGELFVRFELAVLNDLGFGLDLGECAATGARSDLAYVSPKSGRAVSRSAGAPWA 180

Query: 181 EKMLVLPSFL-WKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLEL 239
           +KML+LP FL  +     D DSL +AF+LT +FL+++  +   +     R+ F+   L+ 
Sbjct: 181 DKMLLLPPFLGVEGNHAADFDSLAAAFRLTGFFLHRHVYEPRGMEAAAARDGFVQAALKA 240

Query: 240 I 240
           +
Sbjct: 241 L 241


>gi|190891077|ref|YP_001977619.1| DNA repair protein (recombination protein O) [Rhizobium etli CIAT
           652]
 gi|238692513|sp|B3PUP2|RECO_RHIE6 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|190696356|gb|ACE90441.1| DNA repair protein (recombination protein O) [Rhizobium etli CIAT
           652]
          Length = 256

 Score =  185 bits (468), Expect = 6e-45,   Method: Composition-based stats.
 Identities = 112/241 (46%), Positives = 161/241 (66%), Gaps = 1/241 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M WQD AIILG++ +GE ++I EVMTR  GRHLG VR+G+S  MQP+LQ GN V V WR+
Sbjct: 1   MQWQDHAIILGIKRHGETSVIAEVMTRDRGRHLGLVRSGRSRAMQPVLQPGNAVEVIWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LGEFR E +    A+L+ ++  +YG+Q++  L R LPER+P   L+D L + L+ 
Sbjct: 61  RLDEHLGEFRVEPVTLRAARLMETATAVYGVQAMGALLRLLPERDPHPHLFDALEVILDH 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P+  G++FV+ EL +L ++GFGLDL +C  TG   DL +VSPKSG AV RS G P+A
Sbjct: 121 LHNPADAGELFVRFELAVLNDLGFGLDLGECAATGARSDLAYVSPKSGRAVSRSAGAPWA 180

Query: 181 EKMLVLPSFL-WKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLEL 239
           +KML+LP FL  +     D DSL +AF+LT +FL+++  +   +     R+ F+   L+ 
Sbjct: 181 DKMLLLPPFLGVEGNHAADFDSLAAAFRLTGFFLHRHVYEPRGMEAAAARDGFVQAALKA 240

Query: 240 I 240
           +
Sbjct: 241 L 241


>gi|325292418|ref|YP_004278282.1| DNA repair protein RecO [Agrobacterium sp. H13-3]
 gi|325060271|gb|ADY63962.1| DNA repair protein RecO [Agrobacterium sp. H13-3]
          Length = 254

 Score =  184 bits (467), Expect = 7e-45,   Method: Composition-based stats.
 Identities = 115/241 (47%), Positives = 167/241 (69%), Gaps = 1/241 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M WQD+AIILGV+ +GE ++I EVMTR  GRHLG VR G+S  MQP+LQAGN V V WR+
Sbjct: 1   MQWQDEAIILGVKRHGETSVIAEVMTRLRGRHLGMVRGGRSRSMQPVLQAGNRVDVIWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL  +LGEFR E L+   A+L+ ++  +YG+Q++  L R LPER+P   LY  L++ L+ 
Sbjct: 61  RLDDHLGEFRIEPLQLRAAQLMETATAVYGVQAMGALLRLLPERDPHPHLYQALDVILDN 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P   G++FV+ EL +L ++GFGLDLT+C  TG+  DL++VSPK+G AVC + G PYA
Sbjct: 121 LHDPVDAGELFVRFELAVLNDLGFGLDLTECAATGLRTDLIYVSPKTGRAVCSTAGAPYA 180

Query: 181 EKMLVLPSFLWKEE-QTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLEL 239
           E+ML LP+FL + + +  D DSL +AF+LT +FL+++      ++ +  R+ F+   L+ 
Sbjct: 181 ERMLSLPAFLGEGQSKAADRDSLAAAFRLTGHFLHRHVYDPRGLNENAARDGFVQAALKA 240

Query: 240 I 240
           +
Sbjct: 241 L 241


>gi|209548606|ref|YP_002280523.1| DNA repair protein RecO [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|238058646|sp|B5ZW78|RECO_RHILW RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|209534362|gb|ACI54297.1| DNA repair protein RecO [Rhizobium leguminosarum bv. trifolii
           WSM2304]
          Length = 256

 Score =  184 bits (467), Expect = 8e-45,   Method: Composition-based stats.
 Identities = 115/241 (47%), Positives = 162/241 (67%), Gaps = 1/241 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M WQD AIILGV+ +GE ++I EVMTR  GRHLG VR+G+S  MQP+LQAGN V V WR+
Sbjct: 1   MQWQDHAIILGVKRHGETSVIAEVMTRDRGRHLGLVRSGRSRAMQPVLQAGNAVEVIWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LGEFR E +    A+L+ ++  +YG+Q++  L R LPER+P   L+D L + L+ 
Sbjct: 61  RLDEHLGEFRVEPVTLRAARLMETATAVYGVQAMGALLRLLPERDPHPHLFDALEVILDH 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P+  G++FV+ EL +L ++GFGLDL +C  TG   DL +VSPKSG AV RS G P+A
Sbjct: 121 LHNPADAGELFVRFELAVLNDLGFGLDLAECAATGARSDLAYVSPKSGRAVSRSAGAPWA 180

Query: 181 EKMLVLPSFL-WKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLEL 239
           +KML+LP FL  +     D DSL +AF+LT +FL+++  +   I     R+ F+   L+ 
Sbjct: 181 DKMLLLPPFLGIEGNHAADFDSLSAAFRLTGFFLHRHVYEPRGIEAAAARDGFVQAALKA 240

Query: 240 I 240
           +
Sbjct: 241 L 241


>gi|114770109|ref|ZP_01447647.1| DNA repair protein RecO [alpha proteobacterium HTCC2255]
 gi|114548946|gb|EAU51829.1| DNA repair protein RecO [alpha proteobacterium HTCC2255]
          Length = 243

 Score =  184 bits (467), Expect = 8e-45,   Method: Composition-based stats.
 Identities = 82/239 (34%), Positives = 127/239 (53%), Gaps = 1/239 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W  + +I+ VR YGE ++I++ +T ++GRHLG VR G S +M   +Q G+ V++ WR+
Sbjct: 1   MEWTSEGVIVSVRKYGENSVIIDTLTPKHGRHLGVVRGGASRKMAATIQPGSQVKLEWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG FR E LES                    +    PER P  ELY+     ++ 
Sbjct: 61  RLEEHLGNFRVEQLESRSDMFDDRLRLAALSSICSIVTFSFPERMPVAELYNSTLNLMDT 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
                    ++   EL +L+ +GFGLDLT C VT VTQDL++VSPKSG AV R     + 
Sbjct: 121 LNTGGDWKPLYALWELQVLEEMGFGLDLTSCAVTNVTQDLIYVSPKSGRAVSRKAAGEWK 180

Query: 181 EKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNI-IHCHLLRENFLGKLLE 238
           E++L LPSFL  + +T + + + ++ + T +FL+ +             R   + +L  
Sbjct: 181 ERLLPLPSFLRNKFETANHEDILNSLKTTGHFLSSWLATSLGERKLPEARNRLISRLEN 239


>gi|298291623|ref|YP_003693562.1| DNA repair protein RecO [Starkeya novella DSM 506]
 gi|296928134|gb|ADH88943.1| DNA repair protein RecO [Starkeya novella DSM 506]
          Length = 243

 Score =  184 bits (467), Expect = 9e-45,   Method: Composition-based stats.
 Identities = 95/229 (41%), Positives = 129/229 (56%), Gaps = 1/229 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W D+ IILG+R +GE N I+E+MT  +GRHLG VR G S R    LQ GN V+  WR+
Sbjct: 1   MEWSDEGIILGLRRHGEGNAIVELMTAAHGRHLGLVRGGGSRRQAAALQPGNGVQATWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG F  EV      +L+ ++   + L  I  L R LPER+P  EL+D+L   +  
Sbjct: 61  RLDEHLGTFALEVTTPRAGRLMGAAHSAFALSHIGSLIRMLPERDPHPELHDVLTAMVEH 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P + G +  + ELM+L  +GFGLDL  C  TG   DLL+VSPKSG AV R  G P+ 
Sbjct: 121 LDEPRLTGMMMARFELMMLSELGFGLDLESCAATGGRNDLLYVSPKSGRAVSRDAGEPWR 180

Query: 181 EKMLVLPSFLWKE-EQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLL 228
            ++L LP FL  E  +      + +AF LT +FL +   +   I     
Sbjct: 181 AQLLNLPYFLIGEVAEPPSPGDVDAAFDLTGHFLARRVFEPRGIPMPES 229


>gi|295690015|ref|YP_003593708.1| DNA repair protein RecO [Caulobacter segnis ATCC 21756]
 gi|295431918|gb|ADG11090.1| DNA repair protein RecO [Caulobacter segnis ATCC 21756]
          Length = 243

 Score =  184 bits (466), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 72/240 (30%), Positives = 118/240 (49%), Gaps = 1/240 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D+A +L  RS+GE   I+E++T+  G+    V    S RM+P LQ G  V   +R+
Sbjct: 1   MEWEDEAYVLSARSHGETGAIVELLTQDRGKFAAHVAGAASRRMKPFLQPGARVIARYRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREP-CLELYDMLNIFLN 119
           R++  LG    E +    + L    L L GL +   +              +  L   + 
Sbjct: 61  RMSDQLGSASLEPMGEGPSSLFDDRLALAGLSAAAAVAAAALPEREAHPGAFHALEALIR 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
             ++  +   ++V+ E  LL+ +GFGLDL++C  TGV  DL++VSP++G AV R  G PY
Sbjct: 121 VLEVSEIWPAVYVRYEAGLLQELGFGLDLSRCAATGVFDDLVYVSPRTGRAVSREAGRPY 180

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLEL 239
            +K+L LP F+   +  +    +K+   +T +FL ++            R   L +L E 
Sbjct: 181 HDKLLPLPPFMLSSQGGLAEGDVKAGLDITGHFLEQFVFGPLNRPLPPARMWLLDRLTEA 240


>gi|163733859|ref|ZP_02141301.1| DNA repair protein RecO [Roseobacter litoralis Och 149]
 gi|161392970|gb|EDQ17297.1| DNA repair protein RecO [Roseobacter litoralis Och 149]
          Length = 241

 Score =  184 bits (466), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 82/242 (33%), Positives = 122/242 (50%), Gaps = 3/242 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+++ I+L  R +GE   I+EV T  +GRH G VR G S ++ PILQ G  + + WR+
Sbjct: 1   MEWREEGILLSTRRHGESAAIIEVFTPSHGRHAGVVRGGTSRKIAPILQPGAQLDLTWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLF-RFLPEREPCLELYDMLNIFLN 119
           RL  ++G F  E + S  A  +   L L GL ++  L    LPERE    LY      L+
Sbjct: 61  RLEDHIGSFHVEPVRSRAAAAMGDRLALAGLNAVTALLGFCLPEREAHRALYLETERLLD 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
             +   +    +++ E+ LL  +G+ L+L +C VTG   DL++VSPKSG AV       +
Sbjct: 121 LLEEGELWPLAYLRWEVQLLHEMGYALELDQCAVTGQRDDLIYVSPKSGRAVSAQGAGDW 180

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQH-NIIHCHLLRENFLGKLLE 238
           AE++L LP  L       DA  +  AF  T YFL ++  +          R  F+     
Sbjct: 181 AERLLPLPPILRGVGGGPDA-EIAQAFVTTGYFLTEHLARDLGGKPLPEARARFVETFSR 239

Query: 239 LI 240
            +
Sbjct: 240 RL 241


>gi|99082396|ref|YP_614550.1| DNA repair protein RecO [Ruegeria sp. TM1040]
 gi|119361485|sp|Q1GDH8|RECO_SILST RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|99038676|gb|ABF65288.1| DNA repair protein RecO [Ruegeria sp. TM1040]
          Length = 241

 Score =  184 bits (466), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 87/242 (35%), Positives = 128/242 (52%), Gaps = 3/242 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D  I+L VR +GE + ++EV T  +G H G VR G S +M P LQ G  + + W +
Sbjct: 1   MDWRDQGILLTVRRHGESSALIEVFTEDHGLHAGLVRGGASRKMAPHLQPGAQLDLTWSA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLN 119
           RL  +LG ++ E L S     LS  L L GL ++  L  F LP+R P   LY   +  L+
Sbjct: 61  RLEDHLGTYKAEPLRSRAGMALSGRLALAGLNAVCALLAFALPDRAPYPALYHRSSALLD 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                 +    +++ EL LL+++G+GLDL+ C  TGVTQDL +VSPK+G AV  +    +
Sbjct: 121 LLDSEDLWPLAYLRWELSLLEDLGYGLDLSACAATGVTQDLRYVSPKTGRAVSGAAAGEW 180

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLN-KYALQHNIIHCHLLRENFLGKLLE 238
           A+++L LP  +  E    D   + +A + T +FL  K A           R  FL  L  
Sbjct: 181 ADRLLPLPPVMRGEGAAEDI-EILTALRTTGFFLESKLAPALGNRPIPEARGRFLDALAR 239

Query: 239 LI 240
            +
Sbjct: 240 RV 241


>gi|315499944|ref|YP_004088747.1| DNA repair protein reco [Asticcacaulis excentricus CB 48]
 gi|315417956|gb|ADU14596.1| DNA repair protein RecO [Asticcacaulis excentricus CB 48]
          Length = 239

 Score =  184 bits (466), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 77/239 (32%), Positives = 123/239 (51%), Gaps = 1/239 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M ++DDA +L  R +GE   ++  +T ++G     V  G S R++P LQ  + VR+++R+
Sbjct: 1   MTFEDDAFVLSARPHGETGAVVHFLTLEHGHIAAHVPGGASRRLKPYLQPASRVRLSYRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFR-FLPEREPCLELYDMLNIFLN 119
           R A  LG    E      A++    + L G+Q    + R  LPERE     +      +N
Sbjct: 61  RTADQLGSATLEPEGDATAEIFDDPMALIGVQCACVMTRAVLPEREAYPGAFYAFETLIN 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
              +P V   ++V+ E+ LL+ +GFGLDL+ C V+G   DL +VSP+S  AV R  G PY
Sbjct: 121 AFGLPGVWPYVYVRFEMGLLEAVGFGLDLSACAVSGSRDDLAYVSPRSARAVSRREGEPY 180

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLE 238
            +K+L LP FL   +  + AD L+    LT +FL ++           +R   +  + +
Sbjct: 181 KDKLLPLPGFLLSSQGGVQADDLRRGLDLTGFFLERHIFHPLNQPLPEIRTRLIDSVRD 239


>gi|144899859|emb|CAM76723.1| DNA repair protein RecO [Magnetospirillum gryphiswaldense MSR-1]
          Length = 250

 Score =  184 bits (466), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 87/237 (36%), Positives = 120/237 (50%), Gaps = 1/237 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W DD I+L VR  GE  I+  + TR +GRH G V  G     +  LQ GNLV+ +WR+
Sbjct: 1   MDWTDDGIVLAVRRLGEAGIVASLFTRSHGRHPGMVPGGAGRANRAALQPGNLVQASWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL + LG +R E+ E+H AK L  +  L  L S   L   L                L  
Sbjct: 61  RLPEQLGTYRLELAEAHSAKALDDAGCLAALTSACALCEALLPERQPHAPLFDALSALLV 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
                    ++V  EL LL+ +G+GLDL+ C  TG T DL++VSPKS  AV    G P+A
Sbjct: 121 SLTAPSWPSVYVHWELALLRGLGYGLDLSACAATGATTDLIYVSPKSARAVSAQAGQPHA 180

Query: 181 EKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLL 237
            K+L LP+FL  + +  DA  + +   LT YF+ ++ LQ   I     R   + +L 
Sbjct: 181 HKLLPLPAFLLGKSEG-DATDIAAGLTLTGYFIERHLLQQRHIAMPPARLRLVDRLR 236


>gi|23014388|ref|ZP_00054207.1| COG1381: Recombinational DNA repair protein (RecF pathway)
           [Magnetospirillum magnetotacticum MS-1]
          Length = 309

 Score =  184 bits (466), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 87/236 (36%), Positives = 123/236 (52%), Gaps = 1/236 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W DD I+L VR +GE   +  ++TR +GRH G V  GQ    +PILQ GNLVR  W  
Sbjct: 74  MEWDDDGIVLAVRRHGETGAVASLLTRSHGRHAGLVHGGQGRTNRPILQPGNLVRAKWTG 133

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL + LG F+ E+L ++ A  L  +  L  L S   L                  + L  
Sbjct: 134 RLPEQLGNFKLEMLHAYGAAFLDDAARLSALGSACALVETALAERQPHPACHAALVALLH 193

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
                    I+V  EL LL+++GFGLDL+ C  TG T DL WVSPK+G AV R+ G PY 
Sbjct: 194 ALEAESWPSIYVHFELALLRDLGFGLDLSACAATGQTDDLAWVSPKTGRAVSRAAGEPYR 253

Query: 181 EKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKL 236
           +K+  LP+FL +  +  DA +++   ++T +FL ++ L          R   +G+L
Sbjct: 254 DKLFKLPAFLVEGGEG-DAAAIREGLEMTGFFLQRHVLDSRHAVLPAARGRMIGRL 308


>gi|116251281|ref|YP_767119.1| DNA repair protein RecO [Rhizobium leguminosarum bv. viciae 3841]
 gi|119361476|sp|Q1MJ50|RECO_RHIL3 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|115255929|emb|CAK07010.1| putative DNA repair protein (recombination protein O) [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 256

 Score =  184 bits (466), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 114/241 (47%), Positives = 163/241 (67%), Gaps = 1/241 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M WQD AIILGV+ +GE ++I EVMTR  GRHLG VR+G+S  MQP+LQAGN V V WR+
Sbjct: 1   MQWQDHAIILGVKRHGETSVIAEVMTRDRGRHLGLVRSGRSRAMQPVLQAGNAVEVIWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LGEFR E +    A+L+ ++  +YG+Q++  L R LPER+P   L+D L + L+ 
Sbjct: 61  RLDEHLGEFRVEPVTLRAARLMETATAVYGVQAMGALLRLLPERDPHPHLFDALEVILDH 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P+  G++FV+ EL +L ++GFGLDL +C  TG   DL++VSPKSG AV R+ G P+A
Sbjct: 121 LHNPADAGELFVRFELAVLNDLGFGLDLAECAATGARSDLVYVSPKSGRAVSRAAGAPWA 180

Query: 181 EKMLVLPSFL-WKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLEL 239
           +KML+LP FL  +     D DSL +AF+LT +FL+++  +   I     R+ F+   L+ 
Sbjct: 181 DKMLLLPPFLSIEGNHAADFDSLSAAFRLTGFFLHRHVYEPRGIEAVAARDGFVQAALKA 240

Query: 240 I 240
           +
Sbjct: 241 L 241


>gi|163740179|ref|ZP_02147573.1| DNA repair protein RecO [Phaeobacter gallaeciensis 2.10]
 gi|161386037|gb|EDQ10412.1| DNA repair protein RecO [Phaeobacter gallaeciensis 2.10]
          Length = 241

 Score =  183 bits (465), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 83/241 (34%), Positives = 124/241 (51%), Gaps = 5/241 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D+ I+L +R +GE   I++  T ++GRH G VR G   RM P+LQ G  + + WR+
Sbjct: 1   MEWRDEGILLTMRRHGESAAIVDAFTAEHGRHAGIVRGGAGRRMAPVLQPGAQLDLTWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFR-FLPEREPCLELYDMLNIFLN 119
           RL  +LG ++ E++ S  A  +SS L L GL ++  L    LPERE   ELY      L+
Sbjct: 61  RLEDHLGSYQAELIRSRAATAMSSRLALAGLNAVTALLAFCLPEREAHPELYLRSTQILD 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                 +    +++ E+ LL+ +GFGL+  +C VTG   DL++VSPKSG AV R     +
Sbjct: 121 LLGRDDIWPLAYLRWEVALLEEMGFGLEFEQCAVTGSRLDLIYVSPKSGRAVSRRGAGEW 180

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQH--NIIHCHLLRENFLGKLL 237
           A++ML LP  L       +   + +A   T +FL    L            R   +  L 
Sbjct: 181 ADRMLPLPPVLMGRGGAEN-SEIVTALSTTGFFLQNR-LAPSLGNHPLPEARGRLIDVLS 238

Query: 238 E 238
            
Sbjct: 239 R 239


>gi|304392068|ref|ZP_07374010.1| DNA repair protein RecO [Ahrensia sp. R2A130]
 gi|303296297|gb|EFL90655.1| DNA repair protein RecO [Ahrensia sp. R2A130]
          Length = 241

 Score =  183 bits (465), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 94/240 (39%), Positives = 141/240 (58%), Gaps = 4/240 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W D AI+LGVR +GE +++ E+MTRQ GRHLG V  G+S  M+PILQ GN V   WR+
Sbjct: 1   MEWTDQAIVLGVRKHGETSVVAELMTRQRGRHLGLVHGGRSRTMRPILQPGNRVTATWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG+FR E      A+L+ +   +Y LQ++    R L ER+   +LYD L++ L+ 
Sbjct: 61  RLDEHLGQFRIEADNLRAARLMETDYAIYALQTLASHLRLLAERDAHPQLYDTLDLVLDA 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P+  G++ ++ EL LL  +GFGLDL  C  TG   +L+ VSP++G AV  +   PY 
Sbjct: 121 LDNPAAAGELVIRFELALLDELGFGLDLNACAATGARANLVSVSPRTGRAVSGAAAAPYG 180

Query: 181 EKMLVLPSFL----WKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKL 236
           +++L LPSFL           D ++L   F LT +FL++       I+    R++ +  +
Sbjct: 181 DRLLALPSFLTTAQADRTSGADEETLAQGFALTGHFLHRNVFGARGINPPAERDSLIRAV 240


>gi|163738241|ref|ZP_02145657.1| DNA repair protein RecO [Phaeobacter gallaeciensis BS107]
 gi|161388857|gb|EDQ13210.1| DNA repair protein RecO [Phaeobacter gallaeciensis BS107]
          Length = 241

 Score =  183 bits (463), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 82/237 (34%), Positives = 123/237 (51%), Gaps = 5/237 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D+ I+L +R +GE   I++  T ++GRH G VR G   RM P+LQ G  + + WR+
Sbjct: 1   MEWRDEGILLTMRRHGESAAIVDAFTAEHGRHAGIVRGGAGRRMAPVLQPGAQLDLTWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFR-FLPEREPCLELYDMLNIFLN 119
           RL  +LG ++ E++ S  A  +SS L L GL ++  L    LPERE   ELY      L+
Sbjct: 61  RLEDHLGSYQAELIRSRAATAMSSRLALAGLNAVTALLAFCLPEREAHPELYLRSTQILD 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                 +    +++ E+ LL+ +GFGL+  +C VTG   DL++VSPKSG AV R     +
Sbjct: 121 LLGRDDIWPLAYLRWEVALLEEMGFGLEFEQCAVTGSRLDLIYVSPKSGRAVSRRGAGEW 180

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQH--NIIHCHLLRENFLG 234
           A++ML LP  L       +   + +A   T +FL    L            R   + 
Sbjct: 181 ADRMLPLPPVLMGRGGAEN-SEIVTALSTTGFFLQNR-LAPSLGNHPLPEARGRLID 235


>gi|307320728|ref|ZP_07600140.1| DNA repair protein RecO [Sinorhizobium meliloti AK83]
 gi|306893655|gb|EFN24429.1| DNA repair protein RecO [Sinorhizobium meliloti AK83]
          Length = 259

 Score =  182 bits (462), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 110/240 (45%), Positives = 165/240 (68%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W D+AIILG+R +GE ++I EVMT  +GRHLG VR+G+S  MQP+LQ GN V V+WR+
Sbjct: 13  MQWSDEAIILGIRRHGESSVIAEVMTPGHGRHLGLVRSGRSRTMQPVLQPGNSVEVSWRA 72

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LGEFR E L+   A+L+ ++  +YG+Q++  L R LPER+P   LY+ L + ++ 
Sbjct: 73  RLDEHLGEFRVEPLQLRAARLIETATSVYGIQALGALLRLLPERDPHPHLYEALAVIVDH 132

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
            + P+  G++FV+ EL +L ++GFGLDL++C  TG   +L++VSPKSG A+CR  G PYA
Sbjct: 133 LQDPADAGELFVRFELAVLNDLGFGLDLSRCGATGARSELVYVSPKSGRAICREAGAPYA 192

Query: 181 EKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLELI 240
           ++ML LP FL    +  D +SL +AF+LT YFLN++  +   +     R+ F+   L+ +
Sbjct: 193 DRMLALPDFLSGGSRAADHESLAAAFRLTAYFLNRHVYEPRGVDAASARDGFVHATLKAL 252


>gi|227821417|ref|YP_002825387.1| DNA repair protein RecO [Sinorhizobium fredii NGR234]
 gi|227340416|gb|ACP24634.1| DNA repair protein RecO [Sinorhizobium fredii NGR234]
          Length = 276

 Score =  182 bits (462), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 112/240 (46%), Positives = 162/240 (67%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W D AIILG+R +GE ++I EVMT  +GRHLG VR+G+S  MQP+LQ GN V V WR+
Sbjct: 29  MQWSDQAIILGIRRHGESSVIAEVMTSAHGRHLGLVRSGRSRTMQPVLQPGNSVEVTWRA 88

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LGEFR E LE   A+L+ ++  +YG+Q++  L R LPER+P   LY+ L + ++ 
Sbjct: 89  RLDEHLGEFRLEPLELRAARLMEAATSVYGIQALGALLRLLPERDPHPHLYEALAVIVDH 148

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
            + P+  G++FV+ EL +L ++GFGLDL++C  TG   +L++VSPK+G AV R+ G PYA
Sbjct: 149 LQDPADAGELFVRFELAVLNDLGFGLDLSECAATGHRAELIYVSPKTGRAVSRAAGAPYA 208

Query: 181 EKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLELI 240
           E+ML LP FL       D DSL +AF+LT YFLN++  +   +     R+ F+   L+ +
Sbjct: 209 ERMLALPDFLSGTRSAADHDSLAAAFRLTAYFLNRHVYEPRGVDVSSARDGFVHATLKAL 268


>gi|195970186|ref|NP_385194.3| DNA repair protein RecO [Sinorhizobium meliloti 1021]
 gi|307300911|ref|ZP_07580680.1| DNA repair protein RecO [Sinorhizobium meliloti BL225C]
 gi|15074020|emb|CAC45667.1| Recombinational DNA repair protein (RecF pathway) [Sinorhizobium
           meliloti 1021]
 gi|306903866|gb|EFN34452.1| DNA repair protein RecO [Sinorhizobium meliloti BL225C]
          Length = 259

 Score =  182 bits (462), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 110/240 (45%), Positives = 164/240 (68%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W D+AIILG+R +GE ++I EVMT  +GRHLG VR+G+S  MQP+LQ GN V V+WR+
Sbjct: 13  MQWSDEAIILGIRRHGESSVIAEVMTPGHGRHLGLVRSGRSRTMQPVLQPGNSVEVSWRA 72

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LGEFR E L+   A L+ ++  +YG+Q++  L R LPER+P   LY+ L + ++ 
Sbjct: 73  RLDEHLGEFRVEPLQLRAASLIETATSVYGIQALGALLRLLPERDPHPHLYEALAVIVDH 132

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
            + P+  G++FV+ EL +L ++GFGLDL++C  TG   +L++VSPKSG A+CR  G PYA
Sbjct: 133 LQDPADAGELFVRFELAVLNDLGFGLDLSRCGATGARSELVYVSPKSGRAICREAGAPYA 192

Query: 181 EKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLELI 240
           ++ML LP FL    +  D +SL +AF+LT YFLN++  +   +     R+ F+   L+ +
Sbjct: 193 DRMLALPDFLSGGSRAADHESLAAAFRLTAYFLNRHVYEPRGVDAASARDGFVHATLKAL 252


>gi|20139557|sp|Q92KH5|RECO_RHIME RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
          Length = 247

 Score =  182 bits (462), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 110/240 (45%), Positives = 164/240 (68%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W D+AIILG+R +GE ++I EVMT  +GRHLG VR+G+S  MQP+LQ GN V V+WR+
Sbjct: 1   MQWSDEAIILGIRRHGESSVIAEVMTPGHGRHLGLVRSGRSRTMQPVLQPGNSVEVSWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LGEFR E L+   A L+ ++  +YG+Q++  L R LPER+P   LY+ L + ++ 
Sbjct: 61  RLDEHLGEFRVEPLQLRAASLIETATSVYGIQALGALLRLLPERDPHPHLYEALAVIVDH 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
            + P+  G++FV+ EL +L ++GFGLDL++C  TG   +L++VSPKSG A+CR  G PYA
Sbjct: 121 LQDPADAGELFVRFELAVLNDLGFGLDLSRCGATGARSELVYVSPKSGRAICREAGAPYA 180

Query: 181 EKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLELI 240
           ++ML LP FL    +  D +SL +AF+LT YFLN++  +   +     R+ F+   L+ +
Sbjct: 181 DRMLALPDFLSGGSRAADHESLAAAFRLTAYFLNRHVYEPRGVDAASARDGFVHATLKAL 240


>gi|188580258|ref|YP_001923703.1| DNA repair protein RecO [Methylobacterium populi BJ001]
 gi|238692877|sp|B1ZA19|RECO_METPB RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|179343756|gb|ACB79168.1| DNA repair protein RecO [Methylobacterium populi BJ001]
          Length = 246

 Score =  182 bits (461), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 94/239 (39%), Positives = 139/239 (58%), Gaps = 6/239 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W D+ +++G+R +GE  ++LE+MT ++GRHLG V  G+S RMQP+LQ GN +R  WR+
Sbjct: 1   MQWIDEGLVIGLRKHGETGVVLELMTLEHGRHLGLVHGGRSRRMQPMLQPGNTLRATWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL   LG +  E L  + ++L+ S L LYG+  +  L R LPER+P   LY+   + +  
Sbjct: 61  RLDGALGSYAVEPLTLNASRLMDSGLALYGIGHLSTLLRLLPERDPHPALYEAAQVLIAH 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P +   + V+ EL LL  +GFGLDL+ C  TG    L++VSPKSG AV  S G P+ 
Sbjct: 121 LDEPEIAPALMVRFELALLAGLGFGLDLSHCAATGANDALVYVSPKSGRAVSASAGEPFR 180

Query: 181 EKMLVLPSFLWKEEQT------IDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFL 233
           +++L LP FL   +Q        DA  ++  F LT YFL+++  +         R  F+
Sbjct: 181 DRLLALPPFLRDRDQPGSGWRTPDAHDVREGFTLTGYFLDQHVWRPRAQDTPEERARFV 239


>gi|126461085|ref|YP_001042199.1| DNA repair protein RecO [Rhodobacter sphaeroides ATCC 17029]
 gi|166221908|sp|A3PGG1|RECO_RHOS1 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|126102749|gb|ABN75427.1| DNA repair protein RecO [Rhodobacter sphaeroides ATCC 17029]
          Length = 239

 Score =  182 bits (461), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 81/241 (33%), Positives = 120/241 (49%), Gaps = 5/241 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D+  +L VR +GE + I+EV T  +GRH G VR G S ++ PILQ G  + + W++
Sbjct: 2   MEWRDEGALLSVRRHGESSAIIEVFTAAHGRHAGVVRGGASRKIAPILQPGAQLDLTWKA 61

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL +++G F  E L S  A L               L   LPEREP   L+      L+ 
Sbjct: 62  RLDEHMGAFTVEPLRSRTALLGDRLGLAGLNAICAMLHVTLPEREPHSTLWQESMALLDA 121

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P      +++ E+ LL+  GFGLDLT+C VTG  +DL +VSPK+G AV R     +A
Sbjct: 122 LDRP-GWPPAYLRWEMRLLEETGFGLDLTRCAVTGSREDLAFVSPKTGRAVSRGAAGGWA 180

Query: 181 EKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQH--NIIHCHLLRENFLGKLLE 238
           +++  LP  L  +     A+ ++    +T +FL +  L    N       R   +  L  
Sbjct: 181 DRLFPLPLALLGQG-PASAEEVRQGLAITGHFLGRE-LAPLLNGRPLPEARARLMELLAR 238

Query: 239 L 239
            
Sbjct: 239 A 239


>gi|16125811|ref|NP_420375.1| DNA repair protein RecO [Caulobacter crescentus CB15]
 gi|20139676|sp|Q9A802|RECO_CAUCR RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|13422953|gb|AAK23543.1| conserved hypothetical protein [Caulobacter crescentus CB15]
          Length = 250

 Score =  182 bits (461), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 73/239 (30%), Positives = 116/239 (48%), Gaps = 1/239 (0%)

Query: 2   YWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSR 61
            W+D+A +L  RS+GE   I+E++T   G+    V    S RM+P LQ G  V V +R++
Sbjct: 9   EWEDEAYVLSARSHGETGAIVELLTEARGKVAAHVAGAASRRMKPFLQPGARVIVRYRAK 68

Query: 62  LAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREP-CLELYDMLNIFLNC 120
           +   LG    E +    + L    L L GL +   +              +  L   +  
Sbjct: 69  VEGQLGSATLEPMGEGPSSLFDDRLALAGLSAAAAVAAAALPEREAHPGAFHALEALIRV 128

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
            +IP +   ++V+ E  LL+ +GFGLDL+KC  TG   DL++VSP++G AV R  G PY 
Sbjct: 129 LEIPEIWPAVYVRYEAGLLQELGFGLDLSKCAATGAFDDLVYVSPRTGRAVSREAGKPYH 188

Query: 181 EKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLEL 239
           +K+L LP F+   +  +    +K+   +T +FL ++            R   L +L E 
Sbjct: 189 DKLLPLPPFMLSSQGGLAEGDVKAGLDITGHFLEQFVFGPLNRPLPPARLWLLDRLAEA 247


>gi|259418038|ref|ZP_05741957.1| DNA repair protein RecO [Silicibacter sp. TrichCH4B]
 gi|259346944|gb|EEW58758.1| DNA repair protein RecO [Silicibacter sp. TrichCH4B]
          Length = 241

 Score =  182 bits (461), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 87/242 (35%), Positives = 130/242 (53%), Gaps = 3/242 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D  I+L VR +GE + ++EV T+ +GRH G VR G S +M P LQ G  + + W +
Sbjct: 1   MDWRDQGILLTVRRHGESSALIEVFTQAHGRHAGLVRGGASRKMAPHLQPGAQLDLTWSA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLN 119
           RL  +LG ++ E L S  A  LS  L L GL ++  L  F LP+RE   ELY      L+
Sbjct: 61  RLEDHLGTYKAEPLRSRAASALSGRLALSGLNAVCALLAFALPDREAYSELYHRSEALLD 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                 +    +++ EL LL+++G+GLDL+ C VTG T+ L++VSPK+G AV  +    +
Sbjct: 121 LLDNEDLWPLGYLRWELSLLEDLGYGLDLSCCAVTGATEGLMYVSPKTGRAVSEAGAGEW 180

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLN-KYALQHNIIHCHLLRENFLGKLLE 238
           A+++L LP  +  E    D   + +A + T +F   K A           R  FL  L  
Sbjct: 181 ADRLLPLPPVMRGEGDGEDI-EILTALRTTGFFFESKLAPALGNRPVPEARGRFLDALSR 239

Query: 239 LI 240
            +
Sbjct: 240 RL 241


>gi|323137541|ref|ZP_08072618.1| DNA repair protein RecO [Methylocystis sp. ATCC 49242]
 gi|322397167|gb|EFX99691.1| DNA repair protein RecO [Methylocystis sp. ATCC 49242]
          Length = 241

 Score =  181 bits (460), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 96/239 (40%), Positives = 138/239 (57%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D+ +++G R +GE ++ILE+MTRQ+GRHLG VR G+S  M+P+LQ GNLV  +WR+
Sbjct: 1   MEWRDEGLVIGARKHGETSVILELMTRQHGRHLGVVRGGRSQAMRPVLQPGNLVVASWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL  +LG F  E L S  A+ L     L+G+ ++    R LPER+P  EL++M +     
Sbjct: 61  RLEVHLGAFAIEPLASRAARYLDRGAALHGVAALAAWLRLLPERDPYEELFEMADAIACR 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
                    +  + EL LL  +GFGLDL  C +TG   DL +VSPKSG AV R  G P+ 
Sbjct: 121 LDAADFAAPLMARFELALLGALGFGLDLGACALTGARDDLAYVSPKSGRAVSREAGAPWR 180

Query: 181 EKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLEL 239
           E++L  P+FL +       D + +AF+LT YFL +  L    +     R  ++  L   
Sbjct: 181 ERLLPYPAFLREASDVAAVDDVAAAFRLTGYFLTRDVLAPRGVAMPASRALYIDALARA 239


>gi|255263314|ref|ZP_05342656.1| DNA repair protein RecO [Thalassiobium sp. R2A62]
 gi|255105649|gb|EET48323.1| DNA repair protein RecO [Thalassiobium sp. R2A62]
          Length = 242

 Score =  181 bits (460), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 78/239 (32%), Positives = 118/239 (49%), Gaps = 3/239 (1%)

Query: 2   YWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSR 61
            W+D+  +L VR +GE   I+E+ T ++GRH G VR G S ++ PILQ G  + V W++R
Sbjct: 3   QWRDEGALLSVRRHGESAAIVEIFTAEHGRHAGIVRGGTSRKIAPILQPGAQLDVVWKAR 62

Query: 62  LAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREP-CLELYDMLNIFLNC 120
           L ++LG F  E + S  A ++S  L L GL ++  L  F          LY    + ++ 
Sbjct: 63  LEEHLGSFSVEPVRSRAAAVMSDRLALAGLNAVCALLAFAMPEREAHPSLYRQSTVLMDL 122

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
                     +++ EL LL+ +GFGLDL  C VTG  + L +VSPKSG AV       +A
Sbjct: 123 LGNTDAWPLAYLRWELALLEELGFGLDLGSCAVTGSVEGLCYVSPKSGRAVSAEGAGEWA 182

Query: 181 EKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNI-IHCHLLRENFLGKLLE 238
           +++L LP  L       DA  +    + T YFL  +  +          R   +  L+ 
Sbjct: 183 DRLLPLPDVLLGVGSAPDA-EILQGLETTGYFLEHWLARALGDRPVPDARGRMVDALVR 240


>gi|221641177|ref|YP_002527439.1| DNA repair protein RecO [Rhodobacter sphaeroides KD131]
 gi|332560104|ref|ZP_08414426.1| DNA repair protein RecO [Rhodobacter sphaeroides WS8N]
 gi|254764657|sp|B9KSB0|RECO_RHOSK RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|221161958|gb|ACM02938.1| DNA repair protein recO [Rhodobacter sphaeroides KD131]
 gi|332277816|gb|EGJ23131.1| DNA repair protein RecO [Rhodobacter sphaeroides WS8N]
          Length = 239

 Score =  181 bits (460), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 81/241 (33%), Positives = 120/241 (49%), Gaps = 5/241 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D+  +L VR +GE + I+EV T  +GRH G VR G S ++ PILQ G  + + W++
Sbjct: 2   MEWRDEGALLSVRRHGESSAIIEVFTAAHGRHAGVVRGGASRKIAPILQPGAQLDLTWKA 61

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL +++G F  E L S  A L               L   LPEREP   L+      L+ 
Sbjct: 62  RLDEHMGAFTVEPLRSRTALLGDRLGLAGLNAICAMLHVTLPEREPHSTLWQESMALLDA 121

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P      +++ E+ LL+  GFGLDLT+C VTG  +DL +VSPK+G AV R     +A
Sbjct: 122 LDRP-GWPPAYLRWEMRLLEETGFGLDLTRCAVTGSREDLAFVSPKTGRAVSRGAAGGWA 180

Query: 181 EKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQH--NIIHCHLLRENFLGKLLE 238
           +++  LP  L  +     A+ ++    +T +FL +  L    N       R   +  L  
Sbjct: 181 DRLFPLPLALLGQG-PASAEEVRQGLAITGHFLGRE-LAPLLNGRPMPEARARLMELLAR 238

Query: 239 L 239
            
Sbjct: 239 A 239


>gi|84515166|ref|ZP_01002529.1| DNA repair protein RecO [Loktanella vestfoldensis SKA53]
 gi|84511325|gb|EAQ07779.1| DNA repair protein RecO [Loktanella vestfoldensis SKA53]
          Length = 243

 Score =  181 bits (460), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 81/242 (33%), Positives = 124/242 (51%), Gaps = 4/242 (1%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWR 59
           M  W+DDA IL +R +GE + I+EV +  +GRH G VR G S ++ P++Q G  V V W 
Sbjct: 1   MISWRDDAAILAMRPFGESSAIIEVFSANHGRHAGVVRGGASRKIAPLIQPGAQVNVAWA 60

Query: 60  SRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFL 118
           +RL  +LG F  E + S  A  ++  L L GL ++  L    LPERE    LY      L
Sbjct: 61  ARLDDHLGSFTVEPVRSRNAAAMADRLSLAGLNAVCALLLMVLPERESHPLLYQRSIALL 120

Query: 119 NCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
           +     +V    +++ E  LL+ +GFGLDL+ C  +GV +DL +VSPKSG AV R     
Sbjct: 121 DLLDQRAVWPLAYLRWEQALLEEMGFGLDLSACAASGVNEDLAFVSPKSGRAVSRDAAGV 180

Query: 179 YAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQ-HNIIHCHLLRENFLGKLL 237
           +A+++L LP  L  +        +  A   T +F+    ++     +    R   +  ++
Sbjct: 181 WADRLLPLPPVLAGKGDA-SGVEIAKALGTTGFFIENRLIKGLGDRNVPAARARLIDAIM 239

Query: 238 EL 239
             
Sbjct: 240 RA 241


>gi|150395917|ref|YP_001326384.1| DNA repair protein RecO [Sinorhizobium medicae WSM419]
 gi|166221910|sp|A6U7B9|RECO_SINMW RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|150027432|gb|ABR59549.1| DNA repair protein RecO [Sinorhizobium medicae WSM419]
          Length = 249

 Score =  181 bits (459), Expect = 7e-44,   Method: Composition-based stats.
 Identities = 111/240 (46%), Positives = 164/240 (68%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W D AIILG+R +GE ++I EVMT  +GRHLG VR+G+S  MQP+LQ GN V V WR+
Sbjct: 1   MQWSDQAIILGIRRHGESSVIAEVMTPGHGRHLGLVRSGRSRAMQPVLQPGNSVEVVWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LGEFR E L+   A+L+ ++  +YG+Q++  L R LPER+P   LY+ L + ++ 
Sbjct: 61  RLDEHLGEFRVEPLQLRAARLIETATSVYGIQALGSLLRLLPERDPHPHLYEALAVIVDH 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
            + P+  G++FV+ EL +L ++GFGLDL++C  TG   +L++VSPKSG A+CR  G PYA
Sbjct: 121 LQDPADAGELFVRFELAVLNDLGFGLDLSRCGATGARSELVYVSPKSGRAICREAGAPYA 180

Query: 181 EKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLELI 240
           E+ML LP FL  + +  D +SL +AF+LT YFLN++  +   +     R+ F+   L+ +
Sbjct: 181 ERMLALPDFLSGQNRAADHESLAAAFRLTAYFLNRHVYEPRGVDAASARDGFVHATLKAL 240


>gi|319408285|emb|CBI81938.1| DNA repair protein RecO [Bartonella schoenbuchensis R1]
          Length = 248

 Score =  181 bits (459), Expect = 7e-44,   Method: Composition-based stats.
 Identities = 99/239 (41%), Positives = 149/239 (62%), Gaps = 1/239 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W++ AIILG R +GE ++ILE+MTRQ+GR++G V+ G+S  M  +LQ GN V   W +
Sbjct: 1   MRWKEQAIILGTRQHGETSVILEIMTRQHGRYMGMVKGGRSRSMAALLQPGNFVEAEWWA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG F+ E L+ H ++L+     LY LQ +    R LPER+P   LYDML+IF+  
Sbjct: 61  RLDEHLGLFKLEALDLHASRLMLIPEALYTLQLMASHLRLLPERDPHPILYDMLHIFMQN 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
                VI ++ ++ E+ LLK +GFGLDL+ CVVTG  ++L +VSPKSG AV    G  + 
Sbjct: 121 FDEWFVIAELLIRFEMRLLKELGFGLDLSCCVVTGCRENLHYVSPKSGRAVSEEAGYLWR 180

Query: 181 EKMLVLPSFLWKE-EQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLE 238
           +K+L LP FL +   + ID + +++ F LT++FL ++  +   I    +R N +     
Sbjct: 181 DKLLPLPQFLIQRASRPIDFNDMRNGFALTNFFLTRHVWEPRRIQQPSVRVNLINLFER 239


>gi|119370511|sp|Q3J5V8|RECO_RHOS4 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
          Length = 238

 Score =  181 bits (459), Expect = 7e-44,   Method: Composition-based stats.
 Identities = 80/241 (33%), Positives = 120/241 (49%), Gaps = 5/241 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D+  +L VR +GE + I+EV T  +GRH G VR G S ++ PILQ G  + + W++
Sbjct: 1   MEWRDEGALLSVRRHGESSAIIEVFTAAHGRHAGVVRGGASRKIAPILQPGAQLDLTWKA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL +++G F  E L S  A L               L   LPEREP   L+    + L+ 
Sbjct: 61  RLDEHMGAFTVEPLRSRTALLGDRLGLAGLNAICAMLHVTLPEREPHSTLWQESMVLLDA 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P      +++ E+ LL+  GFGLDLT+C VTG  +DL +VSPK+G AV       +A
Sbjct: 121 LDRP-GWPPAYLRWEMRLLEETGFGLDLTRCAVTGSREDLAFVSPKTGRAVSSGAAGGWA 179

Query: 181 EKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQH--NIIHCHLLRENFLGKLLE 238
           +++  LP  L  +     A+ ++    +T +FL +  L    N       R   +  L  
Sbjct: 180 DRLFPLPLALLGQG-PASAEEVRQGLAITGHFLGRE-LAPLLNGRPLPEARARLMELLAR 237

Query: 239 L 239
            
Sbjct: 238 A 238


>gi|77462223|ref|YP_351727.1| DNA repair protein RecO [Rhodobacter sphaeroides 2.4.1]
 gi|77386641|gb|ABA77826.1| putative RecO protein [Rhodobacter sphaeroides 2.4.1]
          Length = 239

 Score =  181 bits (459), Expect = 7e-44,   Method: Composition-based stats.
 Identities = 80/241 (33%), Positives = 120/241 (49%), Gaps = 5/241 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D+  +L VR +GE + I+EV T  +GRH G VR G S ++ PILQ G  + + W++
Sbjct: 2   MEWRDEGALLSVRRHGESSAIIEVFTAAHGRHAGVVRGGASRKIAPILQPGAQLDLTWKA 61

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL +++G F  E L S  A L               L   LPEREP   L+    + L+ 
Sbjct: 62  RLDEHMGAFTVEPLRSRTALLGDRLGLAGLNAICAMLHVTLPEREPHSTLWQESMVLLDA 121

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P      +++ E+ LL+  GFGLDLT+C VTG  +DL +VSPK+G AV       +A
Sbjct: 122 LDRP-GWPPAYLRWEMRLLEETGFGLDLTRCAVTGSREDLAFVSPKTGRAVSSGAAGGWA 180

Query: 181 EKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQH--NIIHCHLLRENFLGKLLE 238
           +++  LP  L  +     A+ ++    +T +FL +  L    N       R   +  L  
Sbjct: 181 DRLFPLPLALLGQG-PASAEEVRQGLAITGHFLGRE-LAPLLNGRPLPEARARLMELLAR 238

Query: 239 L 239
            
Sbjct: 239 A 239


>gi|84684348|ref|ZP_01012249.1| DNA repair protein RecO [Maritimibacter alkaliphilus HTCC2654]
 gi|84667327|gb|EAQ13796.1| DNA repair protein RecO [Rhodobacterales bacterium HTCC2654]
          Length = 246

 Score =  181 bits (458), Expect = 8e-44,   Method: Composition-based stats.
 Identities = 86/241 (35%), Positives = 125/241 (51%), Gaps = 5/241 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D   +L VR +GE ++I+EV T ++GRH G VR G S ++ PILQ G+ + + WR+
Sbjct: 4   MEWRDQGTLLSVRKHGETSVIIEVFTAEHGRHAGVVRGGVSRKIAPILQPGSQLDLVWRA 63

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLN 119
           RL +++G F  E ++S  A ++     L GL +I  L  F LPERE    LY      L+
Sbjct: 64  RLEEHIGAFTVEPVKSRAAAIMGDRNALAGLNAITALLSFALPEREAHPRLYTRSIAMLD 123

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                      ++Q EL LL+ +G+GLDLT C VTG  +DL +VSPKSG AV       +
Sbjct: 124 LLAETPAWPVGYLQWELALLEELGYGLDLTACAVTGGAEDLAYVSPKSGRAVSAEGAGEW 183

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQH--NIIHCHLLRENFLGKLL 237
            +++L LP        T D   +    + T YFL  + L H          R   + +L 
Sbjct: 184 VDRLLPLPEE-LLGVVTQDLAGIPDGLRTTGYFLT-HGLAHALGDRPLPEARARLVDRLS 241

Query: 238 E 238
            
Sbjct: 242 R 242


>gi|163850484|ref|YP_001638527.1| DNA repair protein RecO [Methylobacterium extorquens PA1]
 gi|240137548|ref|YP_002962019.1| DNA repair protein RecO [Methylobacterium extorquens AM1]
 gi|238687373|sp|A9W1K0|RECO_METEP RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|163662089|gb|ABY29456.1| DNA repair protein RecO [Methylobacterium extorquens PA1]
 gi|240007516|gb|ACS38742.1| DNA repair protein RecO [Methylobacterium extorquens AM1]
          Length = 246

 Score =  181 bits (458), Expect = 9e-44,   Method: Composition-based stats.
 Identities = 95/239 (39%), Positives = 138/239 (57%), Gaps = 6/239 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W DD +++G+R +GE  ++LE+MT ++GRHLG V  G+S RMQP+LQ GN +R  WR+
Sbjct: 1   MQWIDDGLVIGLRKHGETGVVLELMTPEHGRHLGLVHGGRSRRMQPMLQPGNTLRATWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL   LG +  E L  + ++L+ S L LYG+  +  L R LPER+P   LY+   I +  
Sbjct: 61  RLDGALGAYAVEPLTLNASRLMDSGLALYGVAHLSALLRLLPERDPHPALYEAAQILIAH 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P +   + V+ EL LL  +GFGLDL+ C  TG    L++VSPKSG AV  S G P+ 
Sbjct: 121 LDDPEIAPALMVRFELALLAGLGFGLDLSHCAATGANDALVYVSPKSGRAVSASAGEPFR 180

Query: 181 EKMLVLPSFLWKEEQT------IDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFL 233
           +++L LP FL   +Q        D   ++  F LT YFL+++  +         R  F+
Sbjct: 181 DRLLPLPPFLRDRDQPGSGWRTPDTHDVREGFTLTGYFLDQHVWRPRAQDTPEERARFV 239


>gi|218529181|ref|YP_002419997.1| DNA repair protein RecO [Methylobacterium chloromethanicum CM4]
 gi|254764643|sp|B7KPI6|RECO_METC4 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|218521484|gb|ACK82069.1| DNA repair protein RecO [Methylobacterium chloromethanicum CM4]
          Length = 246

 Score =  181 bits (458), Expect = 9e-44,   Method: Composition-based stats.
 Identities = 95/239 (39%), Positives = 138/239 (57%), Gaps = 6/239 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W DD +++G+R +GE  ++LE+MT ++GRHLG V  G+S RMQP+LQ GN +R  WR+
Sbjct: 1   MQWIDDGLVIGLRKHGETGVVLELMTPEHGRHLGLVHGGRSRRMQPMLQPGNTLRATWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL   LG +  E L  + ++L+ S L LYG+  +  L R LPER+P   LY+   I +  
Sbjct: 61  RLDGALGAYAVEPLTLNASRLMDSGLALYGVAHLSALLRLLPERDPHPALYEAAQILIAH 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P +   + V+ EL LL  +GFGLDL+ C  TG    L++VSPKSG AV  S G P+ 
Sbjct: 121 LDDPEIAPALMVRFELALLAGLGFGLDLSHCAATGANDALVYVSPKSGRAVSASAGEPFR 180

Query: 181 EKMLVLPSFLWKEEQT------IDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFL 233
           +++L LP FL   +Q        D   ++  F LT YFL+++  +         R  F+
Sbjct: 181 DRLLPLPPFLRDRDQPGSGWRTPDTQDVREGFTLTGYFLDQHVWRPRAQDTPEERARFV 239


>gi|83858198|ref|ZP_00951720.1| DNA repair protein RecO [Oceanicaulis alexandrii HTCC2633]
 gi|83853021|gb|EAP90873.1| DNA repair protein RecO [Oceanicaulis alexandrii HTCC2633]
          Length = 242

 Score =  181 bits (458), Expect = 9e-44,   Method: Composition-based stats.
 Identities = 83/238 (34%), Positives = 127/238 (53%), Gaps = 2/238 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W     I+ VR +GE + ++EV+T ++GRH G VR G+S  M+PILQ GN +R  WR+
Sbjct: 1   MEWTASGRIVAVRPHGETSAVIEVLTAEHGRHAGLVRGGRSKAMRPILQPGNRIRAVWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFR-FLPEREPCLELYDMLNIFLN 119
           RL  +LG F  E  +     L+   L L GL +   +    LPERE    + D   + ++
Sbjct: 61  RLESHLGGFAVEAEDLSAGVLMEDPLALSGLNAACAMASICLPEREEHPAVADAFEVLIS 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
             + P +   ++V+ E  LL ++G+GLDL +C  TGV   L++VSPKSG AV    G PY
Sbjct: 121 ALEDPDLWPALYVRWEAGLLADLGYGLDLRRCAATGVETGLVYVSPKSGRAVSAEAGEPY 180

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLL 237
            ++ML LP F+ K    +    + +  +LT +F+ +  L          R   + +L 
Sbjct: 181 RDRMLALPGFM-KGGGQVSEGDVGAGLKLTAHFIERRVLWPADRMLPDARTRMIERLE 237


>gi|89070889|ref|ZP_01158124.1| DNA repair protein RecO, putative [Oceanicola granulosus HTCC2516]
 gi|89043528|gb|EAR49739.1| DNA repair protein RecO, putative [Oceanicola granulosus HTCC2516]
          Length = 239

 Score =  180 bits (457), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 85/241 (35%), Positives = 121/241 (50%), Gaps = 5/241 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D  ++L  R +GE  +I EV T   GRH G VR G+S ++ P+LQ G  V V W +
Sbjct: 1   MQWRDGGVLLARRGHGESGVIAEVFTETRGRHAGLVRGGRSKQLAPVLQPGEQVEVTWTA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLN 119
           RL ++LG +R E L S  A +++  L L GL +I  L  F LPEREP   LY      L+
Sbjct: 61  RLEEHLGAYRVEPLRSRAALVMNDRLALAGLNAICGLLAFALPEREPHPALYARSVTLLD 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                      ++  EL LL+ +GFGLDL+ C VTG    L +VSP++G AV  +    +
Sbjct: 121 LLGRTDAWPLAYLHWELALLEELGFGLDLSSCAVTGAEDGLAFVSPRTGRAVSAAGAGEW 180

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQH--NIIHCHLLRENFLGKLL 237
           A ++L LP  L  +    DA  +    + T +FL  + L            R   +  L 
Sbjct: 181 AGRLLPLPPALRGQGPGPDA-EILEGLRTTGHFLATW-LAPALGDRPLPEARARLVALLS 238

Query: 238 E 238
            
Sbjct: 239 R 239


>gi|254560020|ref|YP_003067115.1| DNA repair protein RecO [Methylobacterium extorquens DM4]
 gi|254267298|emb|CAX23130.1| DNA repair protein RecO [Methylobacterium extorquens DM4]
          Length = 246

 Score =  180 bits (457), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 96/239 (40%), Positives = 139/239 (58%), Gaps = 6/239 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W DD +++G+R +GE  ++LE+MT ++GRHLG V  G+S RMQP+LQ GN +R  WR+
Sbjct: 1   MQWIDDGLVIGLRKHGETGVVLELMTPEHGRHLGLVHGGRSRRMQPMLQPGNTLRATWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL   LG +  E L  + ++L+ S L LYG+  +  L R LPER+P   LY+   I +  
Sbjct: 61  RLDGALGAYAVEPLTLNASRLMDSGLALYGVAHLSALLRLLPERDPHPALYEAAQILIAH 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P +   + V+ EL LL  +GFGLDL+ C  TG    L++VSPKSG AV  S G P+ 
Sbjct: 121 LDDPEIAPALMVRFELALLAGLGFGLDLSHCAATGANDALVYVSPKSGRAVSASAGEPFR 180

Query: 181 EKMLVLPSFLWKEEQ------TIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFL 233
           +++L LP FL   +Q      T D   ++  F LT YFL+++  +         R  F+
Sbjct: 181 DRLLPLPPFLRDRDQSGSGWRTPDTHDVREGFTLTGYFLDQHVWRPRAQDTPEERARFV 239


>gi|163793044|ref|ZP_02187020.1| GTP-binding protein Era [alpha proteobacterium BAL199]
 gi|159181690|gb|EDP66202.1| GTP-binding protein Era [alpha proteobacterium BAL199]
          Length = 253

 Score =  180 bits (457), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 80/240 (33%), Positives = 126/240 (52%), Gaps = 5/240 (2%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRL 62
           W D+ I+L  +++GE + I+ ++TR +GRH G VR   S R + + Q GN V   WR+RL
Sbjct: 4   WTDEGIVLAAKAHGEGSAIVVLLTRDHGRHAGLVRGAFSGRARGVYQPGNRVTAEWRARL 63

Query: 63  AQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFR-FLPEREPCLELYDMLNIFLNCH 121
           A +LG +  E+   H A +L   L L GL +   +    LPEREP  +++D L   L+  
Sbjct: 64  ADHLGNYTCELGHGHAAAVLDDPLKLAGLSAACAIAEASLPEREPHPQVHDGLVALLDAM 123

Query: 122 KIP---SVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
             P        ++V+ E+ +L ++G+GLDL  C  TG   DL +VSP++G AV  + G P
Sbjct: 124 AEPELGDAWIAVYVRWEIGVLADLGYGLDLESCAATGANDDLAYVSPRTGRAVSLAAGEP 183

Query: 179 YAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLE 238
           Y +++L LP FL       D D L     L+ +F+ ++    +       R  F+ +   
Sbjct: 184 YRDRLLSLPRFLIGRGGG-DQDDLFRGLALSGFFMERHVFATHGRQPPPARTRFVERFAR 242


>gi|84500557|ref|ZP_00998806.1| DNA repair protein RecO [Oceanicola batsensis HTCC2597]
 gi|84391510|gb|EAQ03842.1| DNA repair protein RecO [Oceanicola batsensis HTCC2597]
          Length = 241

 Score =  180 bits (456), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 81/239 (33%), Positives = 132/239 (55%), Gaps = 5/239 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D  I+L VR +GE   I +V T   GRH G VR   S ++ P+LQ G  + ++W++
Sbjct: 1   MEWRDQGILLAVRRHGESAAIADVFTPGRGRHAGVVRGATSRKLAPVLQPGAQLDISWKA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLN 119
           RL ++LG F  E + S  A++L   L L GL ++  L  F LPERE    LY      L+
Sbjct: 61  RLEEHLGHFTVEPVRSRAAQILGDRLALAGLNAVTALLCFALPEREAHEALYRRTETLLD 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                 +    ++  EL LL+++G+GLDLT+C VTG  + L ++SP++G AV  +    +
Sbjct: 121 LLGQMDLWPLAYLHWELALLEDLGYGLDLTECAVTGAREGLDYISPRTGRAVTAAGAGDW 180

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQH--NIIHCHLLRENFLGKL 236
           A+++L LP  L ++ +  D + + S F++T +FL ++ L            R+ F+ + 
Sbjct: 181 ADRLLPLPPCLLRQGEAPD-EEILSGFRVTGHFLAEH-LAPELGQKPIPEARQRFVDRF 237


>gi|182679932|ref|YP_001834078.1| DNA repair protein RecO [Beijerinckia indica subsp. indica ATCC
           9039]
 gi|238691211|sp|B2IBG3|RECO_BEII9 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|182635815|gb|ACB96589.1| DNA repair protein RecO [Beijerinckia indica subsp. indica ATCC
           9039]
          Length = 250

 Score =  180 bits (456), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 92/235 (39%), Positives = 126/235 (53%), Gaps = 2/235 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W D+ +I+G+R YGE   ILEV T  +GRH G VR G   R++ +LQ GN     WR+
Sbjct: 1   MEWHDEGLIIGLRRYGETGAILEVFTPAHGRHFGLVRGGFGRRLRALLQPGNQADFTWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL Q LG    E  +    +L +S L L G+  I  L R LPER+P  ELY ++ + L  
Sbjct: 61  RLDQQLGLLAVEPTKLMTTRLFASGLALQGMNLIAALLRLLPERDPHPELYAVVRVLLEH 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P+V   +  + EL +L   GFGLDL+ C  TG TQ+L++VSPKSG AV    G PY 
Sbjct: 121 LDEPAVAPILLARFELAMLTETGFGLDLSACAATGATQELIYVSPKSGRAVSARAGAPYH 180

Query: 181 EKMLVLPSFLWKEE--QTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFL 233
           +K+L LP F       +    + +++ F LT +FL +             R  FL
Sbjct: 181 DKLLGLPPFFLDGSLLKNPTLEEVEAGFALTGHFLMRDLFGPRGQTLPDARHAFL 235


>gi|114570118|ref|YP_756798.1| DNA repair protein RecO [Maricaulis maris MCS10]
 gi|114340580|gb|ABI65860.1| DNA repair protein RecO [Maricaulis maris MCS10]
          Length = 234

 Score =  179 bits (453), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 85/231 (36%), Positives = 126/231 (54%), Gaps = 2/231 (0%)

Query: 10  LGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQNLGEF 69
           L VR +GE + I+EV+T + GRH G VR  +S  M+PILQ GN + VNWR+RL+++LG F
Sbjct: 2   LAVRPHGETSAIVEVLTAEQGRHAGLVRGARSRSMRPILQPGNQITVNWRARLSEHLGMF 61

Query: 70  RFEVLESHCAKLLSSSLFLYGLQSIV-PLFRFLPEREPCLELYDMLNIFLNCHKIPSVIG 128
           + E  +     ++     L GL S        LPERE    ++    + L     P +  
Sbjct: 62  QIEADDLTAGMVMEDRTALAGLNSACAIAVMGLPEREAHPRVHQGFQLLLGAFDNPDIWP 121

Query: 129 KIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKMLVLPS 188
            ++V+ E  LL ++G+GLD++ C VTGVT+DL  +SP++G AVCR    PYA K+L LP 
Sbjct: 122 ALYVRWEAGLLSDLGYGLDMSACAVTGVTEDLTHISPRTGRAVCREEAAPYAPKLLELPP 181

Query: 189 FLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLEL 239
           F+      I+A  +     LT YFL +  L          R   + +L ++
Sbjct: 182 FMAGSG-KIEAGDIARGLALTGYFLERRVLWPIDKQLPEARGRLMAELEQV 231


>gi|15888381|ref|NP_354062.1| DNA repair protein RecO [Agrobacterium tumefaciens str. C58]
 gi|42559508|sp|Q8UGJ8|RECO_AGRT5 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|15156061|gb|AAK86847.1| DNA repair protein RecO [Agrobacterium tumefaciens str. C58]
          Length = 254

 Score =  178 bits (452), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 112/241 (46%), Positives = 167/241 (69%), Gaps = 1/241 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M WQD+AIILGV+ +GE ++I EVMT   GRHLG VR+G+S  MQP+LQAGN V V WR+
Sbjct: 1   MQWQDEAIILGVKRHGETSVIAEVMTPSRGRHLGMVRSGRSRTMQPVLQAGNRVDVIWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL  +LGEFR E L+    +L+ ++  +YG+Q++  L R LPER+P   LY  L++ L+ 
Sbjct: 61  RLHDHLGEFRIEPLQLRAGQLMETATAVYGVQAMGALLRLLPERDPHPHLYQALDVILDN 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P   G++FV+ EL +L ++GFGLDL++C  TG+  DL++VSPK+G AVCR+ G PYA
Sbjct: 121 LHDPVDAGELFVRFELAVLNDLGFGLDLSECAATGLRSDLIYVSPKTGRAVCRTAGAPYA 180

Query: 181 EKMLVLPSFLWKEE-QTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLEL 239
            +ML LP+FL + + +  D +SL +AF+LTD+FL+++      ++ +  R+ F+   L+ 
Sbjct: 181 ARMLALPAFLGEGQSKAADPESLAAAFRLTDHFLHRHVYDPRGLNENAARDGFVQAALKA 240

Query: 240 I 240
           +
Sbjct: 241 L 241


>gi|159042759|ref|YP_001531553.1| DNA repair protein RecO [Dinoroseobacter shibae DFL 12]
 gi|254790521|sp|A8LLE2|RECO_DINSH RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|157910519|gb|ABV91952.1| DNA repair protein RecO [Dinoroseobacter shibae DFL 12]
          Length = 241

 Score =  178 bits (452), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 76/243 (31%), Positives = 119/243 (48%), Gaps = 7/243 (2%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWR 59
           M  W+++ ++L VR +GE ++I+E  TR +GRHLG VR G S ++ P+LQ G  + + W+
Sbjct: 1   MIEWREEGVLLSVRPHGETSVIVEAFTRAHGRHLGVVRGGVSRKLAPVLQPGAQLDLRWK 60

Query: 60  SRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFL 118
           +RL  ++G F  E +    A +L   L L  + S + L RF L ER      YD     L
Sbjct: 61  ARLEDHMGAFTVEPVRGRAAAVLGDRLALSAMSSALALARFSLAERAAYPGFYDQTVALL 120

Query: 119 NCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
           +     +     ++  E+ LL  +GFGLDL+ C V GV +DL +VSP++G AV R     
Sbjct: 121 DALAEGTGWLPAYLDWEMALLDQMGFGLDLSGCAVRGVNEDLAFVSPRTGRAVSRQAAGA 180

Query: 179 YAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQH--NIIHCHLLRENFLGKL 236
           + +++L LP  +           +      T +FL  + L            R  F+  L
Sbjct: 181 WVDRLLPLPEVML--GGPAHLHGVLEGLTTTGHFLE-HKLAPALGNRPPPEARARFIDVL 237

Query: 237 LEL 239
              
Sbjct: 238 SRA 240


>gi|126733738|ref|ZP_01749485.1| DNA repair protein RecO [Roseobacter sp. CCS2]
 gi|126716604|gb|EBA13468.1| DNA repair protein RecO [Roseobacter sp. CCS2]
          Length = 244

 Score =  178 bits (450), Expect = 7e-43,   Method: Composition-based stats.
 Identities = 80/242 (33%), Positives = 121/242 (50%), Gaps = 4/242 (1%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWR 59
           M  W+ +A +L  R +GE  +I+EV +  +GRH G VR G S ++ P+LQ G  + V W+
Sbjct: 1   MIEWRSEAALLSSRPFGENGVIIEVFSALHGRHAGVVRGGASRKLAPVLQPGAQLSVAWK 60

Query: 60  SRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFL 118
           +RL  +LG F  E + S  A  +   L L GL ++  L    LPERE    LY+     L
Sbjct: 61  ARLESHLGSFAVEPIRSRAAAAMGDRLALAGLNAVCSLLAMVLPEREAHEPLYERTIALL 120

Query: 119 NCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
           +      V    +++ E  LL+ +GF +DL+ C V GV +DL++VSPKSG AV R     
Sbjct: 121 DLLGQQDVWPLAYLRWEQALLEEMGFAMDLSACAVRGVNEDLIYVSPKSGRAVSREAAGE 180

Query: 179 YAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQ-HNIIHCHLLRENFLGKLL 237
           +A++ML LP  L  +        +  A   T YF+    ++          R   L  ++
Sbjct: 181 WADRMLPLPEVLTGKGDA-SNAQIAKALGTTGYFIEHRLIKGLGDRPMPAARTRLLDAIM 239

Query: 238 EL 239
             
Sbjct: 240 RA 241


>gi|154247809|ref|YP_001418767.1| DNA repair protein RecO [Xanthobacter autotrophicus Py2]
 gi|238686793|sp|A7IM67|RECO_XANP2 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|154161894|gb|ABS69110.1| DNA repair protein RecO [Xanthobacter autotrophicus Py2]
          Length = 242

 Score =  178 bits (450), Expect = 8e-43,   Method: Composition-based stats.
 Identities = 89/240 (37%), Positives = 128/240 (53%), Gaps = 1/240 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W D+ I+LGVR +GE N I+E++TR  GRHLG VR G S R  P+LQ GN V   WR+
Sbjct: 1   MEWTDEGIVLGVRRHGEGNAIVELLTRLRGRHLGMVRGGASRRQAPLLQPGNTVSATWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL +++G +  E        L+ +    +G   +  +   LPER+P   L+  +   L+ 
Sbjct: 61  RLDEHMGNYALEPAVVRTEVLMRAPHAAFGFTHMAQILHLLPERDPHEGLFLTVGAILDA 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
            +     G++  + EL LL  +GFGL+L  C  TG  +DL++VSPKSG AVC   G PYA
Sbjct: 121 FENRESAGRLLARFELALLAELGFGLELETCAATGRREDLVYVSPKSGRAVCGEAGAPYA 180

Query: 181 EKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLELI 240
           +++  LP FL        A  ++ A +LT YFL    L+   +     R  F+      I
Sbjct: 181 DRLFALPRFLVDGTAPP-AGDVEDALRLTGYFLLTRVLEPRGLGLSDARAAFISAWRRSI 239


>gi|328543511|ref|YP_004303620.1| DNA repair protein recO [polymorphum gilvum SL003B-26A1]
 gi|326413255|gb|ADZ70318.1| DNA repair protein recO [Polymorphum gilvum SL003B-26A1]
          Length = 253

 Score =  177 bits (449), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 108/242 (44%), Positives = 142/242 (58%), Gaps = 4/242 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W +D IILG RS+GE  ++LE+MTR+ GRHLG VR G+S R QP+LQ GNLVR  WR+
Sbjct: 1   MEWSEDGIILGTRSHGESGVVLELMTRRRGRHLGLVRGGRSRRQQPVLQPGNLVRATWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           R+A  LG F  E L+     L+ S+L L+ LQ +  L R LPER+    LYD L I L+ 
Sbjct: 61  RIADQLGAFTVEPLQLRAGALMDSALALHALQHLAGLLRLLPERDAHERLYDALTIVLDH 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
                + G + V+ EL LL  +GFGLDLT+C  TG   DL +VSPKSG AV R  G PY 
Sbjct: 121 LGEAMIAGPLIVRFELELLNELGFGLDLTRCAATGQLWDLAYVSPKSGRAVSRDAGAPYR 180

Query: 181 EKMLVLPSFLWKE----EQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKL 236
           +++L LPSFL +        I    +    +LT +FL ++ L+       L RE  +  L
Sbjct: 181 DQLLPLPSFLVEGERQPGSEITFADISQGLRLTAFFLARHVLEPQGHAPSLSREELVKAL 240

Query: 237 LE 238
             
Sbjct: 241 ER 242


>gi|197105330|ref|YP_002130707.1| recombinational DNA repair protein (RecF pathway) [Phenylobacterium
           zucineum HLK1]
 gi|254764651|sp|B4RCU1|RECO_PHEZH RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|196478750|gb|ACG78278.1| recombinational DNA repair protein (RecF pathway) [Phenylobacterium
           zucineum HLK1]
          Length = 243

 Score =  177 bits (448), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 78/240 (32%), Positives = 119/240 (49%), Gaps = 1/240 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M ++DDA +L  R++GE   I+E++T  +GR+   V  G S +++P LQ G  V   +R+
Sbjct: 1   MEFEDDAFVLAARAHGETGAIVELLTSAHGRYAAHVAGGASRKVRPFLQPGARVIARYRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPERE-PCLELYDMLNIFLN 119
           R++  LG    E +    A L    L L GL +   +         P    +        
Sbjct: 61  RVSDQLGSAAIEPVGEGPAALFDDPLALSGLSAAAAVAAGALPEREPHPGAFLAFEALTG 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
               P V   +FV+ E  LL+++GFGLDL+KC  TG+T DL+WVSP++G AV R  G PY
Sbjct: 121 ALTHPDVWPAVFVRFEAGLLQDLGFGLDLSKCAATGITDDLVWVSPRTGRAVSRQAGEPY 180

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLEL 239
            +++L LP FL   +  + A  + +   LT +FL  +            R   L +L E 
Sbjct: 181 KDRLLALPPFLLSAQGGLRAGDVAAGLALTGHFLEAFIFGPLNRPLPPARLWLLDRLSEA 240


>gi|217979938|ref|YP_002364085.1| DNA repair protein RecO [Methylocella silvestris BL2]
 gi|254764645|sp|B8EMP4|RECO_METSB RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|217505314|gb|ACK52723.1| DNA repair protein RecO [Methylocella silvestris BL2]
          Length = 247

 Score =  176 bits (447), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 88/232 (37%), Positives = 130/232 (56%), Gaps = 3/232 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D+ +I+GVR YGE ++ILE MTR +GRHLG VR G+S RM+ +LQ GN   + WR+
Sbjct: 1   MEWRDEGLIIGVRQYGEASVILEAMTRGHGRHLGLVRGGRSQRMRAVLQPGNSAELVWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL + LG +  E  +   A L++S+  L+ +  I  L R + ER+P  +LY+   +    
Sbjct: 61  RLDEQLGTWAIEPTQLRAATLMASAEALHAVGLICALLRLIAERDPHPDLYETAVLIAGH 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
                +   + V++E+ +L+  GFGLDL++C  TG  +DL +VSPKSG AV  + G PY 
Sbjct: 121 IGDERLAP-LLVRLEIEILRETGFGLDLSRCAATGAREDLAYVSPKSGRAVSLAAGAPYR 179

Query: 181 EKMLVLPSFLWKE--EQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRE 230
           E++L LP FL  E          +   F LT +FL +             R 
Sbjct: 180 ERLLPLPPFLRDEAPGGEPTPQDVLDGFGLTGFFLKRDVFTPRGQGMPEARR 231


>gi|170748446|ref|YP_001754706.1| DNA repair protein RecO [Methylobacterium radiotolerans JCM 2831]
 gi|170654968|gb|ACB24023.1| DNA repair protein RecO [Methylobacterium radiotolerans JCM 2831]
          Length = 239

 Score =  176 bits (447), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 103/233 (44%), Positives = 140/233 (60%), Gaps = 1/233 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W DDA++LG+R +GE  +ILE MT  +GRHLG V  G+S RMQP+LQAGN VR+ WR+
Sbjct: 1   MQWTDDALVLGLRRHGETGVILEAMTEAHGRHLGLVHGGRSRRMQPVLQAGNRVRLTWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL + LG +  E L+S  ++L+ SSL LYG+  +  L R LPER+P   LY+   I +  
Sbjct: 61  RLDEGLGSYAVEPLDSQVSRLIGSSLALYGMNHMAALLRLLPERDPHPALYEAAGILVEH 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P+V   + V+ EL +L  +GFGLDLT C  TG    L +VSPKSG AV  S G PY 
Sbjct: 121 LDDPAVAPPLMVRFELAILSELGFGLDLTACAATGGNDALAYVSPKSGRAVSASAGEPYR 180

Query: 181 EKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFL 233
           +++L LP+FL         D +   F LT YFL+++      +     R  F+
Sbjct: 181 DRLLALPTFLHAGGSPG-PDGVAQGFTLTGYFLDRHVWGPRGLGPPEERARFV 232


>gi|83951646|ref|ZP_00960378.1| DNA repair protein RecO [Roseovarius nubinhibens ISM]
 gi|83836652|gb|EAP75949.1| DNA repair protein RecO [Roseovarius nubinhibens ISM]
          Length = 257

 Score =  176 bits (445), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 76/242 (31%), Positives = 128/242 (52%), Gaps = 5/242 (2%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWR 59
           M  W+D  ++L VR +GE ++I++V+T+ +GR+ G VR G S +++P+LQ G  + + WR
Sbjct: 1   MIEWRDRGLLLAVRPHGETSVIIDVLTQDHGRYAGVVRGGTSRKLRPVLQPGAELDLVWR 60

Query: 60  SRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFL 118
           +RL  ++G F  E + +  A  L     L GL ++  + RF L ERE    L++     L
Sbjct: 61  ARLDSHMGAFTVEPIRASLAVGLGVRQALAGLNAVTAMLRFALAEREAHGPLFERSLGLL 120

Query: 119 NCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVT-QDLLWVSPKSGGAVCRSVGL 177
                  +    ++  E+ LL  +GFGLDL+ C V G    DL +VSP++G AV R    
Sbjct: 121 EMIGEAELWPLAYLHWEMALLDELGFGLDLSTCAVLGREANDLSFVSPRTGRAVSRKGAG 180

Query: 178 PYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYAL-QHNIIHCHLLRENFLGKL 236
            +A+++L LP+ L  E     A+ L   F +T +FL+++   +         R+  +  +
Sbjct: 181 EWADRLLPLPNCLL-EIAPAPAEDLVQGFAVTGHFLSQHLAGEMQGKPLPDARQRLIDLV 239

Query: 237 LE 238
             
Sbjct: 240 AR 241


>gi|302383088|ref|YP_003818911.1| DNA repair protein RecO [Brevundimonas subvibrioides ATCC 15264]
 gi|302193716|gb|ADL01288.1| DNA repair protein RecO [Brevundimonas subvibrioides ATCC 15264]
          Length = 243

 Score =  175 bits (443), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 79/239 (33%), Positives = 128/239 (53%), Gaps = 1/239 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M + ++A +L  R++G+  ++++++T  +GRH  +V  G S RM+P LQAG  V  ++R+
Sbjct: 1   MEFHEEAFVLSARAHGDTGVVVDLLTETHGRHAAYVAGGASRRMKPFLQAGARVIADYRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSS-SLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLN 119
           R + +LG  R E +    + L            +       LPEREP    +      ++
Sbjct: 61  RTSDHLGSARLEPVGEGPSALFDDGLALAGLSAAAAVAQGALPEREPHPGAFLAFEALMS 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
             +IP+V   IFV+ E  LL+++GFGLDL++C VTG   DL+WVSP++G +V  S G PY
Sbjct: 121 AFQIPAVWPAIFVRFEAGLLEDLGFGLDLSRCAVTGTMDDLVWVSPRTGRSVSASAGAPY 180

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLE 238
           A+K+L LP F+   +  +    +K    LT +FL ++            R   + KL E
Sbjct: 181 ADKLLKLPPFMLGAQAGLRDGDVKDGLDLTGHFLEQFVFHPQNKPLPTSRTWMIDKLGE 239


>gi|209964784|ref|YP_002297699.1| DNA repair protein RecO, putative [Rhodospirillum centenum SW]
 gi|238058647|sp|B6IMY9|RECO_RHOCS RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|209958250|gb|ACI98886.1| DNA repair protein RecO, putative [Rhodospirillum centenum SW]
          Length = 250

 Score =  175 bits (442), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 86/242 (35%), Positives = 123/242 (50%), Gaps = 5/242 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W DDAI+L  R +GE   +  ++TR +GRH G V  GQS RM+P+L+ GN V   W +
Sbjct: 1   MEWTDDAIVLSARPHGETAALAVLLTRGHGRHAGLVHGGQSGRMRPVLEPGNRVAARWAA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFR-FLPEREPCLELYDMLNIFLN 119
           RL + LG    E+  +  A LL   L L  L S   L    LPEREP   L+D      +
Sbjct: 61  RLVEQLGTLALELERATAAGLLEDPLRLAALSSACALVDAALPEREPHPALFDATLALFD 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQD--LLWVSPKSGGAVCRSVGL 177
             +       I+V+ E+ LL+  GFGLD   C  TG+T +  L +VSP++G AV  S G 
Sbjct: 121 ALQTEVWAE-IYVRWEIGLLEEAGFGLDFGSCAATGITDNDQLAYVSPRTGRAVSLSAGE 179

Query: 178 PYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLL 237
           PY +++L LP FL        A+ +     LT +FL+++            R  F+ +  
Sbjct: 180 PYRDRLLALPPFLVGRSAGG-AEEVVQGLALTGHFLDRHLFALRHAEVPAARTRFVDRYR 238

Query: 238 EL 239
           + 
Sbjct: 239 KA 240


>gi|220923264|ref|YP_002498566.1| DNA repair protein RecO [Methylobacterium nodulans ORS 2060]
 gi|254764644|sp|B8IL75|RECO_METNO RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|219947871|gb|ACL58263.1| DNA repair protein RecO [Methylobacterium nodulans ORS 2060]
          Length = 246

 Score =  173 bits (437), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 96/238 (40%), Positives = 136/238 (57%), Gaps = 5/238 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W D+ ++LG R +GE +++LE+MT  +GRHLG V  G+S RMQP+LQ GN VR  WR+
Sbjct: 1   MQWSDEGLVLGARRHGETSVVLELMTAGHGRHLGLVHGGRSRRMQPVLQPGNRVRAVWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL + LG F  E +ES   +L+ S L LYGL     L R LPER+P   LY    + +  
Sbjct: 61  RLDEGLGHFAVEPIESAAGRLMGSRLALYGLAHAAALLRLLPERDPHPSLYAAAQVLVAH 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P++   + V+ EL +L ++GFGLDL+ C  TG    L +VSPKSG AV  + G P+ 
Sbjct: 121 LTDPAIAPALMVRFELAVLADLGFGLDLSACAATGSNAYLAYVSPKSGRAVSAAAGEPWR 180

Query: 181 EKMLVLPSFLW-----KEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFL 233
           +++L LP FL          T     ++  F LT YFL+++      +     RE F+
Sbjct: 181 DRLLALPDFLVAREAGGTGATPTPRDVRQGFTLTGYFLDQHVWHPRGVAPPEARELFV 238


>gi|296444472|ref|ZP_06886437.1| DNA repair protein RecO [Methylosinus trichosporium OB3b]
 gi|296258119|gb|EFH05181.1| DNA repair protein RecO [Methylosinus trichosporium OB3b]
          Length = 240

 Score =  172 bits (436), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 90/234 (38%), Positives = 138/234 (58%), Gaps = 1/234 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D+ +++GVR +GE  +ILE+MTR +GRH+G VR G    ++ +LQ GN V V WR+
Sbjct: 1   MEWRDEGLVIGVRRHGESAVILELMTRAHGRHMGLVRGGSGRALRSVLQVGNSVEVLWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG F  E L S  A+L+  +  L+G+  +  L R LPER+   EL++M  +  + 
Sbjct: 61  RLEEHLGAFAVEPLRSRAARLIDRAFALHGVAHLAALLRLLPERDAQRELFEMAELIADR 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
                +   +  + EL LL+ +GFGLD+ +C +TG TQDL +VSPK+G AV R  G P+ 
Sbjct: 121 LDSLDLAPALMARFELALLQALGFGLDVERCALTGATQDLAFVSPKTGRAVTRDAGAPWR 180

Query: 181 EKMLVLPSFLWK-EEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFL 233
           +++L  P FL        DA  L +AF+LT +FL +       +     R  ++
Sbjct: 181 DRLLPFPPFLQDCARAPADASELAAAFRLTGHFLARDVFTPRGLEAPQARALYV 234


>gi|167645704|ref|YP_001683367.1| DNA repair protein RecO [Caulobacter sp. K31]
 gi|189039651|sp|B0T3I3|RECO_CAUSK RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|167348134|gb|ABZ70869.1| DNA repair protein RecO [Caulobacter sp. K31]
          Length = 243

 Score =  172 bits (435), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 75/240 (31%), Positives = 123/240 (51%), Gaps = 1/240 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D+A +L  R +GE   I+E++T++ G+ +  V    S RM+P LQAG  V   +R+
Sbjct: 1   MEWEDEAFVLSARVHGETGAIVELLTQERGKFVAHVSGAASRRMKPFLQAGAKVIARYRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSL-FLYGLQSIVPLFRFLPEREPCLELYDMLNIFLN 119
           R++  +G    E +    + L    L       +       LPERE     +  L   + 
Sbjct: 61  RMSDQMGAATLEPMGEGPSSLFDEPLALSGLSAAASVAAGALPEREAHPGAFHALEALIA 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
              IP++   ++V+ E  LL+++GFGLDL+KC  TG   DL++VSP++G AV R+ G PY
Sbjct: 121 ALAIPAIWPAVYVRFEAGLLQDLGFGLDLSKCAATGSLDDLVYVSPRTGRAVSRAAGQPY 180

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLEL 239
            +K+L LP F+   +  +    +K+   +T +FL ++            R   L +L E 
Sbjct: 181 HDKLLPLPPFMLSAQGGLVEGDVKAGLDITGHFLEQFVFHPLNRPLPPARVWLLDRLGEA 240


>gi|254420124|ref|ZP_05033848.1| DNA repair protein RecO [Brevundimonas sp. BAL3]
 gi|196186301|gb|EDX81277.1| DNA repair protein RecO [Brevundimonas sp. BAL3]
          Length = 243

 Score =  172 bits (435), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 76/239 (31%), Positives = 127/239 (53%), Gaps = 1/239 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M + ++A +L  R++G+   +++++T  +GR   +V  G S +M+P LQAG  V  ++R+
Sbjct: 1   MDFHEEAFVLSARAHGDTGAVVDLLTESHGRRAAYVAGGASRKMRPFLQAGARVVADYRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPERE-PCLELYDMLNIFLN 119
           R + +LG  R E +    + L   +L L GL +   + +       P   ++      + 
Sbjct: 61  RTSDHLGGARLEPVGEGPSALFDDALALTGLAAAAGVAQGALPEREPHPGVFLAFEALMA 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
              +P V   IFV+ E  LL+++GFGLDL+KC  TG   DL++VSP++G AV R  G PY
Sbjct: 121 AFALPDVWPAIFVRFEAGLLEDLGFGLDLSKCAATGTADDLIYVSPRTGRAVSREAGAPY 180

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLE 238
           A+KML LP F+   +  +    +++ F LT +FL ++            R   L +L E
Sbjct: 181 ADKMLSLPPFMLGAQAGLVEGDVRAGFDLTGHFLEQFVFHPQNKPLPAARVWMLDRLAE 239


>gi|329850744|ref|ZP_08265589.1| DNA repair protein RecO [Asticcacaulis biprosthecum C19]
 gi|328841059|gb|EGF90630.1| DNA repair protein RecO [Asticcacaulis biprosthecum C19]
          Length = 244

 Score =  171 bits (434), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 78/235 (33%), Positives = 115/235 (48%)

Query: 2   YWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSR 61
            ++D+AI+L  + +GE   IL V+T  +G +   V  G S RM+  LQ G  V   +R+R
Sbjct: 3   EFEDEAIVLSAKLHGESGAILHVLTENHGVYAAHVAGGASRRMKAALQPGASVLFRFRAR 62

Query: 62  LAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCH 121
            ++ LG    E   S    L  S   L    + +   + LPERE     Y  L+  L   
Sbjct: 63  HSEQLGTASVEASGSGPDVLDDSVALLGLQCACLMTRQVLPERERHPGAYYALSALLGAF 122

Query: 122 KIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAE 181
             P +   I+V+ E  LL+ +G+GLDL+ C VTG   DL++VSPKS  AV R  G  Y +
Sbjct: 123 VAPDIWPAIYVRYEAGLLEELGYGLDLSACAVTGSRDDLVYVSPKSARAVSRGAGEAYRD 182

Query: 182 KMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKL 236
           K+LVLP FL   +  + A  +     LT +FL ++    +      +R      L
Sbjct: 183 KLLVLPQFLLSSQGGLIAGDVGRGLALTGFFLERHVFHPHNKPLPDVRLRLAEAL 237


>gi|89053018|ref|YP_508469.1| DNA repair protein RecO [Jannaschia sp. CCS1]
 gi|119361461|sp|Q28V18|RECO_JANSC RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|88862567|gb|ABD53444.1| DNA repair protein RecO [Jannaschia sp. CCS1]
          Length = 244

 Score =  171 bits (434), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 78/243 (32%), Positives = 123/243 (50%), Gaps = 7/243 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+ D I+L VR +GE + I+E+ T   G HLG VR G S +M P+LQ G  +   WR+
Sbjct: 1   MDWRADGILLAVRRHGEASAIIELFTADQGCHLGVVRGGASRKMAPLLQVGAQLDATWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLN 119
           RL+ ++G +  E+++   A+++   + L GL S+  L  F LPER     L+      L+
Sbjct: 61  RLSDHIGSYTVELVKGRAAEVMEDRVALAGLSSVCALLSFSLPERAAYPGLFARTLAVLD 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                          E+ LL  +GFGLDL++C  TGVTQDL ++SP++G AV R+    +
Sbjct: 121 GLGAERWAEAYLG-WEMALLTEMGFGLDLSQCAATGVTQDLAFISPRTGRAVSRAAAGEW 179

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQH--NIIHCHLLRENFLGKLL 237
           A+++L L   L  E      + + +   +T +FL    L            R+  +  L 
Sbjct: 180 ADRLLPLSPAL--EGMARGPEDILAGLAVTGHFLA-THLAPSLGDKPLPAARQRLIDALE 236

Query: 238 ELI 240
             +
Sbjct: 237 RQV 239


>gi|126726092|ref|ZP_01741934.1| DNA repair protein RecO [Rhodobacterales bacterium HTCC2150]
 gi|126705296|gb|EBA04387.1| DNA repair protein RecO [Rhodobacterales bacterium HTCC2150]
          Length = 245

 Score =  171 bits (434), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 80/241 (33%), Positives = 120/241 (49%), Gaps = 4/241 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D   I+ VR +GE + I+EV T+  GRH G VR   S ++ P LQ G  V V+WR+
Sbjct: 1   MEWRDQGAIISVRHHGETSAIVEVFTKNQGRHAGVVRGATSRKIAPFLQPGGQVDVSWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG F  E ++S    + +             L   LPERE    LY+     L+ 
Sbjct: 61  RLNEHLGTFTIEPIQSRAHVMSNPLALAGLNAVCALLQFTLPERESHPRLYETSIALLDS 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
               S     ++  E++LL ++GFGLDL++C VTG   DL +VSPKSG AV +S    +A
Sbjct: 121 ISETSDWPLDYLHWEMLLLDDLGFGLDLSECAVTGTQGDLAYVSPKSGRAVSKSGAGEWA 180

Query: 181 EKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQH--NIIHCHLLRENFLGKLLE 238
           +++L L   L   + ++    L    + T +FL  + L            R   + +L  
Sbjct: 181 DRLLPLTPCLI-SDASVGVTELIEGLRTTGHFLENH-LAPELGNRPLPEARARMIDRLGR 238

Query: 239 L 239
           L
Sbjct: 239 L 239


>gi|254780948|ref|YP_003065361.1| DNA repair protein RecO [Candidatus Liberibacter asiaticus str.
           psy62]
 gi|254040625|gb|ACT57421.1| DNA repair protein RecO [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 240

 Score =  171 bits (434), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 240/240 (100%), Positives = 240/240 (100%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS
Sbjct: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC
Sbjct: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
           HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA
Sbjct: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180

Query: 181 EKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLELI 240
           EKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLELI
Sbjct: 181 EKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLELI 240


>gi|288958668|ref|YP_003449009.1| DNA repair protein RecO [Azospirillum sp. B510]
 gi|288910976|dbj|BAI72465.1| DNA repair protein RecO [Azospirillum sp. B510]
          Length = 240

 Score =  171 bits (433), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 82/236 (34%), Positives = 116/236 (49%), Gaps = 6/236 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W D  I+L  R  GE + +  ++TR +GRH G V  G+S R +  L+ G LV   WR 
Sbjct: 1   MDWSDQGIVLSARPQGEGSAVATLLTRGHGRHAGMVMGGRSARQRGTLEPGTLVHARWRG 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFR-FLPEREPCLELYDMLNIFLN 119
           RL ++LG F  E +  + A     +  L  L S   L    LPERE    L+D L +   
Sbjct: 61  RLPEHLGHFTLEPVRGYAAGFFDDAQALAALTSACALVEAALPEREAHPALFDGLLVLFG 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
               P+     +V+ E+ LL  +GFGLDL +C V+G    L +VSP++G AV  SVG PY
Sbjct: 121 LLDSPAWAE-TYVRWEVGLLAELGFGLDLDRCAVSGANDYLAYVSPRTGRAVTASVGEPY 179

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGK 235
            +++L LP FL        A       +LT +FL ++ L          RE    +
Sbjct: 180 RDRLLPLPDFLAGRGGGGPAAV-ADGLRLTAHFLERHLL---NGPLPPARERLRER 231


>gi|170742438|ref|YP_001771093.1| DNA repair protein RecO [Methylobacterium sp. 4-46]
 gi|168196712|gb|ACA18659.1| DNA repair protein RecO [Methylobacterium sp. 4-46]
          Length = 267

 Score =  171 bits (433), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 96/238 (40%), Positives = 134/238 (56%), Gaps = 5/238 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W D+ ++LG R  GE  ++LE+MT  +GRHLG V  G+S RMQP+LQ GN VR  WR+
Sbjct: 22  MQWSDEGLVLGARRLGETGVVLELMTAAHGRHLGLVHGGRSRRMQPVLQPGNRVRAVWRA 81

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL   LG F  E L+S   +L+ S L LYGL     L R LPER+P   LY+   + ++ 
Sbjct: 82  RLDDGLGSFAVEPLDSAAGRLIGSRLALYGLAHAAALLRLLPERDPHPGLYEAARVLIDH 141

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
               ++   + V+ EL +L  +GFGLDL+ C  TG    L +VSPKSG AV  + G P+ 
Sbjct: 142 LADAAIAPPLMVRFELAVLAELGFGLDLSACAATGSNAYLAYVSPKSGRAVSAAAGEPWR 201

Query: 181 EKMLVLPSFLW-----KEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFL 233
           +++L LP FL          T  A  ++  F LT YFL+++      +     RE F+
Sbjct: 202 DRLLALPDFLVAREAGGTGATPTARDVRQGFTLTGYFLDQHVWAPRGLAPPEARERFV 259


>gi|296116242|ref|ZP_06834859.1| putative DNA repair protein recO [Gluconacetobacter hansenii ATCC
           23769]
 gi|295977176|gb|EFG83937.1| putative DNA repair protein recO [Gluconacetobacter hansenii ATCC
           23769]
          Length = 265

 Score =  171 bits (432), Expect = 8e-41,   Method: Composition-based stats.
 Identities = 78/246 (31%), Positives = 127/246 (51%), Gaps = 6/246 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+  A++L    YGE ++I  V+T ++G + G VR G + + +P+ QAGNL+   W +
Sbjct: 7   MEWEAPALVLSAVPYGESSMIAHVLTGEHGLYHGMVRGGGARQGRPVWQAGNLITARWNA 66

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPL-FRFLPEREPCLELYDMLNIFLN 119
           RL + LG  R E++ +  A++L  +  L  L S+  L    LPEREP L +++ L   L 
Sbjct: 67  RLPEQLGSLRGELVHASAARVLEYAHPLAMLASLCALADSSLPEREPHLAVFEELTRLLA 126

Query: 120 CH-----KIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRS 174
                  +         ++ E++LL ++GFGLDL+ C V+G   DL WVSP+SG AV   
Sbjct: 127 RISLEPAEAERSGMAALIRWEMLLLSDLGFGLDLSCCAVSGQADDLAWVSPRSGRAVSDG 186

Query: 175 VGLPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLG 234
               + +++L+LP FL    Q    +   +  +LT +FL + A           R   L 
Sbjct: 187 HAGQWRDRLLMLPPFLLDPTQDGTPEQWLAGLRLTGHFLARDAFGQRHRPLPAARIRLLD 246

Query: 235 KLLELI 240
            +  ++
Sbjct: 247 MVGRMV 252


>gi|315122361|ref|YP_004062850.1| DNA repair protein RecO [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313495763|gb|ADR52362.1| DNA repair protein RecO [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 240

 Score =  171 bits (432), Expect = 9e-41,   Method: Composition-based stats.
 Identities = 182/240 (75%), Positives = 217/240 (90%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M+WQDDAI+LGVRSYGEKNIILEVMTR YGRHLGFVR GQS R+QP+LQ GNLVRVNWRS
Sbjct: 1   MHWQDDAIVLGVRSYGEKNIILEVMTRHYGRHLGFVRYGQSRRIQPVLQVGNLVRVNWRS 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL Q+LGEFR E++E  C+KLLSS++ LYGLQS++P+FRFLPER+PC +LYD+LN+F+N 
Sbjct: 61  RLEQDLGEFRLEIIEYRCSKLLSSAISLYGLQSMIPIFRFLPERDPCPDLYDLLNLFINS 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
           HKI S++GKIF+QIEL+LLKNIGFGL++TKCVVTGV+ DL WVSPKSGGA+C S+GLPYA
Sbjct: 121 HKISSILGKIFIQIELILLKNIGFGLEITKCVVTGVSHDLSWVSPKSGGAICHSLGLPYA 180

Query: 181 EKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLELI 240
            KMLVLP FLWKE+Q IDADSL++AF+LT YFL+KYA QHNIIHC+ LR NFL KL+EL+
Sbjct: 181 SKMLVLPLFLWKEQQNIDADSLRNAFRLTGYFLDKYAFQHNIIHCNSLRINFLNKLIELL 240


>gi|222148084|ref|YP_002549041.1| DNA repair protein RecO [Agrobacterium vitis S4]
 gi|221735072|gb|ACM36035.1| DNA repair protein RecO [Agrobacterium vitis S4]
          Length = 264

 Score =  171 bits (432), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 110/245 (44%), Positives = 160/245 (65%), Gaps = 5/245 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W D AI+LG R +GE ++I E+MT   GRHLG VR G+S  MQP+LQ GN+V V WR+
Sbjct: 1   MEWTDQAIVLGARRHGETSVIAEMMTLARGRHLGLVRGGRSRTMQPVLQPGNVVEVTWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG+FR E L+     L+SS+  +YG+Q++  L R LPEREP   LY+ +NI L+ 
Sbjct: 61  RLEEHLGDFRVEPLQLRAGHLMSSATAVYGVQALASLLRLLPEREPHGHLYEAMNIILDH 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P+  G++F++ EL +L ++GFGLDLT C  TG  QDL++VSPK+G AV  + GLPYA
Sbjct: 121 LHEPASAGELFIRFELAILNDLGFGLDLTACAATGGRQDLVFVSPKTGRAVSHAAGLPYA 180

Query: 181 EKMLVLPSF-----LWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGK 235
           +++L LP F     L  +++  DA +L+ AF+LT YFL ++  +   +     R+ F   
Sbjct: 181 DRLLTLPVFLQPEPLVGKDKQADAQALQQAFRLTGYFLQRHVYEPRGLTAGAARDGFCQA 240

Query: 236 LLELI 240
            L+ +
Sbjct: 241 ALKAL 245


>gi|154253316|ref|YP_001414140.1| DNA repair protein RecO [Parvibaculum lavamentivorans DS-1]
 gi|154157266|gb|ABS64483.1| DNA repair protein RecO [Parvibaculum lavamentivorans DS-1]
          Length = 234

 Score =  169 bits (429), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 85/228 (37%), Positives = 126/228 (55%), Gaps = 1/228 (0%)

Query: 10  LGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQNLGEF 69
           L  R++GE   ILE+ TR+ GRHLG V  G   RM+ +LQ GN +  +WR RL+++LG +
Sbjct: 2   LSARAHGETGAILELFTREQGRHLGLVHGGAGRRMRSVLQPGNKLAAHWRGRLSEHLGTY 61

Query: 70  RFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPSVIGK 129
           + E+++     L+   L L GL +   +   LPERE    LYD   + L+  +   V   
Sbjct: 62  QVELVKPLAGLLMDDPLALLGLSAASAICSILPEREAHPALYDGYEVLLDTMRDEDVWPA 121

Query: 130 IFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKMLVLPSF 189
           +FV+ EL LL+ +GFGLDLT+C  TG   DL +VSP+SG AV R  G  Y E++  LP F
Sbjct: 122 VFVRWELGLLQELGFGLDLTQCAATGSRDDLAYVSPRSGSAVSRGAGEIYKERLFRLPGF 181

Query: 190 LWKEE-QTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKL 236
           L   +    +A  +    +LT +FL ++    +  H    R   + K+
Sbjct: 182 LVGSQAGAAEAADVAEGLRLTGHFLERHLFAAHERHLPDARIRLMEKM 229


>gi|307946583|ref|ZP_07661918.1| DNA repair protein RecO [Roseibium sp. TrichSKD4]
 gi|307770247|gb|EFO29473.1| DNA repair protein RecO [Roseibium sp. TrichSKD4]
          Length = 256

 Score =  169 bits (428), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 95/220 (43%), Positives = 133/220 (60%), Gaps = 4/220 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W    I+LG R +GE ++ILEVMT  YGRHLG VR G+S   QP +Q GN ++V WR+
Sbjct: 1   MEWTATGIVLGSRKHGENDVILEVMTETYGRHLGLVRGGRSRTRQPQIQPGNELQVTWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL + LG +  E L    A+L++S L L+G+Q +  L R LPER+P   LY  L + L+ 
Sbjct: 61  RLPEQLGTYSIEPLRLRAAELMASPLGLHGVQHLGALLRMLPERDPHAALYRALTLVLDQ 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
            +   +   + ++ EL LL  +GFGLDL+ C  TG  +DL +VSPKSG AV R  G PY 
Sbjct: 121 LQDGDIGPPLLIRFELELLNELGFGLDLSCCAATGSQEDLAYVSPKSGRAVSRDAGQPYH 180

Query: 181 EKMLVLPSFLWKEEQTID----ADSLKSAFQLTDYFLNKY 216
           +K+L LP FL   ++          L + F+LT +FL ++
Sbjct: 181 DKLLPLPDFLIDGQRQPGSELLFKDLSNGFKLTRFFLARH 220


>gi|114799258|ref|YP_759606.1| DNA repair protein RecO [Hyphomonas neptunium ATCC 15444]
 gi|122942647|sp|Q0C3T7|RECO_HYPNA RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|114739432|gb|ABI77557.1| DNA repair protein RecO [Hyphomonas neptunium ATCC 15444]
          Length = 243

 Score =  169 bits (427), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 79/239 (33%), Positives = 116/239 (48%), Gaps = 3/239 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W DD I+LG R +GE  +IL+V+TR+ GR  G V  G S R +   +AGN + ++W  
Sbjct: 1   MNWSDDGIVLGGRRFGEGGLILDVLTREKGRRSGLVYGGASRRKRAQFEAGNTIALSWTG 60

Query: 61  RLAQNLGEFRFEVL-ESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPC--LELYDMLNIF 117
           RL   LG F      +   ++LL     L  L +I  L R            LY+   + 
Sbjct: 61  RLDDQLGRFDVAEARKDRASRLLDDPAALAALSAITSLLRGGLNEGDAAGSSLYEATTLL 120

Query: 118 LNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGL 177
           L+    P+V   ++V+ EL LL  +GFGLDL +C V+G    L  VSP++G AV  S   
Sbjct: 121 LDQLTEPNVWPALYVRWELGLLSALGFGLDLDECAVSGANDGLTHVSPRTGRAVRGSEAE 180

Query: 178 PYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKL 236
           PY +++  LPSFL      +    + +  +LT YF+               RE  L ++
Sbjct: 181 PYVDRLFALPSFLIDPRADVLPGDIAAGLRLTGYFIEGRLFGSVHRGLPPERERLLKRI 239


>gi|312115948|ref|YP_004013544.1| DNA repair protein RecO [Rhodomicrobium vannielii ATCC 17100]
 gi|311221077|gb|ADP72445.1| DNA repair protein RecO [Rhodomicrobium vannielii ATCC 17100]
          Length = 241

 Score =  168 bits (426), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 83/240 (34%), Positives = 120/240 (50%), Gaps = 3/240 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W DD I L  R +GE ++I ++ TR  GR  G V+ G+S R++P+LQ GN + V WR+
Sbjct: 1   MRWADDGIFLAGRPHGETSVIADIFTRANGRAKGLVKGGRSRRLRPLLQTGNTLGVEWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL   LG +  E+  +  A  L     L G+ ++  L + L ER+P   LYD     L  
Sbjct: 61  RLDDQLGVYTVELARATAANALDDPSALAGMTALAALLQVLAERDPHPALYDAAQDCLAH 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
               +     F++ EL  L  +GFGL+L  C  TG   DL++VSPKSG AVCR  G PYA
Sbjct: 121 -ASDASFPAAFIRFELRFLNELGFGLNLATCAATGRADDLIYVSPKSGQAVCREAGEPYA 179

Query: 181 EKMLVLP--SFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLE 238
           +++L LP                +++   LT +FL  +    +       R+ F   L  
Sbjct: 180 DRLLPLPAFLANAASAAAPSDAEIEAGLLLTGHFLAVHVFAESGKPLPTARDEFARTLRR 239


>gi|260576291|ref|ZP_05844283.1| DNA repair protein RecO [Rhodobacter sp. SW2]
 gi|259021559|gb|EEW24863.1| DNA repair protein RecO [Rhodobacter sp. SW2]
          Length = 238

 Score =  168 bits (426), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 80/239 (33%), Positives = 113/239 (47%), Gaps = 2/239 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D   +L VR +GE   I+EV T  +GRH G VR G S R+ P+LQ G  + V WR+
Sbjct: 1   MEWRDQGALLSVRPHGESAAIIEVFTAAHGRHAGVVRGGASRRIAPLLQPGAQLDVVWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL  ++G F  E + S    L               +   LPER P   LY      L+ 
Sbjct: 61  RLEGHIGAFTVEPVRSRAGVLGDRLALAGLNAICAMVRVALPERAPHDLLYAATIAVLDA 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
            +        +++ EL+LL+ +GFGLDL +C VTG   DL +VSPK+G AV R     +A
Sbjct: 121 LETAPDWPARYLRWELLLLEELGFGLDLGRCAVTGSRDDLAYVSPKTGRAVSRDGAGEWA 180

Query: 181 EKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNII-HCHLLRENFLGKLLE 238
            ++L LP  L  +        L +   +T +FL +       + H    R   L  L  
Sbjct: 181 ARLLPLPDCLLGQG-PASGADLAAGLAVTGHFLTREMASLRHVQHLPEARARLLELLAR 238


>gi|118587959|ref|ZP_01545369.1| DNA repair protein RecO [Stappia aggregata IAM 12614]
 gi|118439581|gb|EAV46212.1| DNA repair protein RecO [Stappia aggregata IAM 12614]
          Length = 251

 Score =  168 bits (426), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 88/225 (39%), Positives = 130/225 (57%), Gaps = 4/225 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W    ++L  R +GE ++ILE MT  +GRHLG VR G+S R +P+LQ GN + + W++
Sbjct: 1   MEWSGRGVVLTTRKHGENDVILEAMTLDHGRHLGLVRGGRSRRHRPVLQPGNELTLTWKA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL+ +LG+F  E        L++SSL L  LQ +  L R LPER     L++ L + L+ 
Sbjct: 61  RLSDHLGQFHIEPETLRAGDLMTSSLGLAALQHLAFLLRLLPERHTYPRLFNALTVVLDH 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
            +       + ++ EL +L+++G GLDL+ C  TG  +DL +VSPKS  AVCR  GLPY 
Sbjct: 121 LEASDAAAALLIRFELEVLRDLGIGLDLSSCAATGSNEDLAYVSPKSARAVCREAGLPYH 180

Query: 181 EKMLVLPSFLWKE----EQTIDADSLKSAFQLTDYFLNKYALQHN 221
           +++L LP FL          +    +   F LT +FLN+Y  +H 
Sbjct: 181 DRLLPLPGFLLDGQRQAGSELTWADVTQGFDLTSFFLNRYLQEHG 225


>gi|162148788|ref|YP_001603249.1| DNA repair protein recO [Gluconacetobacter diazotrophicus PAl 5]
 gi|189039658|sp|A9HRQ4|RECO_GLUDA RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|161787365|emb|CAP56960.1| putative DNA repair protein recO [Gluconacetobacter diazotrophicus
           PAl 5]
          Length = 254

 Score =  168 bits (425), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 69/242 (28%), Positives = 113/242 (46%), Gaps = 6/242 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+  A++L    YGE + I+ ++T   G   G  R G +   + + Q GNL+R +WR 
Sbjct: 1   MEWEAPALVLSASPYGESSAIVHLLTEDLGLVHGLARGGTARANRALWQPGNLIRASWRG 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFR-FLPEREPCLELYDMLNIFLN 119
           RL   LG    E++    A+L+S+ L L  L S   +    LPEREP   ++ +L  F +
Sbjct: 61  RLPDQLGNLSGELVHGSAARLMSAPLALAMLASACAVADGTLPEREPHPRIFHLLTRFFS 120

Query: 120 CHKIPSVIGKIFV-----QIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRS 174
              +   +          + E  LL ++G+G+DL+ C VTG + +L WVSP++G AV  +
Sbjct: 121 LLSLDPDMAGWGGMAALLRWEACLLGDLGYGMDLSACAVTGGSAELAWVSPRTGRAVSDA 180

Query: 175 VGLPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLG 234
               +  ++L LP     E         +   +LT +FL + A           R   + 
Sbjct: 181 AAGEWRPRLLRLPPLFLDESDPGTVQDWRDGLRLTGHFLARDAFGQRHRPLPPARLRLVD 240

Query: 235 KL 236
            +
Sbjct: 241 MI 242


>gi|209545462|ref|YP_002277691.1| DNA repair protein RecO [Gluconacetobacter diazotrophicus PAl 5]
 gi|209533139|gb|ACI53076.1| DNA repair protein RecO [Gluconacetobacter diazotrophicus PAl 5]
          Length = 254

 Score =  168 bits (425), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 69/242 (28%), Positives = 113/242 (46%), Gaps = 6/242 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+  A++L    YGE + I+ ++T   G   G  R G +   + + Q GNL+R +WR 
Sbjct: 1   MEWEAPALVLSASPYGESSAIVHLLTEDLGLVHGLARGGTARANRALWQPGNLIRASWRG 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFR-FLPEREPCLELYDMLNIFLN 119
           RL   LG    E++    A+L+S+ L L  L S   +    LPEREP   ++ +L  F +
Sbjct: 61  RLPDQLGNLSGELVHGSAARLMSAPLALAMLASACAVADGTLPEREPHPRIFHLLTRFFS 120

Query: 120 CHKIPSVIGKIFV-----QIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRS 174
              +   +          + E  LL ++G+G+DL+ C VTG + +L WVSP++G AV  +
Sbjct: 121 LLSLDPDMAGWGGMAALLRWEACLLGDLGYGMDLSACAVTGGSAELAWVSPRTGRAVSDA 180

Query: 175 VGLPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLG 234
               +  ++L LP     E         +   +LT +FL + A           R   + 
Sbjct: 181 AAGEWRPRLLRLPPLFLNESDPGTVQDWRDGLRLTGHFLARDAFGQRHRPLPPARLRLVD 240

Query: 235 KL 236
            +
Sbjct: 241 MI 242


>gi|330994746|ref|ZP_08318668.1| DNA repair protein recO [Gluconacetobacter sp. SXCC-1]
 gi|329758007|gb|EGG74529.1| DNA repair protein recO [Gluconacetobacter sp. SXCC-1]
          Length = 263

 Score =  168 bits (424), Expect = 8e-40,   Method: Composition-based stats.
 Identities = 77/244 (31%), Positives = 115/244 (47%), Gaps = 6/244 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+  A++L    YGE + I+ V+T +YG + G  R G + R +   Q GNLVR  W +
Sbjct: 1   MEWEAPALVLSATPYGEGSAIVHVLTGEYGLYHGLARGGSASRGRATWQTGNLVRARWTA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPL-FRFLPEREPCLELYDMLNIFLN 119
           RL + LG    E + +  A+LL   L L  L S+  L    LPEREP   ++  L   L 
Sbjct: 61  RLPEQLGSITAETVHASAARLLDYPLPLAMLASLCALADDCLPEREPHPAIFQGLTSLLA 120

Query: 120 CHKIPSVIGKI-----FVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRS 174
              +     +       V+ ELMLL ++GFGLDL  C + G  +DL WVSP++G AV   
Sbjct: 121 RISLDPQWAETEAMPEIVRWELMLLSDLGFGLDLGGCALGGSREDLRWVSPRTGRAVSDE 180

Query: 175 VGLPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLG 234
               + +++L LP F+   +Q           +L+ +FL + A           R     
Sbjct: 181 KAGAWRDRLLPLPGFILHPQQVATPRDWHDGLRLSGHFLRRDAFGQRHRPVPEARGRLAD 240

Query: 235 KLLE 238
            +  
Sbjct: 241 MIAR 244


>gi|319405460|emb|CBI79079.1| DNA repair protein RecO [Bartonella sp. AR 15-3]
          Length = 248

 Score =  167 bits (423), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 105/239 (43%), Positives = 150/239 (62%), Gaps = 1/239 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W++ AIILG R +GE ++ILE+MTRQ+GR++G V+ G+S RM P+LQ GN V   W +
Sbjct: 1   MKWKEPAIILGTRQHGETSVILEIMTRQHGRYMGIVKGGRSRRMAPLLQPGNFVEAEWWA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG FR E L+SH ++L+     LY LQ +    R LPER+P   LYDML  F+  
Sbjct: 61  RLDEHLGLFRLEALDSHASRLIVLPEALYSLQLMASHLRLLPERDPHPVLYDMLYFFMQN 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P +  ++ V+ EL+LL+ +GFGLDL+ C VTG  + L +VSPKSG AVC  +G P+ 
Sbjct: 121 FDDPFINAELLVRFELLLLEELGFGLDLSCCAVTGRQEKLCYVSPKSGRAVCEEIGRPWK 180

Query: 181 EKMLVLPSFLWKEEQ-TIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLE 238
           +K+L+LP FL ++    ID D +     LTD+FL +Y  +   I    LR + +     
Sbjct: 181 DKLLLLPQFLVQKTACPIDFDDINKGLTLTDFFLTRYVWEARGIKQPSLRVSLIQLFER 239


>gi|294084098|ref|YP_003550856.1| DNA repair protein RecO [Candidatus Puniceispirillum marinum
           IMCC1322]
 gi|292663671|gb|ADE38772.1| DNA repair protein RecO [Candidatus Puniceispirillum marinum
           IMCC1322]
          Length = 250

 Score =  167 bits (422), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 82/240 (34%), Positives = 120/240 (50%), Gaps = 6/240 (2%)

Query: 2   YWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSR 61
            W  DA+I+  + +GE + ++ V+T + GRH G VR G S +M+ ILQ GN VRV+WR+R
Sbjct: 3   EWVADAVIISAKPHGEGSAVVIVLTAENGRHAGLVRGGSSSKMRGILQPGNRVRVSWRAR 62

Query: 62  LAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFR-FLPEREPCLELYDMLNIFLNC 120
           L   LG+ + E++ +  A +L  +L L G+ S   L    LPERE    LYD  N   + 
Sbjct: 63  LIDQLGQMQIELINAIPALMLDDALRLAGIASACALLDGTLPEREAQHALYDGTNALFDL 122

Query: 121 H---KIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGL 177
                      + +++ EL LL   G+ LDLT+C  +G  + L +VSPKSG A+      
Sbjct: 123 MCLDDPDHRWIEGYIRWELGLLNAAGYQLDLTRCAASGAREKLAYVSPKSGCAIALDQAG 182

Query: 178 PYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLL 237
            Y ++ML LP FL             S   LT +FL K     +     + R      +L
Sbjct: 183 EYVQRMLTLPVFLGGITNVASDH--VSGLNLTGHFLEKRVFAAHNQDLPIQRRRLADMVL 240


>gi|294678824|ref|YP_003579439.1| DNA repair protein RecO [Rhodobacter capsulatus SB 1003]
 gi|294477644|gb|ADE87032.1| DNA repair protein RecO [Rhodobacter capsulatus SB 1003]
          Length = 240

 Score =  167 bits (422), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 80/239 (33%), Positives = 112/239 (46%), Gaps = 2/239 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M WQD   IL  R +GE + I+EV T  +GRHLG VR G S +M  +L  G+ V V WR+
Sbjct: 1   MDWQDSGTILSTRLHGESSAIVEVFTATHGRHLGVVRGGASRKMAAVLMPGSHVAVAWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL   LG F  E L S    L      +        L   L ER P   LY         
Sbjct: 61  RLEDQLGSFTVEPLASRAGALSDRLALMGLNAVCALLSFVLAERAPHPRLYAATEPLFTV 120

Query: 121 HKI-PSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                      ++  E+ LL+++GFGLDL++C VTG   DL +VSP++G AV R+    +
Sbjct: 121 IGQAAEGWVVDYLIWEMALLEDLGFGLDLSRCAVTGTRDDLAFVSPRTGRAVSRAGAGDW 180

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLE 238
           A K+L LP  L  +        +     LT +FL ++A +H+       R   +  +  
Sbjct: 181 APKLLPLPLCLLGQG-PATWTEIGQGLTLTGHFLTRFASEHSRKALPEARNRLIAAIAR 238


>gi|146278602|ref|YP_001168761.1| DNA repair protein RecO [Rhodobacter sphaeroides ATCC 17025]
 gi|172046019|sp|A4WVP2|RECO_RHOS5 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|145556843|gb|ABP71456.1| DNA repair protein RecO [Rhodobacter sphaeroides ATCC 17025]
          Length = 237

 Score =  166 bits (421), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 73/237 (30%), Positives = 113/237 (47%), Gaps = 3/237 (1%)

Query: 2   YWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSR 61
            W+D+  +L VR +GE   I+EV T  +GRHLG VR G S R  P+LQ G  + + W++R
Sbjct: 3   EWRDEGALLSVRRHGESAAIIEVFTASHGRHLGVVRGGASRRHAPVLQPGAQLDLTWKAR 62

Query: 62  LAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCH 121
           L  ++G F  E L +                    L   LPEREP + L+      ++  
Sbjct: 63  LDDHMGAFTVEPLRARTGIFGDRLALAGLNAICAMLHVVLPEREPHVGLWRESIELMDAL 122

Query: 122 KIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAE 181
                    +++ E+ LL+  GFGLDLT+C VTG  +DL +VSP++G AV R+    +A+
Sbjct: 123 A-APGWPAAYLRWEMRLLEEAGFGLDLTRCAVTGSREDLAFVSPRTGRAVGRAAAGDWAD 181

Query: 182 KMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLE 238
           ++  LP  L  +        ++    +T +FL +  L          R   +  L  
Sbjct: 182 RLFPLPLALLGQG-PASGPEVRQGLAITGHFLARE-LPLAGRPLPEARARLIDLLAR 236


>gi|254293710|ref|YP_003059733.1| DNA repair protein RecO [Hirschia baltica ATCC 49814]
 gi|254042241|gb|ACT59036.1| DNA repair protein RecO [Hirschia baltica ATCC 49814]
          Length = 290

 Score =  165 bits (418), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 80/239 (33%), Positives = 122/239 (51%), Gaps = 2/239 (0%)

Query: 2   YWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSR 61
            W D AI LG R++GE ++IL+V T   GR  G V  G S + +P+++AGN + V W+++
Sbjct: 3   EWSDTAISLGARTFGETDVILDVFTPSRGRTRGLVYGGISQKKRPMIEAGNTIDVQWKAK 62

Query: 62  LAQNLGEFRFEV-LESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLN 119
              +LG F     +    A+ +   L L GL ++  + R  LPE E    LY+     L+
Sbjct: 63  TESSLGHFSVADAINQRAARCMIDPLALAGLSAVTSILRDGLPEGEAKDGLYEATETLLD 122

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
               P +   IF++ EL  L+ +G+GL+L  CV++G    L  VSPKSG AV  S    Y
Sbjct: 123 VMGEPDIWPAIFIKWELGFLQQMGYGLNLETCVISGANDGLTHVSPKSGCAVRGSEAEEY 182

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLE 238
            +K+L LP+FL   +       + + F+LT YFL +             R   L +L +
Sbjct: 183 IDKLLSLPAFLTDAKAPPSPYDIGAGFKLTGYFLTRRLFADINRDAPEARYLMLERLEK 241


>gi|114327658|ref|YP_744815.1| DNA repair protein recO [Granulibacter bethesdensis CGDNIH1]
 gi|122327371|sp|Q0BTG0|RECO_GRABC RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|114315832|gb|ABI61892.1| DNA repair protein recO [Granulibacter bethesdensis CGDNIH1]
          Length = 250

 Score =  164 bits (416), Expect = 6e-39,   Method: Composition-based stats.
 Identities = 71/239 (29%), Positives = 114/239 (47%), Gaps = 3/239 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W    I+L  + YGE + +  V +   G + G VR G S +   I Q GNLV   W +
Sbjct: 1   MEWTAPCIVLSAQPYGEADCLAAVFSEDQGLYRGLVRGGTSRQRGGIWQPGNLVMARWTA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFR-FLPEREPCLELYDMLNIFLN 119
           RLA  LG    E++    A  +   L L  L+S+  +    LP+RE     +  L   L 
Sbjct: 61  RLADQLGSLTAELIHPAAALAMDDPLNLAVLRSLCTVAEGALPDREAHPAAFIPLPGLLT 120

Query: 120 CH-KIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
                   + +  ++ E +LL+ +G+GLDL +C VTG    L +VSP++G AV      P
Sbjct: 121 RLSLGGGQVVEDAIRWEAILLRELGYGLDLQRCAVTGQVSGLHYVSPRTGRAVSSDAAEP 180

Query: 179 YAEKMLVLPSFLWKEEQT-IDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKL 236
           + +++L LP+FL  + +T  D  + +   +LT YFL++             R +   ++
Sbjct: 181 WLDRLLPLPAFLLHQAETDSDPVAWRDGLRLTGYFLSRDVFGTRHRPLPPARMSLYDRI 239


>gi|254502661|ref|ZP_05114812.1| DNA repair protein RecO [Labrenzia alexandrii DFL-11]
 gi|222438732|gb|EEE45411.1| DNA repair protein RecO [Labrenzia alexandrii DFL-11]
          Length = 244

 Score =  163 bits (412), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 91/234 (38%), Positives = 129/234 (55%), Gaps = 5/234 (2%)

Query: 9   ILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQNLGE 68
           +L  R +GE ++ILEVMT   GRHLG VR G+S R +P LQ GN + + W++RL+ +LG+
Sbjct: 2   VLTTRKHGENDVILEVMTADSGRHLGLVRGGRSKRHRPALQPGNELSLTWKARLSDHLGQ 61

Query: 69  FRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPSVIG 128
           F+ E   +  A L++S + L  +Q +  L R LPER P   +Y  LN+ L+         
Sbjct: 62  FQIEPHTARAADLMNSGIGLAAVQHLAALVRLLPERHPYPRIYGALNVVLDHLDASDAAA 121

Query: 129 KIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKMLVLPS 188
            + ++ EL LL+ +G GLDLT C  TG T DL +VSP+S  AV R  G PY +K+L LPS
Sbjct: 122 ALMIRFELELLQELGAGLDLTSCAATGTTDDLAYVSPRSARAVSREAGRPYHDKLLPLPS 181

Query: 189 FLWKE----EQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLE 238
           FL          +    +   FQLT +FL++  L    I     R      L +
Sbjct: 182 FLLDGQRQAGTELTWQDVTQGFQLTGFFLDRQ-LGERNITDSGTRTLLTNALEK 234


>gi|83593184|ref|YP_426936.1| DNA repair protein RecO [Rhodospirillum rubrum ATCC 11170]
 gi|119361481|sp|Q2RT96|RECO_RHORT RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|83576098|gb|ABC22649.1| Recombination protein O, RecO [Rhodospirillum rubrum ATCC 11170]
          Length = 252

 Score =  161 bits (406), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 77/246 (31%), Positives = 118/246 (47%), Gaps = 8/246 (3%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWR 59
           M  W D  I+L  R +GE  +I+ +++  +GRH G VR G+  R++  LQ G+LV+  W+
Sbjct: 1   MIEWSDRGIVLAARPHGEDGVIVSLLSAGHGRHSGIVRGGRGKRLRAALQPGSLVQATWK 60

Query: 60  SRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLN 119
           +RL  +LG    E+L      LL     L  L +   L   +              + L 
Sbjct: 61  ARLEDHLGSLVVELLAGVAGGLLDDRDRLAALAAACALAETVLPERAPQADVYDATLALL 120

Query: 120 C------HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCR 173
                     P V    FV+ E+ LL  +GFGLDL+ C V+G   DL +VSP+SG AV R
Sbjct: 121 DALAEGGEGTPLVWAGAFVRWEIGLLAALGFGLDLSCCAVSGECGDLAYVSPRSGRAVGR 180

Query: 174 SVGLPYAEKMLVLPSFLWKEEQ-TIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENF 232
             G P+  ++L LP+FL    +   +A ++    +L+ YFL  + L          R+ F
Sbjct: 181 EAGAPWQARLLALPAFLLSPAEVPANAQAVGDGLRLSGYFLEGHVLAPQGRGLPASRQRF 240

Query: 233 LGKLLE 238
           + +L  
Sbjct: 241 VERLRR 246


>gi|319404020|emb|CBI77608.1| DNA repair protein RecO [Bartonella rochalimae ATCC BAA-1498]
          Length = 248

 Score =  158 bits (399), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 101/239 (42%), Positives = 149/239 (62%), Gaps = 1/239 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W++ AIILG R +GE ++ILE+MTRQ+GR++G V+ G+S RM P+LQ GN V   W +
Sbjct: 1   MKWKEQAIILGTRQHGETSVILEIMTRQHGRYMGIVKGGRSRRMAPLLQPGNFVEAEWWA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG FR E L  H ++L+     LY LQ +    R LPER+P   LYDML  F+  
Sbjct: 61  RLDEHLGLFRLEALNLHASRLIVLPEALYSLQLMAFYLRLLPERDPHPVLYDMLYFFMQN 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
            + P +  ++ V+ EL+LL+ +GFGLDL+ C VTG  + L +VSPKSG AVC  +G P+ 
Sbjct: 121 FEDPFINAELLVRFELLLLEELGFGLDLSCCAVTGRQEKLYYVSPKSGRAVCEEIGRPWK 180

Query: 181 EKMLVLPSFLWKEEQ-TIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLE 238
           +K+L+LP FL ++    +D + +     LT++FL +Y  +   I    LR + +     
Sbjct: 181 DKLLLLPQFLVQKSVYPVDFNDISKGLILTNFFLTRYVWEARGIKQLSLRVSLIQLFER 239


>gi|319407033|emb|CBI80670.1| DNA repair protein RecO [Bartonella sp. 1-1C]
          Length = 248

 Score =  158 bits (399), Expect = 7e-37,   Method: Composition-based stats.
 Identities = 101/239 (42%), Positives = 149/239 (62%), Gaps = 1/239 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W++ AIILG R +GE ++ILE+MTRQ+GR++G V+ G+S RM P+LQ GN V   W +
Sbjct: 1   MKWKEQAIILGTRQHGETSVILEIMTRQHGRYMGIVKGGRSRRMAPLLQPGNFVEAEWWA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG FR E L+ H ++L+     LY LQ +    R LPER+P   LYDML  F+  
Sbjct: 61  RLDEHLGLFRLEALDLHASRLIVLPEALYSLQLMAFYLRLLPERDPHPVLYDMLYFFMQN 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
            + P +  ++ V+ EL+LL+ +GFGLDL+ C VTG  + L +VSPKSG AVC  +G P+ 
Sbjct: 121 FEDPFINAELLVRFELLLLEELGFGLDLSCCAVTGRQEKLYYVSPKSGRAVCEEIGRPWK 180

Query: 181 EKMLVLPSFLWKEEQ-TIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLE 238
           +K+L+LP FL ++    +D + +     LT++FL +Y      I    LR + +     
Sbjct: 181 DKLLLLPKFLVQKNVYPVDFNDISKGLILTNFFLTRYVWDARGIKQSSLRVSLIQLFER 239


>gi|304321235|ref|YP_003854878.1| DNA repair protein RecO [Parvularcula bermudensis HTCC2503]
 gi|303300137|gb|ADM09736.1| DNA repair protein RecO [Parvularcula bermudensis HTCC2503]
          Length = 243

 Score =  158 bits (398), Expect = 9e-37,   Method: Composition-based stats.
 Identities = 82/242 (33%), Positives = 120/242 (49%), Gaps = 6/242 (2%)

Query: 2   YWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSR 61
            W D   ++     GE ++++ + TR  G   G V  GQ  R  P+LQ GNLV  +W SR
Sbjct: 3   EWTDRGFVIKTIPRGENHLVVTLFTRCRGAVTGLVHGGQGTRKAPLLQRGNLVSADWSSR 62

Query: 62  LAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLF-RFLPEREPCLELYDMLNIFLNC 120
            A   G +R E+ E+  A+ L S L L  LQS+  L    LPE      L+D   +F + 
Sbjct: 63  QADGYGTYRLELAEAIAARALDSRLSLLALQSVTDLLCEILPEGVAYEGLFDATEVFFSA 122

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVT----QDLLWVSPKSGGAVCRSVG 176
               +++  + V+ EL LL  +G+GL L +C  TG T     DL++VSPKSGGAV    G
Sbjct: 123 LGEKAIMATLLVKWELGLLAALGYGLSLERCAATGRTLEDGADLVFVSPKSGGAVTAEAG 182

Query: 177 LPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKL 236
            PYA+++L LP FL    +      + +  +LT  FL++  L          R   + +L
Sbjct: 183 APYADRLLPLPPFLIDRGEP-TWPDIAAGLRLTGTFLDERLLAPVGKSLPEARGQLIRRL 241

Query: 237 LE 238
             
Sbjct: 242 TR 243


>gi|94498593|ref|ZP_01305147.1| Recombinational DNA repair protein (RecF pathway)-like
           [Sphingomonas sp. SKA58]
 gi|94421957|gb|EAT07004.1| Recombinational DNA repair protein (RecF pathway)-like
           [Sphingomonas sp. SKA58]
          Length = 244

 Score =  154 bits (389), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 71/237 (29%), Positives = 109/237 (45%), Gaps = 4/237 (1%)

Query: 7   AIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQNL 66
           AI+  VR++GE   I  ++T  +G   G+VR G+S  M+P+L  GN+V+ ++R+R    L
Sbjct: 8   AIVCAVRAHGEHGAIARLLTPDHGLMAGYVRGGRSRAMRPVLLPGNVVKADFRARTEDQL 67

Query: 67  GEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPS- 125
                E+  S    L           S       LPE  P   LY  L   L+  +    
Sbjct: 68  AGLAVELAHSRAPLLAEPLPAAAIDWSCALTAAALPEATPYPALYQALAGLLDAVEAAPA 127

Query: 126 --VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKM 183
                   V+ EL+LL  +GFGLDL++C   G   DL +VSP+S  AV R+  L Y +++
Sbjct: 128 ARGWAVALVRYELLLLTELGFGLDLSRCAALGDVNDLAFVSPRSAAAVSRAGALGYEQRL 187

Query: 184 LVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLELI 240
           L LP FL       D   +    +LT +FL +  +          R+  + +L   +
Sbjct: 188 LPLPPFLVGGG-AGDWADIMDGLRLTGFFLERSVMTERRTDVLAARDRLVERLKRAV 243


>gi|148557387|ref|YP_001264969.1| DNA repair protein RecO [Sphingomonas wittichii RW1]
 gi|254790737|sp|A5VEW5|RECO_SPHWW RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|148502577|gb|ABQ70831.1| DNA repair protein RecO [Sphingomonas wittichii RW1]
          Length = 243

 Score =  154 bits (388), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 78/242 (32%), Positives = 117/242 (48%), Gaps = 3/242 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M  +  AII  +R++GE   I+  +T  +G   G+VR G+S R++P+L AGNLV   +R+
Sbjct: 1   MQVRTPAIICAMRAHGEHGAIVRALTPDHGLLAGYVRGGRSRRLRPVLVAGNLVEAEFRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           R A+ L     E+  S    L                   L E +P   LY+ L+  L  
Sbjct: 61  RTAEQLPGLTVELSHSRAGLLAEPLAAAAIDWLSSLTAASLAEGQPHARLYEALDAVLAA 120

Query: 121 HKIPSV---IGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGL 177
            +            V+ ELML+ ++G+ LDL+ C  TG   DL +VSPKSGGAV R+ G 
Sbjct: 121 IEYAPSARGWAAAAVRYELMLMADLGYALDLSACAATGARDDLAYVSPKSGGAVSRAAGE 180

Query: 178 PYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLL 237
           PYA ++L LP+FL       D   +    +LT +FL +  L          R+  + ++ 
Sbjct: 181 PYAARLLPLPAFLVDPSADSDWSDIVDGMRLTGHFLARDILVDRRADALDARQRLVDRIG 240

Query: 238 EL 239
            L
Sbjct: 241 RL 242


>gi|71083742|ref|YP_266462.1| recombination protein O [Candidatus Pelagibacter ubique HTCC1062]
 gi|91763222|ref|ZP_01265186.1| Recombination protein O [Candidatus Pelagibacter ubique HTCC1002]
 gi|71062855|gb|AAZ21858.1| Recombination protein O [Candidatus Pelagibacter ubique HTCC1062]
 gi|91717635|gb|EAS84286.1| Recombination protein O [Candidatus Pelagibacter ubique HTCC1002]
          Length = 226

 Score =  153 bits (387), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 49/237 (20%), Positives = 89/237 (37%), Gaps = 11/237 (4%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W D A ++    Y E +II EV T  +G+  G +  G S +++  LQ GN + VN+ S
Sbjct: 1   MNWDDSAYLVSKNRYSENSIIAEVFTENHGKISGIIFGGTSKKIKNYLQIGNKIYVNYNS 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           +    +G F+ E+L++        +  L  + S + L + L       +    L      
Sbjct: 61  KSVTRIGYFKIEILKALTPLYFDQNQKLSCITSAMHLIKLLTAEAQSNKEIFKLIDKFFE 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
                   + ++  EL LLK +G+ L+L       +    +    KS             
Sbjct: 121 ILNSENWIQKYIFWELELLKLLGYDLELKTMAEKEIVDSEVNYYVKSSTEKKSIPNFLID 180

Query: 181 EKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLL 237
           E  + +      +   +              +L K  L+ N ++    R +F+  L 
Sbjct: 181 ENNMDVNLKNLLKGLKL-----------VSDYLEKSILKPNNLNLPTSRTHFINLLK 226


>gi|119385562|ref|YP_916617.1| DNA repair protein RecO [Paracoccus denitrificans PD1222]
 gi|254764650|sp|A1B5X7|RECO_PARDP RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|119376157|gb|ABL70921.1| DNA repair protein RecO [Paracoccus denitrificans PD1222]
          Length = 242

 Score =  153 bits (385), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 72/237 (30%), Positives = 109/237 (45%), Gaps = 5/237 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W  +A ++ ++ +GE  +IL V++R+ G   G V  G S +   +LQ GN V + WR+
Sbjct: 1   MEWSGEASVMALQRHGESAVILTVLSRETGLIRGLVPGGASAKRAAMLQPGNRVSLRWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL + LG F  E   +    L S             L   LPER+P   L D     L+ 
Sbjct: 61  RLEEQLGTFAVEPARARPGLLGSGDALAGVNAVTALLTFALPERDPHPRLADATEALLDL 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
                   + ++  E+ LL  +GFGLDLT C VTG  + L +VSP+SG AV       +A
Sbjct: 121 MDAGEGWAEAYLHWEMRLLDELGFGLDLTSCAVTGAREGLAYVSPRSGRAVSAQAAGEWA 180

Query: 181 EKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHN-IIHCHLLRENFLGKL 236
            ++L LP+ L           ++ A  LT +FL     + +        R   + +L
Sbjct: 181 PRLLPLPAMLGGRGNGG----IEDALALTGHFLQVRLAEAHAGKPLPPARARLVARL 233


>gi|294012225|ref|YP_003545685.1| DNA repair protein RecO [Sphingobium japonicum UT26S]
 gi|292675555|dbj|BAI97073.1| DNA repair protein RecO [Sphingobium japonicum UT26S]
          Length = 244

 Score =  150 bits (379), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 67/239 (28%), Positives = 110/239 (46%), Gaps = 4/239 (1%)

Query: 5   DDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQ 64
             A++  +R +GE   I  ++T  +G   G+VR G+S R++P+L  GN V+  +R+R  +
Sbjct: 6   TPALVCALRPHGEHGAIARLLTPGHGLLAGYVRGGRSRRLRPVLLPGNAVKAEFRARTEE 65

Query: 65  NLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIP 124
            L     E+  S    L           +       LPE  P   L+  L+  L   +  
Sbjct: 66  QLAGLTVELEHSRAPLLAEPLPAAAIDWACALTAVALPEATPYPALHQALDGVLGAVEAA 125

Query: 125 S---VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAE 181
                     ++ EL+LL  +GFGLDL +C  TG   DL +VSP+S  AV R+  + Y +
Sbjct: 126 PAARGWATALIRYELLLLAELGFGLDLGRCAATGGNDDLAYVSPRSAAAVSRAGAVGYED 185

Query: 182 KMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLELI 240
           ++L LP+FL +         +    +LT +FL +  L    +     RE  + +L   +
Sbjct: 186 RLLPLPAFLLEGGAGEWPA-ILDGLRLTGFFLERSVLTDWRVDVLAARERLVDRLKRAV 243


>gi|258543012|ref|YP_003188445.1| DNA repair protein RecO [Acetobacter pasteurianus IFO 3283-01]
 gi|256634090|dbj|BAI00066.1| DNA repair protein RecO [Acetobacter pasteurianus IFO 3283-01]
 gi|256637150|dbj|BAI03119.1| DNA repair protein RecO [Acetobacter pasteurianus IFO 3283-03]
 gi|256640202|dbj|BAI06164.1| DNA repair protein RecO [Acetobacter pasteurianus IFO 3283-07]
 gi|256643259|dbj|BAI09214.1| DNA repair protein RecO [Acetobacter pasteurianus IFO 3283-22]
 gi|256646314|dbj|BAI12262.1| DNA repair protein RecO [Acetobacter pasteurianus IFO 3283-26]
 gi|256649367|dbj|BAI15308.1| DNA repair protein RecO [Acetobacter pasteurianus IFO 3283-32]
 gi|256652353|dbj|BAI18287.1| DNA repair protein RecO [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256655411|dbj|BAI21338.1| DNA repair protein RecO [Acetobacter pasteurianus IFO 3283-12]
          Length = 263

 Score =  149 bits (377), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 72/240 (30%), Positives = 113/240 (47%), Gaps = 6/240 (2%)

Query: 4   QDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLA 63
           +  A++L     GE +  + V+T  YG   G    G S   + + Q GN+V+ +   R A
Sbjct: 12  EAPALVLFAGVQGETSARVHVLTEDYGPLRGIAYGGASKAGRALWQPGNVVKTSLHKRSA 71

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPER-EPCLELYDMLNIFLNCHK 122
               +   E+L +  A+LL + L L  +QS+  L        +PC  L+      L    
Sbjct: 72  AAPLQISAELLYACAARLLDAPLALSMVQSVCVLADVTLPEADPCPFLFAETVRLLTFLG 131

Query: 123 IPSVI-----GKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGL 177
              VI         V+ E+ LL  +GFGLDL+ C VTG T++L +VSP++G AV      
Sbjct: 132 YDPVIAEREGMPHVVRWEMALLATLGFGLDLSACAVTGSTENLHYVSPRTGRAVSEEGAG 191

Query: 178 PYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLL 237
            + +++L LPSFL   EQT +A    +  +LT +FL + A     +     R+    +L 
Sbjct: 192 EWKDRLLPLPSFLQDTEQTGNAADWLAGLRLTGHFLARDAFGQRHLPLPAARQRLYDRLE 251


>gi|296535950|ref|ZP_06898099.1| recombination protein O [Roseomonas cervicalis ATCC 49957]
 gi|296263723|gb|EFH10199.1| recombination protein O [Roseomonas cervicalis ATCC 49957]
          Length = 250

 Score =  148 bits (373), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 81/238 (34%), Positives = 116/238 (48%), Gaps = 2/238 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M WQ  AI+L  R +GE   ++ V+T  +GRH G V  G S     + Q GNLV V WR 
Sbjct: 1   MEWQAPAIVLEARPHGEGAAVVSVLTEDHGRHAGLVHGGASRAQSGLWQPGNLVEVRWRG 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLF-RFLPEREPCLELYDMLNIFLN 119
           RLA+ LG    E++    A  L   L L  LQS   L    LPERE    ++  L   + 
Sbjct: 61  RLAEQLGSLSGEMVHPTAALALDEPLTLALLQSACALATDALPEREAQPRIFSGLLALMA 120

Query: 120 CHKIPSVIG-KIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
                +      +++ E +LL+ +G+GLDL+ C VTG  ++L  VSP+SG AV      P
Sbjct: 121 QLGRGAPALLADYIRWEALLLEGLGYGLDLSVCAVTGAAENLTHVSPRSGRAVSAEAAAP 180

Query: 179 YAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKL 236
           Y +++L LP FL   +   D        +LT +FL + A           RE  + ++
Sbjct: 181 YRDRLLPLPLFLLGGQDERDPAEWLKGLRLTGHFLERDAFGARHRAVPPARERLVSRI 238


>gi|307294438|ref|ZP_07574282.1| DNA repair protein RecO [Sphingobium chlorophenolicum L-1]
 gi|306880589|gb|EFN11806.1| DNA repair protein RecO [Sphingobium chlorophenolicum L-1]
          Length = 244

 Score =  146 bits (369), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 68/239 (28%), Positives = 111/239 (46%), Gaps = 4/239 (1%)

Query: 5   DDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQ 64
             A++  +R +GE   I  ++T  +G   G+VR G+S RM+P+L   N V+  +R+R  +
Sbjct: 6   TPALVCALRPHGEHGAIARLLTPDHGLLAGYVRGGRSRRMRPVLLPANAVKAEFRARTEE 65

Query: 65  NLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFL---NCH 121
            L     E+  S    L           +       LPE  P   LY  L+  L      
Sbjct: 66  QLAGLTVELDHSRAPLLAEPLPAAAIDWACALTAVALPEGTPYPALYQALDGVLGAVEAA 125

Query: 122 KIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAE 181
                     ++ EL++L  +GFGLDLT+C  TG   DL ++SP+S  AV R+    Y +
Sbjct: 126 PAARGWAAALIRYELLMLAELGFGLDLTRCAATGGRDDLAYISPRSAAAVSRAGAAGYED 185

Query: 182 KMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLELI 240
           ++L LP+FL +     D  ++    +LT +FL +  L    +     RE  + +L  ++
Sbjct: 186 RLLPLPAFLLEGG-AGDWPAILDGLRLTGFFLERSVLTDWRVDVLAARERLVDRLKRVV 243


>gi|329115619|ref|ZP_08244341.1| DNA repair protein RecO [Acetobacter pomorum DM001]
 gi|326695047|gb|EGE46766.1| DNA repair protein RecO [Acetobacter pomorum DM001]
          Length = 263

 Score =  146 bits (369), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 71/240 (29%), Positives = 113/240 (47%), Gaps = 6/240 (2%)

Query: 4   QDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLA 63
           +  A++L     GE +  + V+T  YG   G    G S   + + Q GN+V+ ++  R A
Sbjct: 12  EAPALVLFAGVQGETSARIHVLTEDYGPLRGIAYGGASKAGRALWQPGNVVKTSFHKRSA 71

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPER-EPCLELYDMLNIFLNCHK 122
               +   E+L +  A+LL + L L  +QS+  L        +PC  L+      L    
Sbjct: 72  AAPLQISGELLYACAARLLDAPLALGMVQSVCVLADVTLPEADPCPFLFAETVRLLTFLG 131

Query: 123 IPSVI-----GKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGL 177
              V+         V+ E+ LL  +GFGLDL+ C VTG T++L +VSP++G AV      
Sbjct: 132 YDPVVAEREGMPHVVRWEMALLVTLGFGLDLSACAVTGSTENLHYVSPRTGRAVSEEGAG 191

Query: 178 PYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLL 237
            + +++L LPSFL   EQT  A    +  +LT +FL + A     +     R+    +L 
Sbjct: 192 EWKDRLLPLPSFLRDTEQTGHAADWLAGLRLTGHFLARDAFGQRHLPLPAARQRLYDRLE 251


>gi|319898694|ref|YP_004158787.1| DNA repair protein RecO [Bartonella clarridgeiae 73]
 gi|319402658|emb|CBI76204.1| DNA repair protein RecO [Bartonella clarridgeiae 73]
          Length = 231

 Score =  142 bits (358), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 99/220 (45%), Positives = 140/220 (63%), Gaps = 1/220 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W++ AIILG R +GE ++ILE+MTRQ GR++G V+ G+S RM  +LQ GN V   W +
Sbjct: 1   MKWKEQAIILGTRQHGETSVILEIMTRQRGRYMGIVKGGRSRRMAFLLQPGNFVEAEWWA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG FR E L+ H ++L+     LY  Q +    R LPER+P   LYDML  F+  
Sbjct: 61  RLDEHLGLFRLEALDLHASRLIVLPEALYSFQLMASHLRLLPERDPHPVLYDMLYFFMQN 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P +  ++ V+ EL+LL+ +GFGLDL+ C VTG  + L +VSPKSG AVC  VG P+ 
Sbjct: 121 FDDPFINAELLVRFELLLLEELGFGLDLSCCAVTGRQEKLCYVSPKSGRAVCEEVGRPWK 180

Query: 181 EKMLVLPSFLWKEEQ-TIDADSLKSAFQLTDYFLNKYALQ 219
           +K+L LP FL ++    +D + +K    LTD+F N   L+
Sbjct: 181 DKLLFLPQFLARKTICPVDFNDIKKGLILTDFFFNTLCLE 220


>gi|310815097|ref|YP_003963061.1| DNA repair protein RecO [Ketogulonicigenium vulgare Y25]
 gi|308753832|gb|ADO41761.1| DNA repair protein RecO [Ketogulonicigenium vulgare Y25]
          Length = 241

 Score =  141 bits (356), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 76/222 (34%), Positives = 112/222 (50%), Gaps = 6/222 (2%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWR 59
           M  WQD+ I+L    +GE  +I +V T++ G+  G VR G   RMQP+L  GN + + WR
Sbjct: 1   MIDWQDEGILLTTHRHGEAGVIAQVFTQERGKISGLVRGGAGSRMQPVLIPGNQLSLRWR 60

Query: 60  SRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPERE-PCLELYDMLNIFL 118
           +RL  +LG  + E++ S    L+   L L    ++  L         P    Y      L
Sbjct: 61  ARLDDHLGSLQPELIRSRAGFLMQDRLSLAAGAAVTALLAATMPERVPHTAFYAQSTALL 120

Query: 119 NC---HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSV 175
           +        S+    ++Q E++LL+  GFGLDLT C VTG   DL +VSPKSG AV +S 
Sbjct: 121 DLVGVEDWQSLWPLAYLQWEMVLLREGGFGLDLTTCAVTGAADDLCYVSPKSGRAVSKSG 180

Query: 176 GLPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYA 217
              +AE++L LP+ +  E    D   +  A   T++FL    
Sbjct: 181 AGAWAERLLPLPAVMRGEGDA-DTSDILQALATTEWFLLHRL 221


>gi|157825871|ref|YP_001493591.1| DNA repair protein RecO [Rickettsia akari str. Hartford]
 gi|254764658|sp|A8GNV8|RECO_RICAH RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|157799829|gb|ABV75083.1| DNA repair protein RecO [Rickettsia akari str. Hartford]
          Length = 237

 Score =  138 bits (347), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 75/238 (31%), Positives = 124/238 (52%), Gaps = 3/238 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M  +D  +I+  +   E   I+ V T+ +G + G V+   S + + I Q GN+V   W++
Sbjct: 1   MNIKDVGVIISKKPLKENTFIITVCTKNHGLYSGVVK-ESSKKSKFIYQEGNIVDFLWQA 59

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL +++G  + E+++S+   L+ +   LY   SI+ L + L         +    +    
Sbjct: 60  RLHEHIGIAKCELIKSYTGYLIINKTKLYAFNSIISLIKELCHEREKHSNFFSFLLNYLD 119

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
           +   +   + ++  EL LL   G+ LDLTKC VT VT DL +VSPKS  A+   VG PY 
Sbjct: 120 NLSKNFCFRDYINFELTLLAKTGYKLDLTKCGVTHVTTDLTYVSPKSARALSYEVGKPYK 179

Query: 181 EKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLE 238
           +K+L+LP FL  ++  I  +  + A  LT+YF N+Y   +N       R+ F+G +L 
Sbjct: 180 DKLLILPKFLLSDDSEITLEEKRQALTLTNYFFNRYLFHNN--RQPEARQTFVGYILN 235


>gi|157964679|ref|YP_001499503.1| DNA repair protein RecO [Rickettsia massiliae MTU5]
 gi|157844455|gb|ABV84956.1| DNA repair protein RecO [Rickettsia massiliae MTU5]
          Length = 274

 Score =  138 bits (346), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 72/238 (30%), Positives = 121/238 (50%), Gaps = 3/238 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M  +D  +I+  +   E   I+ V T+ +G + G V+   S + +   Q GN+V   W++
Sbjct: 38  MNIKDIGVIIAKKPLKENTFIITVFTKNHGLYSGVVK-EFSRKSKFTYQEGNIVDFLWQA 96

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LG  + E+++S+    +++   LY   S++ L + L         +    I    
Sbjct: 97  RLHEHLGMAKCELIKSYTGYFITNKAKLYAFNSVISLIKELFHEREEHSKFCSFLINYLD 156

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
           +   +   + ++  EL LL   G+ LDLTKC V+ VT DL++VSPKS  A+   VG PY 
Sbjct: 157 NLSKNFCFRDYINFELALLAETGYKLDLTKCGVSHVTTDLIYVSPKSARALSYEVGKPYK 216

Query: 181 EKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLE 238
           +K+L+LP FL  +   I  +  + A  LT+YF N+Y   +N       R+ F+   L 
Sbjct: 217 DKLLMLPRFLLSDNIEITLEEKRQALALTNYFFNRYLFHNN--RQVEARQTFIEYTLN 272


>gi|157803626|ref|YP_001492175.1| DNA repair protein RecO [Rickettsia canadensis str. McKiel]
 gi|254790734|sp|A8EYF7|RECO_RICCK RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|157784889|gb|ABV73390.1| DNA repair protein RecO [Rickettsia canadensis str. McKiel]
          Length = 241

 Score =  137 bits (345), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 74/237 (31%), Positives = 121/237 (51%), Gaps = 3/237 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M  +D  +I+  +   E   I+ V T+ YG + G V+   S + + I Q GN+V   W +
Sbjct: 1   MNIKDIGVIVAKKPLKENTFIITVFTKNYGLYSGVVK-ASSKKSKFIYQEGNIVDFLWMA 59

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL +++G  + E+++S+    +++   LY   SI+ L + L         +    I    
Sbjct: 60  RLHEHIGIAKCELIKSYTGYFITNKTKLYAFNSIISLIKELLHEREEYSNFFSFLINYLD 119

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
           +       + ++  EL LL   G+ LDL+KC V+ V QDL +VSPKSG A+   VG PY 
Sbjct: 120 NLSKKFFFRDYINFELALLDIAGYKLDLSKCAVSNVKQDLYYVSPKSGRALSYEVGKPYK 179

Query: 181 EKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLL 237
           +K+L+LP FL  +   I  +  + A  LT+YF N+Y   +N       R+ F+  +L
Sbjct: 180 DKLLILPKFLLSDNSKITLEEKRQALTLTNYFFNRYLFHNN--RHAEARQAFMEYIL 234


>gi|91205107|ref|YP_537462.1| DNA repair protein RecO [Rickettsia bellii RML369-C]
 gi|157827560|ref|YP_001496624.1| DNA repair protein RecO [Rickettsia bellii OSU 85-389]
 gi|122425954|sp|Q1RJU1|RECO_RICBR RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|254790733|sp|A8GXI7|RECO_RICB8 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|91068651|gb|ABE04373.1| DNA repair protein RecO [Rickettsia bellii RML369-C]
 gi|157802864|gb|ABV79587.1| DNA repair protein RecO [Rickettsia bellii OSU 85-389]
          Length = 241

 Score =  136 bits (342), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 72/238 (30%), Positives = 119/238 (50%), Gaps = 3/238 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M  +D  +I+  +   E   I+ V T+ +G + G  +   S + + I Q GN+V   W++
Sbjct: 1   MNIKDIGVIIAKKPLKENTFIITVFTKNHGLYSGVAK-ESSKKSKFIYQEGNVVDFLWQA 59

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL +++G  + E+++S+    + +   LY   S++ L + L         +  L I    
Sbjct: 60  RLHEHIGIAKCELVKSYIGHFIINKAKLYAFNSVISLIKELFHEREEHYNFFSLLINYLD 119

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
           +   +     ++  EL LL  +G+ LD TKC V+  TQDL ++SPKSG AV   VG PY 
Sbjct: 120 NLAKNFCFHDYINFELALLAEMGYELDFTKCGVSNTTQDLAYLSPKSGRAVSYEVGAPYK 179

Query: 181 EKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLE 238
           +K+L LP FL      I  +  + A  LT YF N+Y    +      +R+ F+  +LE
Sbjct: 180 DKLLPLPKFLLSGNDKITLEEKRQALNLTSYFFNRYLF--HNHRQPEIRQVFVEYILE 235


>gi|51473730|ref|YP_067487.1| DNA repair protein RecO [Rickettsia typhi str. Wilmington]
 gi|81610783|sp|Q68WI7|RECO_RICTY RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|51460042|gb|AAU04005.1| possible RecO-like recombinational DNA repair protein [Rickettsia
           typhi str. Wilmington]
          Length = 236

 Score =  135 bits (340), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 71/239 (29%), Positives = 122/239 (51%), Gaps = 3/239 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M  +D  +I+  +   E   I+ V T+ +G + G ++   S + + I Q GN+V   W++
Sbjct: 1   MNIKDIGVIISKKPLKENTFIIRVFTKNHGLYSGVIK-ASSKKNKFIYQEGNIVDFLWQA 59

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL +++G  + E+++S+    + +   LY   S+  L + L        ++    I    
Sbjct: 60  RLHEHIGIAKCELIKSYTGYFIINKAKLYAFNSVKFLIQELFHEREEHSIFFAFLINYLD 119

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
           +   +   + ++  EL LL   G+ +DLTKC V+ VT DL +VSPKS  A+   VG PY 
Sbjct: 120 NLSKNFCFRDYINFELNLLAETGYKIDLTKCCVSHVTTDLTYVSPKSARALSYKVGKPYR 179

Query: 181 EKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLEL 239
           +K+L+LP FL  E+  I  +  K A  LT+YF N+Y   +N       R+ F+  +  +
Sbjct: 180 DKLLILPKFLLSEDSKITLEEKKQALTLTNYFFNRYLFHNN--RQVEARKEFIEYITNI 236


>gi|157828681|ref|YP_001494923.1| DNA repair protein RecO [Rickettsia rickettsii str. 'Sheila Smith']
 gi|165933400|ref|YP_001650189.1| DNA repair protein RecO [Rickettsia rickettsii str. Iowa]
 gi|254790735|sp|B0BY57|RECO_RICRO RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|254790736|sp|A8GSP0|RECO_RICRS RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|157801162|gb|ABV76415.1| DNA repair protein RecO [Rickettsia rickettsii str. 'Sheila Smith']
 gi|165908487|gb|ABY72783.1| DNA repair protein [Rickettsia rickettsii str. Iowa]
          Length = 237

 Score =  135 bits (340), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 71/238 (29%), Positives = 121/238 (50%), Gaps = 3/238 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M  +D  +I+  +   E   I+ V T+ +G + G V+   S + + I Q GN++   W++
Sbjct: 1   MNIKDIGVIIAKKPLKENTFIITVFTKNHGLYSGVVK-EFSKKSKFIYQEGNIIDFLWQA 59

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL +++G  + E+++S+    +++   LY   S++ L + L         +    I    
Sbjct: 60  RLHEHIGMAKCELIKSYTGYFITNKTKLYAFNSVISLIKELFHEREEHSKFFSFLINYLD 119

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
           +       + ++  EL LL   G+ LDLTKC V+ VT DL++VSPKS  A+   VG PY 
Sbjct: 120 NLSKHFCFRDYINFELALLAETGYKLDLTKCGVSHVTTDLIYVSPKSARALSYEVGKPYK 179

Query: 181 EKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLE 238
           +K+L+LP FL  +   I  +  + A  LT+YF N+Y   +N       R+ F+   L 
Sbjct: 180 DKLLMLPRFLLSDNSEITLEEKRQALALTNYFFNRYLFHNN--RQVEARQTFIEYTLN 235


>gi|15892735|ref|NP_360449.1| DNA repair protein RecO [Rickettsia conorii str. Malish 7]
 gi|34581542|ref|ZP_00143022.1| hypothetical protein [Rickettsia sibirica 246]
 gi|81595557|sp|Q92HF9|RECO_RICCN RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|15619911|gb|AAL03350.1| unknown [Rickettsia conorii str. Malish 7]
 gi|28262927|gb|EAA26431.1| unknown [Rickettsia sibirica 246]
          Length = 237

 Score =  135 bits (339), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 71/238 (29%), Positives = 122/238 (51%), Gaps = 3/238 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M  +D  +I+  +   E   I+ V T+ +G + G V+   S + + I Q GN++   W++
Sbjct: 1   MNIKDIGVIIAKKPLKENTFIITVFTKNHGLYSGVVK-EFSKKSKFIYQEGNIIDFLWQA 59

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL +++G  + E+++S+    +++   LY   S++ L + L         +    I    
Sbjct: 60  RLHEHIGMAKCELIKSYTGYFITNKAKLYAFNSVISLIKELFHEREEHSKFFSFLINYLD 119

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
           +   +   + ++  EL LL   G+ LDLTKC V+ VT DL++VSPKS  A+   VG PY 
Sbjct: 120 NLSKNFCFRDYINFELALLAETGYKLDLTKCGVSHVTTDLIYVSPKSARALSYEVGKPYK 179

Query: 181 EKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLE 238
           +K+L+LP FL  +   I  +  + A  LT+YF N+Y   +N       R+ F+   L 
Sbjct: 180 DKLLMLPRFLLSDNSEITLEEKRQALALTNYFFNRYLFHNN--RQVEARQTFIEYTLN 235


>gi|239947680|ref|ZP_04699433.1| DNA repair protein RecO [Rickettsia endosymbiont of Ixodes
           scapularis]
 gi|239921956|gb|EER21980.1| DNA repair protein RecO [Rickettsia endosymbiont of Ixodes
           scapularis]
          Length = 234

 Score =  135 bits (339), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 75/237 (31%), Positives = 122/237 (51%), Gaps = 3/237 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M  +D  +I+  +   E   I+ V T+ +G + G V+   S + + I Q GN+V   W++
Sbjct: 1   MNIKDIGVIIAKKPLKENTFIITVFTKNHGLYSGVVK-ESSKKSKFIYQEGNIVDFLWQA 59

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL +++G  + E+++S+    + +   LY   S++ L + L         +    I    
Sbjct: 60  RLHEHIGMAKCELIKSYTGYFIINKAKLYAFNSVISLIKELFHEREEHSNFFSFLINYLD 119

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
           +   +   + ++  EL LL   G+ LDLTKC V+ VT DL +VSPKSG A+   VG PY 
Sbjct: 120 NLSKNFCFRDYINFELALLAETGYKLDLTKCDVSHVTTDLTYVSPKSGRALSYKVGKPYK 179

Query: 181 EKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLL 237
           +K+L+LP FL  E   I  +  K A  LT+YF N+Y   +N       R+ F+  +L
Sbjct: 180 DKLLILPRFLLSENSEITLEEKKQAITLTNYFFNRYLFHNN--RQAEARQAFMEYIL 234


>gi|148284965|ref|YP_001249055.1| DNA repair protein RecO [Orientia tsutsugamushi str. Boryong]
 gi|254764648|sp|A5CF17|RECO_ORITB RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|146740404|emb|CAM80867.1| DNA repair protein [Orientia tsutsugamushi str. Boryong]
          Length = 241

 Score =  134 bits (338), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 81/239 (33%), Positives = 127/239 (53%), Gaps = 4/239 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M ++D AIIL  R+  E   I+ V+T+ YG + G +++  S +   I Q GN+V   W +
Sbjct: 1   MNFRDKAIILKKRNIKENLAIVTVLTQSYGIYSGIIKDLHSKKNTIIYQIGNIVDFCWSA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSL-FLYGLQSIVPLFRFLPEREPCLELYDMLNIFLN 119
           RL ++LG    E+++S+   ++S+     Y    I        ERE    L++     L 
Sbjct: 61  RLDKHLGTINCELVKSYSYLIMSNKRNLFYTHSLIELTLMSFKERELHANLFEKWLGNLE 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
              + ++  K ++  EL++LK  G+ L L +C VT  TQ+L++VSPKSG A+  +VG PY
Sbjct: 121 SINVGNINIKNYINFELLILKEAGYQLTLDRCGVTNCTQNLIYVSPKSGQAISAAVGEPY 180

Query: 180 AEKMLVLPSFLWKEE-QTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLL 237
             K+L+LP FL     +  D   +++AF LT YF NKY L        + RE  L  +L
Sbjct: 181 KHKLLLLPKFLVHNNCEPEDIYEIQAAFNLTAYFFNKYVLI--KKKLPIARELLLKSIL 237


>gi|15604714|ref|NP_220921.1| DNA repair protein RecO [Rickettsia prowazekii str. Madrid E]
 gi|292572163|gb|ADE30078.1| DNA repair protein RecO [Rickettsia prowazekii Rp22]
          Length = 236

 Score =  134 bits (338), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 72/239 (30%), Positives = 123/239 (51%), Gaps = 3/239 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M  +D  +I+  +   E   I+ V T+ +G + G ++   S + + I Q GN+V   W++
Sbjct: 1   MNIKDIGVIISKKPLKENTFIIRVFTKNHGLYSGVIK-ESSKKNKFIYQEGNIVDFLWKA 59

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL +++G  + E+++S+    + +   LY   S++ L + L        ++    I    
Sbjct: 60  RLHEHIGIAKCELIKSYTGYFIINKAKLYAFNSVISLIQELFHEREEHSIFFSFLINYLD 119

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
           +   +   + ++  EL LL   G+ LDLTKC V+ VT DL +VSPKS  A+   VG PY 
Sbjct: 120 NLSKNFCFRDYISFELNLLAETGYKLDLTKCCVSHVTTDLTYVSPKSARALSYKVGKPYR 179

Query: 181 EKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLEL 239
           +K+L+LP FL  ++  I  +  K A  LT+YF N+Y   +N       RE F+  +  +
Sbjct: 180 DKLLILPKFLLAKDSEITLEEKKQALTLTNYFFNRYLFHNN--RQVKAREEFIEYITNI 236


>gi|189184083|ref|YP_001937868.1| DNA repair protein RecO [Orientia tsutsugamushi str. Ikeda]
 gi|254764649|sp|B3CTD7|RECO_ORITI RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|189180854|dbj|BAG40634.1| DNA repair protein RecO [Orientia tsutsugamushi str. Ikeda]
          Length = 241

 Score =  134 bits (338), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 83/240 (34%), Positives = 129/240 (53%), Gaps = 4/240 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M ++D AIIL  R+  E   I+ V+T+ YG + G +++  S +   I Q GN+V   W +
Sbjct: 1   MNFRDKAIILKKRNIKENLAIVTVLTQSYGIYSGIIKDLHSKKNTIIYQIGNIVDFCWSA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSL-FLYGLQSIVPLFRFLPEREPCLELYDMLNIFLN 119
           RL ++LG    E+++S+   ++S+    LY    I        ERE    L++     L 
Sbjct: 61  RLDEHLGTINCELVKSYSYLIMSNKRNLLYTHSLIELTLMSFKERELHANLFEKWLENLE 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                ++  K ++  EL++LK  G+ L+L +C VT  TQ+L++VSPKSG A+  +VG PY
Sbjct: 121 SINTGNINVKNYINFELLILKEAGYRLNLDRCGVTNCTQNLIYVSPKSGQAISATVGEPY 180

Query: 180 AEKMLVLPSFLWKEE-QTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLE 238
             K+L+LP FL     +  D   +++AF LT YF NKY L        + RE  L  +LE
Sbjct: 181 KHKLLLLPKFLVHNNCEPEDIYEIQAAFNLTAYFFNKYILI--KKKLPITRELLLKSILE 238


>gi|238650314|ref|YP_002916166.1| DNA repair protein RecO [Rickettsia peacockii str. Rustic]
 gi|259563684|sp|C4K0L7|RECO_RICPU RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|238624412|gb|ACR47118.1| DNA repair protein RecO [Rickettsia peacockii str. Rustic]
          Length = 237

 Score =  134 bits (337), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 71/238 (29%), Positives = 123/238 (51%), Gaps = 3/238 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M  +D  +I+  +   E   I+ V T+ +G + G V+   S + + I Q GN++   W++
Sbjct: 1   MNIKDIGVIIAKKPLKENTFIITVFTKNHGLYSGVVK-EFSKKSKFIYQEGNIIDFLWQA 59

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL +++G  + E+++S+    +++   LY   S++ L + L         + +  I    
Sbjct: 60  RLHEHIGMAKCELIKSYTGYFITNKAKLYAFNSVISLIKELFHEREEHSKFFLFLINYLD 119

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
           +   +   + ++  EL LL   G+ LDLTKC V+ VT DL++VSPKS  A+   VG PY 
Sbjct: 120 NLSKNFCFRDYINFELALLAETGYKLDLTKCGVSHVTTDLIYVSPKSARALSYEVGKPYK 179

Query: 181 EKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLE 238
           +K+L+LP FL  +   I  +  + A  LT+YF N+Y   +N       R+ F+   L 
Sbjct: 180 DKLLMLPRFLLSDNSEITLEEKRQALALTNYFFNRYLFHNN--RQVEARQTFIEYTLN 235


>gi|67459260|ref|YP_246884.1| DNA repair protein RecO [Rickettsia felis URRWXCal2]
 gi|75536308|sp|Q4UL54|RECO_RICFE RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|67004793|gb|AAY61719.1| DNA repair protein RecO [Rickettsia felis URRWXCal2]
          Length = 237

 Score =  134 bits (337), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 73/238 (30%), Positives = 122/238 (51%), Gaps = 3/238 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M  +D  +I+  +   E   I+ V T+ +G + G V+   S + + I Q GN+V   W++
Sbjct: 1   MNIKDVGVIIAKKPLKENTFIITVFTKNHGLYSGVVK-ESSKKSKFIYQEGNIVDFLWQA 59

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL +++G  + E+++S+    + +   LY   S++ L + L         +    I    
Sbjct: 60  RLHEHIGMAKCELIKSYTGYFIINKAKLYAFNSVISLIKELFHEREEHSNFFSFLINYLD 119

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
           +   +   + ++  EL LL   G+ LDLTKC VT VT DL +VSPKS  A+   VG PY 
Sbjct: 120 NLSKNFCFRDYINFELALLAETGYKLDLTKCGVTHVTTDLNYVSPKSARALSYEVGKPYK 179

Query: 181 EKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLE 238
           +K+L+LP FL  ++  I  +  + A  LT+YF N+Y   +N       R+ F+  +L 
Sbjct: 180 DKLLILPKFLLSDDSEITLEEKRQASTLTNYFFNRYLFHNN--RQAEARQIFMEYILN 235


>gi|301154943|emb|CBW14406.1| gap repair protein [Haemophilus parainfluenzae T3T1]
          Length = 234

 Score =  133 bits (333), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 39/240 (16%), Positives = 78/240 (32%), Gaps = 12/240 (5%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNW 58
           M  Q    +L  R Y E ++++++ T + GR     +  ++ R   + +LQ    + + W
Sbjct: 1   MDLQ-RGFVLHRRPYSETSLLVDLFTEETGRLTVIAKGARAKRSAWKSVLQPFTPLLLRW 59

Query: 59  RSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFL 118
             + A            +     L  +    G      + R +       +L+      L
Sbjct: 60  SGKGALKTLTKAEPAAITLP---LQQTALYSGFYVNELITRVIEPETANPQLFQHYLQCL 116

Query: 119 NCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
                   +       E  LLK +G+G+D   C  +G+  D              +  + 
Sbjct: 117 TGLATQPQVEPTLRLFEFHLLKILGYGIDFLHCAGSGLPVDESMTYQYRAEKGFIASLVK 176

Query: 179 YAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENFLGKLL 237
                       +   +  D   L++A + T     + AL+  +       RE F   +L
Sbjct: 177 DNLTFYGRDLLAFDRLEFTDEAVLQAAKRFT-----RIALKPYLGDKPLKSRELFTQNVL 231


>gi|325577292|ref|ZP_08147776.1| recombination protein O [Haemophilus parainfluenzae ATCC 33392]
 gi|325160874|gb|EGC72995.1| recombination protein O [Haemophilus parainfluenzae ATCC 33392]
          Length = 234

 Score =  132 bits (332), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 39/240 (16%), Positives = 77/240 (32%), Gaps = 12/240 (5%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNW 58
           M  Q    +L  R Y E ++++++ T + GR     +  ++ R   + +LQ    + + W
Sbjct: 1   MDLQ-RGFVLHRRPYSETSLLVDLFTEETGRLTVIAKGARAKRSAWKSVLQPFTPLLLRW 59

Query: 59  RSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFL 118
             + A            +     L  +    G      + R +       +L+      L
Sbjct: 60  SGKGALKTLTKAEPAAITLP---LQQTALYSGFYVNELITRVIEPETANPQLFQHYLQCL 116

Query: 119 NCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
                   +       E  LLK +G+G+D   C  +G+  D              +  + 
Sbjct: 117 TGLATQPQVEPTLRLFEFHLLKILGYGIDFLHCAGSGLPVDESMTYQYRAEKGFIASLVK 176

Query: 179 YAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENFLGKLL 237
                       +   +  D   L +A + T     + AL+  +       RE F   +L
Sbjct: 177 DNLTFYGRDLLAFDRLEFTDESVLLAAKRFT-----RIALKPYLGDKPLKSRELFTQNVL 231


>gi|229586870|ref|YP_002845371.1| DNA repair protein RecO [Rickettsia africae ESF-5]
 gi|259563683|sp|C3PNW8|RECO_RICAE RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|228021920|gb|ACP53628.1| DNA repair protein RecO [Rickettsia africae ESF-5]
          Length = 237

 Score =  132 bits (332), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 71/238 (29%), Positives = 124/238 (52%), Gaps = 3/238 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M  +D  +I+  ++  E   I+ V T+ +G + G V+   S + + I Q GN++   W++
Sbjct: 1   MNIKDIGVIIAKKTLKENTFIITVFTKNHGLYSGVVK-EFSKKSKFIYQEGNIIDFLWQA 59

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL +++G  + E+++S+    +++   LY   S++ L + L         +    I    
Sbjct: 60  RLHEHIGMAKCELIKSYTGYFITNKAKLYAFNSVISLIKELFHEREEHSKFFSFLINYLD 119

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
           +   +   + ++  EL LL   G+ LDLTKC V+ VT DL++VSPKS  A+  +VG PY 
Sbjct: 120 NLSKNFCFRDYINFELALLAETGYKLDLTKCGVSHVTTDLIYVSPKSARALSYAVGKPYK 179

Query: 181 EKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLE 238
           +K+L+LP FL  +   I  +  + A  LT+YF N+Y   +N       R+ F+   L 
Sbjct: 180 DKLLMLPRFLLSDNSEITLEEKRQALALTNYFFNRYLFHNN--RQVEARQTFIEYTLN 235


>gi|218670194|ref|ZP_03519865.1| DNA repair protein RecO [Rhizobium etli GR56]
          Length = 190

 Score =  132 bits (331), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 86/181 (47%), Positives = 119/181 (65%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M WQD AIILGV+ +GE ++I EVMTR  GRHLG VR+G+S  MQP+LQ GN V V WR+
Sbjct: 1   MQWQDHAIILGVKRHGETSVIAEVMTRDRGRHLGLVRSGRSRAMQPVLQPGNAVEVIWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LGEFR E +    A+L+ ++  +YG+Q++  L R LPER+P   L+D L + L+ 
Sbjct: 61  RLDEHLGEFRVEPVTLRAARLMETATAVYGVQAMGALLRLLPERDPHPHLFDALEVILDH 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
              P+  G++FV+ EL +L ++GFGLDL +C  TG   DL +VSPKS          P+ 
Sbjct: 121 LHNPADAGELFVRFELAVLNDLGFGLDLAECAATGDRSDLAYVSPKSRPRRQPQRRAPWR 180

Query: 181 E 181
            
Sbjct: 181 T 181


>gi|68171672|ref|ZP_00545033.1| recO-related protein [Ehrlichia chaffeensis str. Sapulpa]
 gi|88658325|ref|YP_507349.1| DNA repair protein RecO [Ehrlichia chaffeensis str. Arkansas]
 gi|123493398|sp|Q2GGT4|RECO_EHRCR RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|67998907|gb|EAM85598.1| recO-related protein [Ehrlichia chaffeensis str. Sapulpa]
 gi|88599782|gb|ABD45251.1| putative DNA repair protein RecO [Ehrlichia chaffeensis str.
           Arkansas]
          Length = 244

 Score =  132 bits (331), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 66/242 (27%), Positives = 109/242 (45%), Gaps = 8/242 (3%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M WQD  I++ +R YG+  II+ + T+++G   G  +   S +    LQ G+ V V W S
Sbjct: 1   MRWQDQGIVIAIRKYGDDQIIISIFTQKHGLKKGLAKY--SKKATHRLQIGDYVNVTWSS 58

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL  NLG F++E+++S     +  +L    +     +   +        +          
Sbjct: 59  RLISNLGCFKYELIKSTLYHYIQDNLKTMCIAFSTVILDQVLPENEENYIIYNCLDIFIN 118

Query: 121 HKIPSVIGKIFVQ--IELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
                 I        +EL LL  +GFGLDL++C V    ++L ++SPK+G AV ++VGLP
Sbjct: 119 SIQFQDINWKIKYLRLELTLLSELGFGLDLSRCAVNNTNENLTFISPKTGKAVSKTVGLP 178

Query: 179 YAEKMLVLPSFLWKEEQT----IDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLG 234
           Y++ +L LP  L+               K +  +  YF  K+ L          RE  + 
Sbjct: 179 YSKSLLPLPQLLYDVYNNYEYKYSKTDFKLSLNVLGYFFKKHFLTEKNTILIKYREEIIK 238

Query: 235 KL 236
            +
Sbjct: 239 LI 240


>gi|262273708|ref|ZP_06051521.1| DNA recombination and repair protein RecO [Grimontia hollisae CIP
           101886]
 gi|262222123|gb|EEY73435.1| DNA recombination and repair protein RecO [Grimontia hollisae CIP
           101886]
          Length = 237

 Score =  129 bits (324), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 46/242 (19%), Positives = 77/242 (31%), Gaps = 12/242 (4%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNW 58
           M       +L  R Y E ++IL+V +  +GR     +  +  R   +  LQ    + + W
Sbjct: 1   MEGLQRCFVLHSRPYSETSLILDVFSENHGRVSLMAKGARGKRSPLKGALQPFTPLLMKW 60

Query: 59  RSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFL 118
             R                 A  LS +    G      L R +       +L+      L
Sbjct: 61  SGRGE---MHTLRHAEAMGLAIPLSGNALFSGFYLNEILSRVVEPETAYHQLFYDYVTAL 117

Query: 119 NCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
                         + EL LL ++G+G+D   C  +G   D              +  + 
Sbjct: 118 TELAQHRNPEPALRRFELALLDSLGYGVDFLHCAGSGEPVDETMTYIFREQQGFVASLMK 177

Query: 179 YAEKMLVLPSF-LWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENFLGKL 236
               M            Q   A+ LK+A + T     + AL+  +       RE FL + 
Sbjct: 178 SNTLMFTGSDLKALATRQFSTAEQLKAAKRFT-----RLALKPYLGPKPLKSRELFLLRT 232

Query: 237 LE 238
            +
Sbjct: 233 RK 234


>gi|229846418|ref|ZP_04466526.1| DNA repair protein RecO [Haemophilus influenzae 7P49H1]
 gi|229810511|gb|EEP46229.1| DNA repair protein RecO [Haemophilus influenzae 7P49H1]
 gi|309972510|gb|ADO95711.1| DNA repair protein RecO [Haemophilus influenzae R2846]
          Length = 236

 Score =  128 bits (322), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 36/235 (15%), Positives = 73/235 (31%), Gaps = 11/235 (4%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLA 63
              +L  R Y E ++++++ T + GR     +  ++ R   + +LQ    + + W  +  
Sbjct: 7   RGFVLHRRPYSETSLLVDLFTEESGRLTVIAKGARAKRSSWKSVLQPFTPLLLRWTGKST 66

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKI 123
                       +     L       G      L R +    P   L+      L     
Sbjct: 67  LKTLTKAEPAAITLP---LQQIALYSGFYVNELLTRVIESETPNPALFQHYLKCLTGLAT 123

Query: 124 PSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKM 183
            + +       E  LL+ +G+G+D   C  +G   D              +  +      
Sbjct: 124 ETNVEPTLRLFEFQLLQILGYGVDFLHCAGSGEPVDFSMTYRYREEKGFVASLVKDNLTF 183

Query: 184 LVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENFLGKLL 237
                  ++     D    ++A + T     + AL+  +       RE F   +L
Sbjct: 184 YGRDLLAFEALDFSDDAVRQAAKRFT-----RIALKPYLGDKPLKSRELFTQNIL 233


>gi|148825386|ref|YP_001290139.1| DNA repair protein RecO [Haemophilus influenzae PittEE]
 gi|166221893|sp|A5UAF5|RECO_HAEIE RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|148715546|gb|ABQ97756.1| DNA repair protein RecO [Haemophilus influenzae PittEE]
          Length = 236

 Score =  128 bits (322), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 36/235 (15%), Positives = 73/235 (31%), Gaps = 11/235 (4%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLA 63
              +L  R Y E ++++++ T + GR     +  ++ R   + +LQ    + + W  +  
Sbjct: 7   RGFVLHRRPYSETSLLVDLFTEESGRLTVIAKGARAKRSSWKSVLQPFTPLLLRWTGKST 66

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKI 123
                       +     L       G      L R +    P   L+      L     
Sbjct: 67  LKTLTKAEPAAITLP---LQQITLYSGFYVNELLTRVIESETPNPALFQHYLKCLTGLAT 123

Query: 124 PSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKM 183
            + +       E  LL+ +G+G+D   C  +G   D              +  +      
Sbjct: 124 ETNVEPTLRLFEFQLLQILGYGVDFLHCAGSGEPVDFSMTYRYREEKGFVASLVKDNLTF 183

Query: 184 LVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENFLGKLL 237
                  ++     D    ++A + T     + AL+  +       RE F   +L
Sbjct: 184 YGRDLLAFEALDFSDDAVRQAAKRFT-----RIALKPYLGDKPLKSRELFTQNIL 233


>gi|260913269|ref|ZP_05919751.1| recombination protein O [Pasteurella dagmatis ATCC 43325]
 gi|260632856|gb|EEX51025.1| recombination protein O [Pasteurella dagmatis ATCC 43325]
          Length = 237

 Score =  128 bits (321), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 39/240 (16%), Positives = 80/240 (33%), Gaps = 13/240 (5%)

Query: 2   YWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWR 59
            WQ    +L  ++Y E ++++++ T + GR     +  ++ R   + +LQ    + + W 
Sbjct: 4   NWQ-RGFVLHRKAYSETSLLVDLFTEESGRLTVIAKGARAKRSSLKSVLQPFTPLLLRWT 62

Query: 60  SRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLN 119
            +              +  A  L  +    G      L R L       +L+      L 
Sbjct: 63  GKGELKTLTKAEP---AAIALPLQHTALYSGFYVNELLSRVLEPETAYPQLFQNYLRCLT 119

Query: 120 CHK-IPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
                   +       E  LL  +G+G+D   C  +G   D              +  + 
Sbjct: 120 GLASNTQQVEPYLRHFEFELLHTLGYGVDFCHCAGSGKIVDENMTYRYREEKGFIASLIK 179

Query: 179 YAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENFLGKLL 237
                       ++  +  D  +L++A + T     + AL+  + +     RE F   +L
Sbjct: 180 DNLTFYGRDLLAFEAREFHDPATLQAAKRFT-----RMALKPYLGNKPLKSRELFTQYVL 234


>gi|68248937|ref|YP_248049.1| DNA repair protein RecO [Haemophilus influenzae 86-028NP]
 gi|81336652|sp|Q4QNK8|RECO_HAEI8 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|68057136|gb|AAX87389.1| DNA repair protein RecO [Haemophilus influenzae 86-028NP]
          Length = 236

 Score =  128 bits (321), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 36/235 (15%), Positives = 73/235 (31%), Gaps = 11/235 (4%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLA 63
              +L  R Y E ++++++ T + GR     +  ++ R   + +LQ    + + W  +  
Sbjct: 7   RGFVLHRRPYSETSLLVDLFTEESGRLTVIAKGARAKRSSWKSVLQPFTPLLLRWTGKST 66

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKI 123
                       +     L       G      L R +    P   L+      L     
Sbjct: 67  LKTLTKAEPAAITLP---LQQIALYSGFYVNELLTRVIESETPNPALFQHYLKCLTGLAT 123

Query: 124 PSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKM 183
            + +       E  LL+ +G+G+D   C  +G   D              +  +      
Sbjct: 124 ETNVEPTLRLFEFQLLQMLGYGVDFLHCAGSGEPVDFSMTYRYREEKGFVASLVKDNLTF 183

Query: 184 LVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENFLGKLL 237
                  ++     D    ++A + T     + AL+  +       RE F   +L
Sbjct: 184 YGRDLLAFEALDFSDDAVRQAAKRFT-----RIALKPYLGDKPLKSRELFTQNIL 233


>gi|145628684|ref|ZP_01784484.1| DNA repair protein RecO [Haemophilus influenzae 22.1-21]
 gi|145638757|ref|ZP_01794366.1| DNA repair protein RecO [Haemophilus influenzae PittII]
 gi|144979154|gb|EDJ88840.1| DNA repair protein RecO [Haemophilus influenzae 22.1-21]
 gi|145272352|gb|EDK12260.1| DNA repair protein RecO [Haemophilus influenzae PittII]
 gi|309750247|gb|ADO80231.1| DNA repair protein RecO [Haemophilus influenzae R2866]
          Length = 236

 Score =  128 bits (321), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 37/235 (15%), Positives = 73/235 (31%), Gaps = 11/235 (4%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLA 63
              +L  R Y E ++++++ T + GR     +  ++ R   + +LQ    + + W  +  
Sbjct: 7   RGFVLHRRPYSETSLLVDLFTEESGRLTVIAKGARTKRSPWKSVLQPFTPLLLRWTGKST 66

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKI 123
                       +     L       G      L R +    P   L+      L     
Sbjct: 67  LKTLTKAEPAAITLP---LQQIALYSGFYVNELLTRVIEPETPNPALFQYYLKCLTGLAT 123

Query: 124 PSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKM 183
            + I       E  LL+ +G+G+D   C  +G   D              +  +      
Sbjct: 124 ETNIEPTLRLFEFQLLQILGYGVDFLHCAGSGEPVDFSMTYRYREEKGFIASLVKDNLSF 183

Query: 184 LVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENFLGKLL 237
                  ++     D    ++A + T     + AL+  +       RE F   +L
Sbjct: 184 YGRDLLAFEALDFSDNAVRQAAKRFT-----RIALKPYLGDKPLKSRELFTQNIL 233


>gi|145634671|ref|ZP_01790380.1| DNA repair protein RecO [Haemophilus influenzae PittAA]
 gi|229844576|ref|ZP_04464716.1| DNA repair protein RecO [Haemophilus influenzae 6P18H1]
 gi|145268216|gb|EDK08211.1| DNA repair protein RecO [Haemophilus influenzae PittAA]
 gi|229812825|gb|EEP48514.1| DNA repair protein RecO [Haemophilus influenzae 6P18H1]
          Length = 236

 Score =  128 bits (320), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 37/235 (15%), Positives = 73/235 (31%), Gaps = 11/235 (4%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLA 63
              +L  R Y E ++++++ T + GR     +  ++ R   + +LQ    + + W  +  
Sbjct: 7   RGFVLHRRPYSETSLLVDLFTEESGRLTVIAKGARAKRSSWKSVLQPFTPLLLRWTGKST 66

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKI 123
                       +     L       G      L R +    P   L+      L     
Sbjct: 67  LKTLTKAEPAAITLP---LQQIALYSGFYVNELLTRVIESETPNPALFQHYLKCLTGLAT 123

Query: 124 PSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKM 183
            + I       E  LL+ +G+G+D   C  +G   D              +  +      
Sbjct: 124 ETNIEPTLRLFEFQLLQILGYGVDFLHCAGSGKPVDFSMTYRYREEKGFVASLVKDNLTF 183

Query: 184 LVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENFLGKLL 237
                  ++     D    ++A + T     + AL+  +       RE F   +L
Sbjct: 184 YGRDLLAFEALDFSDDAVRQAAKRFT-----RIALKPYLGDKPLKSRELFTQNIL 233


>gi|145640278|ref|ZP_01795862.1| DNA repair protein RecO [Haemophilus influenzae R3021]
 gi|145274864|gb|EDK14726.1| DNA repair protein RecO [Haemophilus influenzae 22.4-21]
          Length = 236

 Score =  128 bits (320), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 36/235 (15%), Positives = 73/235 (31%), Gaps = 11/235 (4%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLA 63
              +L  R Y E ++++++ T + GR     +  ++ R   + +LQ    + + W  +  
Sbjct: 7   RGFVLHRRPYSETSLLVDLFTEESGRLTVIAKGARTKRSSWKSVLQPFTPLLLRWTGKST 66

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKI 123
                       +     L       G      L R +    P   L+      L     
Sbjct: 67  LKTLTKAEPAAITLP---LQQIALYSGFYVNELLTRVIESETPNPALFQHYLKCLTGLAT 123

Query: 124 PSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKM 183
            + +       E  LL+ +G+G+D   C  +G   D              +  +      
Sbjct: 124 ETNVEPTLRLFEFQLLQILGYGVDFLHCAGSGEPVDCTMTYRYREEKGFIASLVKDNLTF 183

Query: 184 LVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENFLGKLL 237
                  ++     D    ++A + T     + AL+  +       RE F   +L
Sbjct: 184 YGRDLLAFEALDFSDDAVRQAAKRFT-----RIALKPYLGDKPLKSRELFTQNIL 233


>gi|28899344|ref|NP_798949.1| DNA repair protein RecO [Vibrio parahaemolyticus RIMD 2210633]
 gi|260365943|ref|ZP_05778433.1| DNA repair protein RecO [Vibrio parahaemolyticus K5030]
 gi|260878965|ref|ZP_05891320.1| DNA repair protein RecO [Vibrio parahaemolyticus AN-5034]
 gi|260898318|ref|ZP_05906814.1| DNA repair protein RecO [Vibrio parahaemolyticus Peru-466]
 gi|260899639|ref|ZP_05908034.1| DNA repair protein RecO [Vibrio parahaemolyticus AQ4037]
 gi|31340321|sp|Q87LP1|RECO_VIBPA RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|28807580|dbj|BAC60833.1| DNA repair protein RecO [Vibrio parahaemolyticus RIMD 2210633]
 gi|308085237|gb|EFO34932.1| DNA repair protein RecO [Vibrio parahaemolyticus Peru-466]
 gi|308090490|gb|EFO40185.1| DNA repair protein RecO [Vibrio parahaemolyticus AN-5034]
 gi|308110552|gb|EFO48092.1| DNA repair protein RecO [Vibrio parahaemolyticus AQ4037]
 gi|308113207|gb|EFO50747.1| DNA repair protein RecO [Vibrio parahaemolyticus K5030]
 gi|328474123|gb|EGF44928.1| DNA repair protein RecO [Vibrio parahaemolyticus 10329]
          Length = 243

 Score =  128 bits (320), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 43/229 (18%), Positives = 76/229 (33%), Gaps = 11/229 (4%)

Query: 8   IILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLAQN 65
            +L  R Y E ++IL+V + +YGR     +  +S R   +  LQ    + + W  + +  
Sbjct: 13  FVLHRRPYSESSLILDVFSEEYGRITLMAKGARSKRSNLKGALQPFTPLLLKWSGKGS-- 70

Query: 66  LGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPS 125
             +   +         L        +     + R L    P   L+      L       
Sbjct: 71  -MKTLRQAEPISLGLPLFGINLYSAMYVNELVGRVLMAEVPMPALFHDYLHALTELAQCE 129

Query: 126 VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKMLV 185
                  + EL LL ++G+G+D   C  TG   D              +         L 
Sbjct: 130 NPEPALRRFELALLSSMGYGVDFLHCAGTGEPVDPEMTYRYREQKGFIASVRRDNLTFLG 189

Query: 186 LPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENFL 233
                  E + +  + LK+A + T     + AL+  +       RE F+
Sbjct: 190 NELIAISERRFVTKEQLKAAKRFT-----RIALKPYLGGKPLKSRELFI 233


>gi|323491196|ref|ZP_08096382.1| DNA repair protein RecO [Vibrio brasiliensis LMG 20546]
 gi|323314564|gb|EGA67642.1| DNA repair protein RecO [Vibrio brasiliensis LMG 20546]
          Length = 243

 Score =  127 bits (319), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 41/231 (17%), Positives = 74/231 (32%), Gaps = 11/231 (4%)

Query: 8   IILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLAQN 65
            +L  R Y E ++IL+V + +YGR     +  +S R   +  LQ    + + W    +  
Sbjct: 10  FVLHRRPYSESSLILDVFSEEYGRVTLMSKGARSKRSNLKGALQPFTPLLLKWSGNGS-- 67

Query: 66  LGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPS 125
             +   +         LS       +     + R L    P   L+      L       
Sbjct: 68  -MKTLRQAEPISLGLPLSGINLYSAMYVNELVGRVLMAEVPMPALFHDYLHALTELAQCD 126

Query: 126 VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKMLV 185
                  + EL +L  +G+G+D   C  TG   +              +           
Sbjct: 127 NPEPALRRFELAMLSAMGYGVDFMHCAGTGEPVEPNMTYRYREQKGFIASVRKDNLTFYG 186

Query: 186 LPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENFLGK 235
                  E +    + LK+A + T     + AL+  +       RE F+ +
Sbjct: 187 SELIAISERRFTTKEQLKAAKRFT-----RIALKPYLGGKPLKSRELFISR 232


>gi|16272284|ref|NP_438496.1| DNA repair protein RecO [Haemophilus influenzae Rd KW20]
 gi|145631422|ref|ZP_01787192.1| DNA repair protein RecO [Haemophilus influenzae R3021]
 gi|260581202|ref|ZP_05849021.1| DNA repair protein RecO [Haemophilus influenzae RdAW]
 gi|260582574|ref|ZP_05850364.1| DNA repair protein RecO [Haemophilus influenzae NT127]
 gi|1172897|sp|P44642|RECO_HAEIN RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|1573301|gb|AAC21994.1| DNA repair protein (recO) [Haemophilus influenzae Rd KW20]
 gi|144982959|gb|EDJ90468.1| DNA repair protein RecO [Haemophilus influenzae R3021]
 gi|260092127|gb|EEW76071.1| DNA repair protein RecO [Haemophilus influenzae RdAW]
 gi|260094385|gb|EEW78283.1| DNA repair protein RecO [Haemophilus influenzae NT127]
 gi|301169037|emb|CBW28634.1| gap repair protein [Haemophilus influenzae 10810]
          Length = 236

 Score =  127 bits (319), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 37/235 (15%), Positives = 73/235 (31%), Gaps = 11/235 (4%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLA 63
              +L  R Y E ++++++ T + GR     +  ++ R   + +LQ    + + W  +  
Sbjct: 7   RGFVLHRRPYSETSLLVDLFTEESGRLTVIAKGARAKRSSWKSVLQPFTPLLLRWTGKST 66

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKI 123
                       +     L       G      L R +    P   L+      L     
Sbjct: 67  LKTLTKAEPAAITLP---LQQIALYSGFYVNELLTRVIESETPNPALFQHYLKCLTGLAT 123

Query: 124 PSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKM 183
            + I       E  LL+ +G+G+D   C  +G   D              +  +      
Sbjct: 124 ETNIEPTLRLFEFQLLQILGYGVDFLHCAGSGEPVDFSMTYRYREEKGFIASLVKDNLTF 183

Query: 184 LVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENFLGKLL 237
                  ++     D    ++A + T     + AL+  +       RE F   +L
Sbjct: 184 YGRDLLAFEALDFSDDAVRQAAKRFT-----RIALKPYLGDKPLKSRELFTQNIL 233


>gi|149192069|ref|ZP_01870294.1| DNA repair protein RecO [Vibrio shilonii AK1]
 gi|148834094|gb|EDL51106.1| DNA repair protein RecO [Vibrio shilonii AK1]
          Length = 234

 Score =  127 bits (319), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 45/235 (19%), Positives = 78/235 (33%), Gaps = 11/235 (4%)

Query: 8   IILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLAQN 65
            +L  R Y E ++IL+V + +YGR     +  +S R   +  LQ    + + W    +  
Sbjct: 8   FVLHRRPYSESSLILDVFSEEYGRVTLLSKGARSKRSNLKGALQPFTPLLLKWSGGGS-- 65

Query: 66  LGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPS 125
             +   +         LS       +     + R L    P   L+      L      +
Sbjct: 66  -MKTLRQAEAISLGLPLSGINLYSAMYVNELIARVLASEIPFPALFHDYLQALTELAHNT 124

Query: 126 VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKMLV 185
                  + EL LL  +G+G+D   C  TG   +              +         L 
Sbjct: 125 NPEPALRRFELALLSAMGYGVDFLHCAGTGEPIEPTMTYRYREQKGFIASVRKDNLTFLG 184

Query: 186 LPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENFLGKLLEL 239
                  E +      L++A + T     + AL+  +       RE FL +L +L
Sbjct: 185 EELIAISERRFNSKTQLQAAKRFT-----RIALKPYLGGKPLKSRELFLPRLKQL 234


>gi|145636400|ref|ZP_01792069.1| DNA repair protein RecO [Haemophilus influenzae PittHH]
 gi|145270565|gb|EDK10499.1| DNA repair protein RecO [Haemophilus influenzae PittHH]
          Length = 236

 Score =  127 bits (319), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 37/235 (15%), Positives = 73/235 (31%), Gaps = 11/235 (4%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLA 63
              +L  R Y E ++++++ T + GR     +  ++ R   + +LQ    + + W  +  
Sbjct: 7   RGFVLHRRPYSETSLLVDLFTEESGRLTVIAKGARAKRSSWKSVLQPFTPLLLRWTGKST 66

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKI 123
                       +     L       G      L R +    P   L+      L     
Sbjct: 67  LKTLTKAEPAAITLP---LQQIALYSGFYVNELLTRVIESETPNPALFQHYLKCLTGLAT 123

Query: 124 PSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKM 183
            + I       E  LL+ +G+G+D   C  +G   D              +  +      
Sbjct: 124 ETNIEPTLRLFEFQLLQILGYGVDFLHCAGSGEPVDFSMTYRYREEKGFLASLVKDNLTF 183

Query: 184 LVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENFLGKLL 237
                  ++     D    ++A + T     + AL+  +       RE F   +L
Sbjct: 184 YGRDLLAFEALDFSDDAVRQAAKRFT-----RIALKPYLGDKPLKSRELFTQNIL 233


>gi|163802960|ref|ZP_02196847.1| DNA repair protein RecO [Vibrio sp. AND4]
 gi|159173250|gb|EDP58078.1| DNA repair protein RecO [Vibrio sp. AND4]
          Length = 243

 Score =  127 bits (319), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 43/229 (18%), Positives = 76/229 (33%), Gaps = 11/229 (4%)

Query: 8   IILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLAQN 65
            +L  R Y E ++IL+V + +YGR     +  +S R   +  LQ    + + W  + +  
Sbjct: 13  FVLHRRPYSESSLILDVFSEEYGRVTLMAKGARSKRSNLKGALQPFTPLLLKWSGKSS-- 70

Query: 66  LGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPS 125
             +   +         L        +     + R L    P   L+      L       
Sbjct: 71  -MKTLRQAEAISLGLPLFGINLYSAMYVNELVGRVLMAEVPMPALFHDYLHALTELAQND 129

Query: 126 VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKMLV 185
                  + EL LL ++G+G+D   C  TG   D              +         L 
Sbjct: 130 NPEPALRRFELALLSSLGYGVDFLHCAGTGEPVDPEMTYRYREQKGFIASVRRDNLTFLG 189

Query: 186 LPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENFL 233
                  E + +  + LK+A + T     + AL+  +       RE F+
Sbjct: 190 NELIAISERRFVTKEQLKAAKRFT-----RVALKPYLGGKPLKSRELFI 233


>gi|148827479|ref|YP_001292232.1| DNA repair protein RecO [Haemophilus influenzae PittGG]
 gi|166221894|sp|A5UGE3|RECO_HAEIG RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|148718721|gb|ABQ99848.1| DNA repair protein RecO [Haemophilus influenzae PittGG]
          Length = 236

 Score =  127 bits (319), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 37/235 (15%), Positives = 73/235 (31%), Gaps = 11/235 (4%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLA 63
              +L  R Y E ++++++ T + GR     +  ++ R   + +LQ    + + W  +  
Sbjct: 7   RGFVLHRRPYSETSLLVDLFTEESGRLTVIAKGARAKRSSWKSVLQPFTPLLLRWTGKST 66

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKI 123
                       +     L       G      L R +    P   L+      L     
Sbjct: 67  LKTLAKAEPAAITLP---LQQIALYSGFYVNELLTRVIESETPNPALFQHYLKCLTGLAT 123

Query: 124 PSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKM 183
            + I       E  LL+ +G+G+D   C  +G   D              +  +      
Sbjct: 124 ETNIEPTLRLFEFQLLQILGYGVDFLHCAGSGEPVDFSMTYRYREEKGFIASLVKDNLTF 183

Query: 184 LVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENFLGKLL 237
                  ++     D    ++A + T     + AL+  +       RE F   +L
Sbjct: 184 YGRDLLAFEALDFSDDAVRQAAKRFT-----RIALKPYLGDKPLKSRELFTQNIL 233


>gi|152977879|ref|YP_001343508.1| DNA repair protein RecO [Actinobacillus succinogenes 130Z]
 gi|171472920|sp|A6VKS6|RECO_ACTSZ RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|150839602|gb|ABR73573.1| DNA repair protein RecO [Actinobacillus succinogenes 130Z]
          Length = 237

 Score =  127 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 40/242 (16%), Positives = 78/242 (32%), Gaps = 13/242 (5%)

Query: 1   MYWQD--DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRV 56
           M  +      +L  + Y E ++++++ T + GR     +  ++ R   + +LQ    + +
Sbjct: 1   MAIETFQRGFVLHRKPYSETSLLVDLFTEETGRLTVLAKGARAKRSAWKGVLQPFTPLLL 60

Query: 57  NWRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNI 116
            W  + A            +  A  L  +    G      L R +    P  EL+     
Sbjct: 61  RWSGKGALKTLTKAEP---AAIALPLQQTALFSGFYVNELLCRVIEAETPNGELFQDYLH 117

Query: 117 FLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVG 176
            L        +       E  LL  +G+G+D T C  +G   D              +  
Sbjct: 118 CLTRLASEDGVEPALRTFEFQLLTMLGYGVDFTHCAGSGEPVDEAMTYRYREEKGFTASL 177

Query: 177 LPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENFLGK 235
           +             ++     D     +A + T     + AL+  + +     RE F   
Sbjct: 178 IKDNATFYGRDLLAFEARDFRDPAVRSAAKRFT-----RMALKPYLGNKPLKSRELFAHN 232

Query: 236 LL 237
           +L
Sbjct: 233 IL 234


>gi|145632581|ref|ZP_01788315.1| DNA repair protein RecO [Haemophilus influenzae 3655]
 gi|144986776|gb|EDJ93328.1| DNA repair protein RecO [Haemophilus influenzae 3655]
          Length = 236

 Score =  127 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 38/235 (16%), Positives = 74/235 (31%), Gaps = 11/235 (4%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLA 63
              +L  R Y E ++++++ T + GR     +  ++ R   + +LQ    + + W  + A
Sbjct: 7   RGFVLHRRPYSETSLLVDLFTEESGRLTVIAKGARAKRSSWKSVLQPFTPLLLRWTGKSA 66

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKI 123
                       +     L       G      L R +    P   L+      L     
Sbjct: 67  LKTLTKAEPAAITLP---LQQIALYSGFYVNELLTRVIESETPNPALFQHYLKCLTGLAT 123

Query: 124 PSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKM 183
            S +       E  LL+ +G+G+D   C  +G   D              +  +      
Sbjct: 124 ESNVEPTLRLFEFQLLQILGYGVDFLHCAGSGEPVDCTMTYRYREEKGFIASLVKDNLTF 183

Query: 184 LVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENFLGKLL 237
                  ++     D    ++A + T     + AL+  +       RE F   +L
Sbjct: 184 YGRDLLAFEALDFSDDAVRQAAKRFT-----RIALKPYLGDKPLKSRELFTQNIL 233


>gi|260771273|ref|ZP_05880200.1| DNA recombination and repair protein RecO [Vibrio furnissii CIP
           102972]
 gi|260613870|gb|EEX39062.1| DNA recombination and repair protein RecO [Vibrio furnissii CIP
           102972]
 gi|315179120|gb|ADT86034.1| DNA repair protein RecO [Vibrio furnissii NCTC 11218]
          Length = 241

 Score =  127 bits (318), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 42/228 (18%), Positives = 74/228 (32%), Gaps = 11/228 (4%)

Query: 8   IILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLAQN 65
            +L  R Y E ++IL+V + +YGR     +  +S R   +  LQ    + + W    +  
Sbjct: 9   FVLHRRPYSETSLILDVFSEEYGRLTLLAKGARSKRSNLKGALQPFTPLLLKWSGNSS-- 66

Query: 66  LGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPS 125
             +   +         L+       +     + R L    P   L+      L       
Sbjct: 67  -MKTLRQAEAISLGLPLTGIHLYSAMYVNELVGRVLAPEVPSPGLFHDYLFALTELAQSD 125

Query: 126 VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKMLV 185
                  + EL LL ++G+G+D   C  TG   D              +         L 
Sbjct: 126 NPEPPLRRFELALLSSLGYGVDFLHCAGTGEPVDPAMTYRYREQKGFIASVRRDNLTFLG 185

Query: 186 LPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENF 232
                  E +    + L++A + T     + AL+  +       RE F
Sbjct: 186 NELIAISERRFTTKEQLQAAKRFT-----RIALKPYLGGKPLKSRELF 228


>gi|58418862|gb|AAW70877.1| Recombinational DNA repair protein RecO [Wolbachia endosymbiont
           strain TRS of Brugia malayi]
          Length = 245

 Score =  126 bits (317), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 78/242 (32%), Positives = 120/242 (49%), Gaps = 9/242 (3%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D+ II+  + YG+K++IL +  + +G+  G  R       +   Q  NL+   W +
Sbjct: 6   MRWKDEGIIIAAKKYGDKSLILSLFMKNHGKCRGLTRLTNDSSYK--FQVSNLLHAEWSA 63

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLF-RFLPEREPCLELYDMLNIFLN 119
           +L +NLG F+ E++ES        SL    + S   +  + LPE EPC  LYD    F++
Sbjct: 64  KLPENLGFFKCELIESPFHHFFQDSLKSITIVSFSSILEKVLPESEPCAVLYDNFQYFID 123

Query: 120 CHKI-PSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
             K         ++ +EL+LL  +GF LDL+KC VTGV ++L ++SPK+G AV + VG  
Sbjct: 124 VIKHGSEPWQGHYLNLELLLLAQLGFKLDLSKCAVTGVKENLQFISPKTGRAVSKKVGDY 183

Query: 179 YAEKMLVLPSFLWKEEQT-----IDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFL 233
           YA+K+L  P  L                 +   ++T YFLNKY      +     R   L
Sbjct: 184 YADKLLPFPQMLHDVYNNNLQNSYSYQEFQLGLKVTGYFLNKYLFSQLNMRFPESRNLIL 243

Query: 234 GK 235
             
Sbjct: 244 SL 245


>gi|330814140|ref|YP_004358379.1| GTP-binding protein Era [Candidatus Pelagibacter sp. IMCC9063]
 gi|327487235|gb|AEA81640.1| GTP-binding protein Era [Candidatus Pelagibacter sp. IMCC9063]
          Length = 228

 Score =  126 bits (317), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 50/238 (21%), Positives = 88/238 (36%), Gaps = 12/238 (5%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D   +L + +Y E + I   +T ++G H G +    S + +  LQ GN   +NW+S
Sbjct: 1   MNWKDIGYLLKISNYSENSSIATFVTCEHGLHKGVIYGATSKKKKNYLQIGNKFSLNWKS 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           +    LG +  E+  +  AK     + L  +QS+  L                   F   
Sbjct: 61  KSEDALGYYDLELKNAVTAKFFDEPIKLSFIQSLSELCCKTLAERYDYSELFDYTDFFIN 120

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
           +   +   K+++  E  LL  IGF L            +    +            L   
Sbjct: 121 NISKANALKLYILWEKELLTAIGFEL------------NPDNKNFNFYKNNLSQWILEID 168

Query: 181 EKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLE 238
           ++  + P+FL       +   L     +  + L ++  + N I    +RE    KL E
Sbjct: 169 KQKFLYPNFLIDSNSVYEDTDLYEGLVINKFILKRFVFEPNRIRFPEVRERIEKKLNE 226


>gi|161899045|ref|YP_198119.2| DNA repair protein RecO [Wolbachia endosymbiont strain TRS of
           Brugia malayi]
          Length = 240

 Score =  126 bits (317), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 78/242 (32%), Positives = 120/242 (49%), Gaps = 9/242 (3%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D+ II+  + YG+K++IL +  + +G+  G  R       +   Q  NL+   W +
Sbjct: 1   MRWKDEGIIIAAKKYGDKSLILSLFMKNHGKCRGLTRLTNDSSYK--FQVSNLLHAEWSA 58

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLF-RFLPEREPCLELYDMLNIFLN 119
           +L +NLG F+ E++ES        SL    + S   +  + LPE EPC  LYD    F++
Sbjct: 59  KLPENLGFFKCELIESPFHHFFQDSLKSITIVSFSSILEKVLPESEPCAVLYDNFQYFID 118

Query: 120 CHKI-PSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
             K         ++ +EL+LL  +GF LDL+KC VTGV ++L ++SPK+G AV + VG  
Sbjct: 119 VIKHGSEPWQGHYLNLELLLLAQLGFKLDLSKCAVTGVKENLQFISPKTGRAVSKKVGDY 178

Query: 179 YAEKMLVLPSFLWKEEQT-----IDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFL 233
           YA+K+L  P  L                 +   ++T YFLNKY      +     R   L
Sbjct: 179 YADKLLPFPQMLHDVYNNNLQNSYSYQEFQLGLKVTGYFLNKYLFSQLNMRFPESRNLIL 238

Query: 234 GK 235
             
Sbjct: 239 SL 240


>gi|88607051|ref|YP_505316.1| DNA repair protein RecO [Anaplasma phagocytophilum HZ]
 gi|123494993|sp|Q2GJY5|RECO_ANAPZ RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|88598114|gb|ABD43584.1| DNA repair protein RecO [Anaplasma phagocytophilum HZ]
          Length = 245

 Score =  126 bits (317), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 67/245 (27%), Positives = 105/245 (42%), Gaps = 11/245 (4%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M WQD  +I+ +  YG+   IL V TR +G     +R  +  +    LQ G+ V V WR+
Sbjct: 1   MQWQDHGMIVSMTPYGDTRSILSVFTRNHGICNAMIRLNKKKQS---LQIGDRVCVTWRA 57

Query: 61  RLAQNLGEFRFEVLESHC-AKLLSSSLFLYGLQSIVPLF-RFLPEREPCLELYDMLNIFL 118
           RLA NLG F    + S            L  L S+     + +P  +    LYD L  F 
Sbjct: 58  RLANNLGYFNSCEIISSAFYAYFQDHSKLLCLSSVTSTIYKSVPTNDAHPILYDYLIEFA 117

Query: 119 NCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
              +        ++++EL +L  +GF LDL++C V     +LL++SPK+G A+    G+ 
Sbjct: 118 EAAECGGHWYNEYLKLELEILSQLGFALDLSRCAVYHCEDNLLYISPKTGRAISERAGVS 177

Query: 179 YAEKMLVLPSFLWK-----EEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFL 233
           Y   +  LP  L         +           Q+  YFL+++ L          R+   
Sbjct: 178 YRHLLFPLPQILRDLHNGTHTEQCSRKEFLLCLQILGYFLHRHLLSD-DSKFLEQRKEMT 236

Query: 234 GKLLE 238
             + E
Sbjct: 237 ALIYE 241


>gi|261491681|ref|ZP_05988262.1| DNA recombination protein RecO [Mannheimia haemolytica serotype A2
           str. BOVINE]
 gi|261494444|ref|ZP_05990930.1| DNA recombination protein RecO [Mannheimia haemolytica serotype A2
           str. OVINE]
 gi|261309828|gb|EEY11045.1| DNA recombination protein RecO [Mannheimia haemolytica serotype A2
           str. OVINE]
 gi|261312634|gb|EEY13756.1| DNA recombination protein RecO [Mannheimia haemolytica serotype A2
           str. BOVINE]
          Length = 240

 Score =  126 bits (316), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 45/238 (18%), Positives = 79/238 (33%), Gaps = 12/238 (5%)

Query: 2   YWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWR 59
            WQ  A +L  R Y E ++++E  T  +GR     +  +  R   + +LQ    + V W 
Sbjct: 5   QWQ-RAFVLHRREYSESSLLVEFFTEHHGRITLLAKGARRARSPLKAVLQPFTPLLVRWS 63

Query: 60  SRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLN 119
            +              +     + ++    G      L R L  +    EL+      + 
Sbjct: 64  GKGDLKTLTKAEP---AALTLPMETAALYSGFYINEVLARVLENQTAYPELFQHYLRCMT 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                  I  I    E   LK +G+G+D T C  TG+  D              +  L  
Sbjct: 121 ELATQHQIEPILRTFEFHTLKALGYGVDFTHCTATGLPIDPKMSYQFRESEGFIASLLQN 180

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENFLGKL 236
               L      + +    +  + ++A + T     + AL+  +       RE F   L
Sbjct: 181 NNSFLGCDLLAFAQLDFSEKQTQQAAKRFT-----RIALKPYLGSQPLKSRELFQSIL 233


>gi|329123646|ref|ZP_08252206.1| recombination protein O [Haemophilus aegyptius ATCC 11116]
 gi|327469845|gb|EGF15310.1| recombination protein O [Haemophilus aegyptius ATCC 11116]
          Length = 236

 Score =  126 bits (315), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 37/235 (15%), Positives = 74/235 (31%), Gaps = 11/235 (4%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLA 63
              +L  R Y E ++++++ T + GR     +  ++ R   + +LQ    + + W  + A
Sbjct: 7   RGFVLHRRPYSETSLLVDLFTEESGRLTVIAKGARAKRSSWKSVLQPFTPLLLRWTGKSA 66

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKI 123
                       +     L       G      L R +    P   L+      L     
Sbjct: 67  LKTLTKAEPAAITLP---LQQIALYSGFYVNELLTRVIESETPNPALFQHYLKCLTGLAT 123

Query: 124 PSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKM 183
            + +       E  LL+ +G+G+D   C  +G   D              +  +      
Sbjct: 124 ETNVEPTLRLFEFQLLQILGYGVDFLHCAGSGEPVDCTMTYRYREEKGFIASLVKDNLTF 183

Query: 184 LVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENFLGKLL 237
                  ++     D    ++A + T     + AL+  +       RE F   +L
Sbjct: 184 YGRDLLAFEALDFSDDAVRQAAKRFT-----RIALKPYLGDKPLKSRELFSQHIL 233


>gi|153835469|ref|ZP_01988136.1| DNA repair protein RecO [Vibrio harveyi HY01]
 gi|269960403|ref|ZP_06174776.1| DNA repair protein recO [Vibrio harveyi 1DA3]
 gi|148867980|gb|EDL67177.1| DNA repair protein RecO [Vibrio harveyi HY01]
 gi|269834830|gb|EEZ88916.1| DNA repair protein recO [Vibrio harveyi 1DA3]
          Length = 243

 Score =  125 bits (314), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 43/229 (18%), Positives = 76/229 (33%), Gaps = 11/229 (4%)

Query: 8   IILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLAQN 65
            +L  R Y E ++IL+V + +YGR     +  +S R   +  LQ    + + W  + +  
Sbjct: 13  FVLHRRPYSESSLILDVFSEEYGRITLMAKGARSKRSNLKGALQPFTPLLLKWSGKGS-- 70

Query: 66  LGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPS 125
             +   +         L        +     + R L    P   L+      L       
Sbjct: 71  -MKTLRQAEPISLGLPLFGINLYSAMYVNELVGRVLMAEVPMPALFHDYLHALTELAQSD 129

Query: 126 VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKMLV 185
                  + EL LL ++G+G+D   C  TG   D              +         L 
Sbjct: 130 NPEPGLRRFELALLSSMGYGVDFLHCAGTGEPVDPEMTYRYREQKGFIASVRRDNLTFLG 189

Query: 186 LPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENFL 233
                  E + +  + LK+A + T     + AL+  +       RE F+
Sbjct: 190 NELIAISERRFVTKEQLKAAKRFT-----RMALKPYLGGKPLKSRELFI 233


>gi|14195092|sp|P57974|RECO_PASMU RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
          Length = 240

 Score =  125 bits (314), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 44/239 (18%), Positives = 77/239 (32%), Gaps = 11/239 (4%)

Query: 2   YWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWR 59
            WQ    +L  ++Y E ++++E+ T + GR     +  ++ R   + ILQ    + + W 
Sbjct: 7   NWQ-RGFVLHRKAYSETSLLVELFTEETGRLTVLAKGARAKRSALKGILQPFTPLLLRWS 65

Query: 60  SRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLN 119
            R              +  A  L  +    G      L R L        L+      L 
Sbjct: 66  GRSELKTLTKVEP---AAIALPLQQTALYSGFYVNELLCRVLEPETGYPHLFQDYLRCLT 122

Query: 120 CHKIPSV-IGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
                   I       E  LL+ +G+G+D   C  +G   D              +  + 
Sbjct: 123 GLASAEHLIEPSLRHFEFQLLQTLGYGVDFCHCAGSGELVDENMTYRYREEKGFIASLIK 182

Query: 179 YAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLL 237
                       +   Q  D+ +L++A + T   L +Y            RE F   +L
Sbjct: 183 DNLTFYGRELLAFDARQFHDSATLQAAKRFTRIALKQYL---GNKPL-KSRELFTQYML 237


>gi|15603732|ref|NP_246806.1| DNA repair protein RecO [Pasteurella multocida subsp. multocida
           str. Pm70]
 gi|12722295|gb|AAK03951.1| RecO [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 236

 Score =  125 bits (314), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 44/239 (18%), Positives = 77/239 (32%), Gaps = 11/239 (4%)

Query: 2   YWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWR 59
            WQ    +L  ++Y E ++++E+ T + GR     +  ++ R   + ILQ    + + W 
Sbjct: 3   NWQ-RGFVLHRKAYSETSLLVELFTEETGRLTVLAKGARAKRSALKGILQPFTPLLLRWS 61

Query: 60  SRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLN 119
            R              +  A  L  +    G      L R L        L+      L 
Sbjct: 62  GRSELKTLTKVEP---AAIALPLQQTALYSGFYVNELLCRVLEPETGYPHLFQDYLRCLT 118

Query: 120 CHKIPSV-IGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
                   I       E  LL+ +G+G+D   C  +G   D              +  + 
Sbjct: 119 GLASAEHLIEPSLRHFEFQLLQTLGYGVDFCHCAGSGELVDENMTYRYREEKGFIASLIK 178

Query: 179 YAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLL 237
                       +   Q  D+ +L++A + T   L +Y            RE F   +L
Sbjct: 179 DNLTFYGRELLAFDARQFHDSATLQAAKRFTRIALKQYL---GNKPL-KSRELFTQYML 233


>gi|319896660|ref|YP_004134853.1| DNA repair protein rec0 [Haemophilus influenzae F3031]
 gi|317432162|emb|CBY80513.1| DNA repair protein Rec0 [Haemophilus influenzae F3031]
          Length = 236

 Score =  125 bits (314), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 37/235 (15%), Positives = 74/235 (31%), Gaps = 11/235 (4%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLA 63
              +L  R Y E ++++++ T + GR     +  ++ R   + +LQ    + + W  + A
Sbjct: 7   RGFVLHRRPYSETSLLVDLFTEESGRLTVIAKGARAKRSSWKSVLQPFTPLLLRWTGKSA 66

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKI 123
                       +     L       G      L R +    P   L+      L     
Sbjct: 67  LKTLTKAEPAAITLP---LQQIALYSGFYVNELLTRVIESETPNPALFQHYLKCLTGLAT 123

Query: 124 PSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKM 183
            + +       E  LL+ +G+G+D   C  +G   D              +  +      
Sbjct: 124 ETNVEPTLRLFEFQLLQILGYGVDFLHCAGSGEPVDCTMTYRYREEKGFIASLVKDNLTF 183

Query: 184 LVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENFLGKLL 237
                  ++     D    ++A + T     + AL+  +       RE F   +L
Sbjct: 184 YGRDLLAFETLDFSDDSVRQAAKRFT-----RIALKPYLGDKPLKSRELFSQHIL 233


>gi|327484951|gb|AEA79358.1| DNA recombination and repair protein RecO [Vibrio cholerae
           LMA3894-4]
          Length = 241

 Score =  125 bits (313), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 40/228 (17%), Positives = 71/228 (31%), Gaps = 11/228 (4%)

Query: 8   IILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLAQN 65
            +L  R Y E ++IL+V + +YGR     +  +  R   +  LQ    + + W    +  
Sbjct: 9   FVLHRRPYSESSLILDVFSEEYGRVSLMAKGARGKRSNLKGALQPFTPLLLKWSGNSS-- 66

Query: 66  LGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPS 125
             +   +         LS       +     + R L        L+      L      +
Sbjct: 67  -MKTLRQAEPISLGLPLSGVYLYSAMYINELVDRVLMPEVASPGLFHDYLFALTELAQST 125

Query: 126 VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKMLV 185
                  + EL LL  +G+G+D   C  TG                  +         L 
Sbjct: 126 NPEPALRRFELALLAAMGYGVDFLHCAGTGEPVSPDMTYRYREQKGFIASVRRDNLTFLG 185

Query: 186 LPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENF 232
                  E +    + L++A + T     + AL+  +       RE F
Sbjct: 186 NELIAISERRFTSKEQLQAAKRFT-----RLALKPYLGGKPLKSRELF 228


>gi|153826906|ref|ZP_01979573.1| DNA repair protein RecO [Vibrio cholerae MZO-2]
 gi|229527067|ref|ZP_04416462.1| DNA recombination and repair protein RecO [Vibrio cholerae
           12129(1)]
 gi|254291659|ref|ZP_04962447.1| DNA repair protein RecO [Vibrio cholerae AM-19226]
 gi|149739269|gb|EDM53531.1| DNA repair protein RecO [Vibrio cholerae MZO-2]
 gi|150422431|gb|EDN14390.1| DNA repair protein RecO [Vibrio cholerae AM-19226]
 gi|229335464|gb|EEO00946.1| DNA recombination and repair protein RecO [Vibrio cholerae
           12129(1)]
          Length = 241

 Score =  125 bits (313), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 40/228 (17%), Positives = 71/228 (31%), Gaps = 11/228 (4%)

Query: 8   IILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLAQN 65
            +L  R Y E ++IL+V + +YGR     +  +  R   +  LQ    + + W    +  
Sbjct: 9   FVLHRRPYSESSLILDVFSEEYGRVSLMAKGARGKRSNLKGALQPFTPLLLKWSGNGS-- 66

Query: 66  LGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPS 125
             +   +         LS       +     + R L        L+      L      +
Sbjct: 67  -MKTLRQAEPISLGLPLSGVYLYSAMYINELVDRVLMPEVASPGLFHDYLFALTELAQST 125

Query: 126 VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKMLV 185
                  + EL LL  +G+G+D   C  TG                  +         L 
Sbjct: 126 NPEPALRRFELALLAAMGYGVDFLHCAGTGEPVSPDMTYRYREQKGFIASVRRDNLTFLG 185

Query: 186 LPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENF 232
                  E +    + L++A + T     + AL+  +       RE F
Sbjct: 186 NELIAISERRFTSKEQLQAAKRFT-----RLALKPYLGGKPLKSRELF 228


>gi|269965787|ref|ZP_06179884.1| DNA repair protein recO [Vibrio alginolyticus 40B]
 gi|269829655|gb|EEZ83892.1| DNA repair protein recO [Vibrio alginolyticus 40B]
          Length = 243

 Score =  124 bits (312), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 43/229 (18%), Positives = 76/229 (33%), Gaps = 11/229 (4%)

Query: 8   IILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLAQN 65
            +L  R Y E ++IL+V + +YGR     +  +S R   +  LQ    + + W  + +  
Sbjct: 13  FVLHRRPYSESSLILDVFSEEYGRMTLMAKGARSKRSNLKGALQPFTPLLLKWSGKGS-- 70

Query: 66  LGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPS 125
             +   +         L+       +     + R L    P   L+      L       
Sbjct: 71  -MKTLRQAEPISLGLPLTGINLYSAMYVNELIGRILMAEVPMPALFHDYLHALTELAHNE 129

Query: 126 VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKMLV 185
                  + EL LL  +G+G+D   C  TG   D              +         L 
Sbjct: 130 NPEPALRRFELALLSAMGYGVDFLHCAGTGEPVDPEMTYRYREQKGFIASVRRDNLTFLG 189

Query: 186 LPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENFL 233
                  E + +  + LK+A + T     + AL+  +       RE F+
Sbjct: 190 NELIAISERRFVTKEQLKAAKRFT-----RIALKPYLGGKPLKSREFFI 233


>gi|319775804|ref|YP_004138292.1| DNA repair protein Rec0 [Haemophilus influenzae F3047]
 gi|317450395|emb|CBY86611.1| DNA repair protein Rec0 [Haemophilus influenzae F3047]
          Length = 236

 Score =  124 bits (312), Expect = 8e-27,   Method: Composition-based stats.
 Identities = 37/235 (15%), Positives = 74/235 (31%), Gaps = 11/235 (4%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLA 63
              +L  R Y E ++++++ T + GR     +  ++ R   + +LQ    + + W  + A
Sbjct: 7   RGFVLHRRPYSETSLLVDLFTEESGRLTVIAKGARAKRSSWKSVLQPFTPLLLRWTGKNA 66

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKI 123
                       +     L       G      L R +    P   L+      L     
Sbjct: 67  LKTLTKAEPAAITLP---LQQIALYSGFYVNELLTRVIESETPNPALFQHYLKCLTGLAT 123

Query: 124 PSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKM 183
            + +       E  LL+ +G+G+D   C  +G   D              +  +      
Sbjct: 124 KTNVEPTLRLFEFQLLQILGYGVDFLHCAGSGEPVDFSMTYRYREEKGFIASLVKDNLTF 183

Query: 184 LVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENFLGKLL 237
                  ++     D    ++A + T     + AL+  +       RE F   +L
Sbjct: 184 YGRDLLAFEALDFSDDVVRQAAKRFT-----RIALKPYLGDKPLKSRELFSQHIL 233


>gi|260598948|ref|YP_003211519.1| DNA repair protein recO [Cronobacter turicensis z3032]
 gi|260218125|emb|CBA32921.1| DNA repair protein recO [Cronobacter turicensis z3032]
          Length = 245

 Score =  124 bits (312), Expect = 8e-27,   Method: Composition-based stats.
 Identities = 47/237 (19%), Positives = 78/237 (32%), Gaps = 14/237 (5%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVN 57
           M  WQ  A +L  R + E ++I+++ + + GR     +  +  R   +  LQ    + V 
Sbjct: 1   MEGWQ-RAFVLHARPWSETSLIIDLFSEESGRVRVVAKGARRKRSNLKGALQPFTPLLVR 59

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
           W  R                 A  LS      GL     + R L       EL+      
Sbjct: 60  WSGRGDVKN---LTSAEAVSLALPLSGITLYSGLYVNELVARVLEPETRFSELFFDYLHC 116

Query: 118 LNCHKIPS-VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVG 176
           +      +        + EL LL ++G+G+D   C  TG   D              +  
Sbjct: 117 IQALAGATGTPEPALRRFELALLGHLGYGVDFLHCAGTGDEVDDAMTYRYREEKGFIASL 176

Query: 177 LPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENF 232
           +                    DAD+L++A + T     + AL+  +       RE F
Sbjct: 177 VIDNTSFTGRQLKALATRDFPDADTLRAAKRFT-----RMALKPYLGGKPLKSRELF 228


>gi|254230526|ref|ZP_04923897.1| DNA repair protein RecO [Vibrio sp. Ex25]
 gi|262393272|ref|YP_003285126.1| DNA recombination and repair protein RecO [Vibrio sp. Ex25]
 gi|151936951|gb|EDN55838.1| DNA repair protein RecO [Vibrio sp. Ex25]
 gi|262336866|gb|ACY50661.1| DNA recombination and repair protein RecO [Vibrio sp. Ex25]
          Length = 243

 Score =  124 bits (311), Expect = 9e-27,   Method: Composition-based stats.
 Identities = 43/229 (18%), Positives = 77/229 (33%), Gaps = 11/229 (4%)

Query: 8   IILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLAQN 65
            +L  R Y E ++IL+V + +YGR     +  +S R   +  LQ    + + W  + +  
Sbjct: 13  FVLHRRPYSESSLILDVFSEEYGRMTLMAKGARSKRSNLKGALQPFTPLLLKWSGKGS-- 70

Query: 66  LGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPS 125
             +   +         L+       +     + R L    P   L+      L       
Sbjct: 71  -MKTLRQAEPISLGLPLTGINLYSAMYVNELIGRILMAEVPMPALFHDYLHALTELAHNE 129

Query: 126 VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKMLV 185
                  + EL LL ++G+G+D   C  TG   D              +         L 
Sbjct: 130 NPEPALRRFELALLSSMGYGVDFLHCAGTGEPVDPEMTYRYREQKGFIASVRRDNLTFLG 189

Query: 186 LPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENFL 233
                  E + +  + LK+A + T     + AL+  +       RE F+
Sbjct: 190 NELIAISERRFVTKEQLKAAKRFT-----RIALKPYLGGKPLKSREFFI 233


>gi|315635029|ref|ZP_07890310.1| recombination protein O [Aggregatibacter segnis ATCC 33393]
 gi|315476291|gb|EFU67042.1| recombination protein O [Aggregatibacter segnis ATCC 33393]
          Length = 247

 Score =  124 bits (311), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 39/235 (16%), Positives = 81/235 (34%), Gaps = 13/235 (5%)

Query: 2   YWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWR 59
            WQ    +L  +SY E +++++++T  +GR     +  ++ R   + +LQ    + + W 
Sbjct: 14  NWQ-RGFVLHRKSYSETSLLVDLLTEDFGRISVLAKGARAKRSMLKGVLQPFTPLLLRWS 72

Query: 60  SRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLN 119
            R    +         +  A  L +     G      + R L       +L+      L 
Sbjct: 73  GRGDLKILTKAEP---AAIALPLQNVALYSGFYLNELICRVLEPETAYPQLFQHYLQCLT 129

Query: 120 CHK-IPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
                 + +       E  LL+ +G+G+D T C  +G   +              +  + 
Sbjct: 130 QLALSQTHVEPALRTFEFQLLRTLGYGIDFTHCAGSGKAVEADMTYRYREEKGFIASLIK 189

Query: 179 YAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENF 232
                       +++ Q  +   L +A + T     + AL+  +       RE F
Sbjct: 190 DNLTFYGRELLAFEQTQFDEPSVLSAAKRFT-----RIALKPYLGDKPLKSRELF 239


>gi|153803097|ref|ZP_01957683.1| DNA repair protein RecO [Vibrio cholerae MZO-3]
 gi|153830872|ref|ZP_01983539.1| DNA repair protein RecO [Vibrio cholerae 623-39]
 gi|124121379|gb|EAY40122.1| DNA repair protein RecO [Vibrio cholerae MZO-3]
 gi|148873641|gb|EDL71776.1| DNA repair protein RecO [Vibrio cholerae 623-39]
          Length = 241

 Score =  124 bits (311), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 40/228 (17%), Positives = 71/228 (31%), Gaps = 11/228 (4%)

Query: 8   IILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLAQN 65
            +L  R Y E ++IL+V + +YGR     +  +  R   +  LQ    + + W    +  
Sbjct: 9   FVLHRRPYSESSLILDVFSEEYGRVSLMAKGARGKRSNLKGALQPFTPLLLKWSGNGS-- 66

Query: 66  LGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPS 125
             +   +         LS       +     + R L        L+      L      +
Sbjct: 67  -MKTLRQAEPISLGLPLSGVYLYSAMYINELVDRVLMPEVASPGLFHDYLFALTELAQST 125

Query: 126 VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKMLV 185
                  + EL LL  +G+G+D   C  TG                  +         L 
Sbjct: 126 NPEPALRRFELALLAAMGYGVDFLHCAGTGEPVSPDMTYRYREQKGFIASIRRDNLTFLG 185

Query: 186 LPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENF 232
                  E +    + L++A + T     + AL+  +       RE F
Sbjct: 186 NELIAISERRFTSKEQLQAAKRFT-----RLALKPYLGGKPLKSRELF 228


>gi|229521286|ref|ZP_04410706.1| DNA recombination and repair protein RecO [Vibrio cholerae TM
           11079-80]
 gi|229341818|gb|EEO06820.1| DNA recombination and repair protein RecO [Vibrio cholerae TM
           11079-80]
          Length = 241

 Score =  124 bits (311), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 41/228 (17%), Positives = 72/228 (31%), Gaps = 11/228 (4%)

Query: 8   IILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLAQN 65
            +L  R Y E ++IL+V + +YGR     +  +  R   +  LQ    + + W    +  
Sbjct: 9   FVLHRRPYSESSLILDVFSEEYGRVTLMAKGARGKRSNLKGALQPFTPLLLKWSGNGS-- 66

Query: 66  LGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPS 125
             +   +         LS       +     + R L     C  L+      L      +
Sbjct: 67  -MKTLRQAEPISLGLPLSGVYLYSAMYINELVDRVLMPEVACPGLFHDYLFALTELAQST 125

Query: 126 VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKMLV 185
                  + EL LL  +G+G+D   C  TG                  +         L 
Sbjct: 126 NPEPALRRFELALLAAMGYGVDFLHCAGTGEPVSPDMTYRYREQKGFIASVRRDNLTFLG 185

Query: 186 LPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENF 232
                  E +    + L++A + T     + AL+  +       RE F
Sbjct: 186 NELIAISERRFTSKEQLQAAKRFT-----RLALKPYLGGKPLKSRELF 228


>gi|229524446|ref|ZP_04413851.1| DNA recombination and repair protein RecO [Vibrio cholerae bv.
           albensis VL426]
 gi|262190711|ref|ZP_06048942.1| DNA recombination and repair protein RecO [Vibrio cholerae CT
           5369-93]
 gi|229338027|gb|EEO03044.1| DNA recombination and repair protein RecO [Vibrio cholerae bv.
           albensis VL426]
 gi|262033423|gb|EEY51930.1| DNA recombination and repair protein RecO [Vibrio cholerae CT
           5369-93]
          Length = 241

 Score =  124 bits (311), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 40/228 (17%), Positives = 71/228 (31%), Gaps = 11/228 (4%)

Query: 8   IILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLAQN 65
            +L  R Y E ++IL+V + +YGR     +  +  R   +  LQ    + + W    +  
Sbjct: 9   FVLHRRPYSESSLILDVFSEEYGRVTLMAKGARGKRSNLKGALQPFTPLLLKWSGNSS-- 66

Query: 66  LGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPS 125
             +   +         LS       +     + R L        L+      L      +
Sbjct: 67  -MKTLRQAEPISLGLPLSGVYLYSAMYINELVDRVLMPEVASPGLFHDYLFALTELAQST 125

Query: 126 VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKMLV 185
                  + EL LL  +G+G+D   C  TG                  +         L 
Sbjct: 126 NPEPALRRFELALLAAMGYGVDFLHCAGTGEPVSPDMTYRYREQKGFIASVRRDNLTFLG 185

Query: 186 LPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENF 232
                  E +    + L++A + T     + AL+  +       RE F
Sbjct: 186 NELIAISERRFTSKEQLQAAKRFT-----RLALKPYLGGKPLKSRELF 228


>gi|254507488|ref|ZP_05119622.1| DNA repair protein RecO [Vibrio parahaemolyticus 16]
 gi|219549558|gb|EED26549.1| DNA repair protein RecO [Vibrio parahaemolyticus 16]
          Length = 247

 Score =  124 bits (311), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 41/232 (17%), Positives = 75/232 (32%), Gaps = 11/232 (4%)

Query: 8   IILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLAQN 65
            +L  R Y E ++IL+V + +YGR     +  +S R   +  LQ    + + W    +  
Sbjct: 16  FVLHRRPYSESSLILDVFSEEYGRVTLMSKGARSKRSNLKGALQPFTPLLLKWSGNGS-- 73

Query: 66  LGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPS 125
             +   +         L+      G+     + R L    P   L+      L       
Sbjct: 74  -MKTLRQAEPISLGLPLTGINLYSGMYVNELIGRVLMAEVPMPALFHDYLHVLTELAQCD 132

Query: 126 VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKMLV 185
                  + EL LL  +G+G+D   C  +G   +              +           
Sbjct: 133 NPEPALRRFELALLSAMGYGVDFLHCAGSGEPIEPTMTYRYREQKGFIASVRYDNLTFKG 192

Query: 186 LPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENFLGKL 236
                  E +    + LK+A + T     + AL+  +       RE F+  +
Sbjct: 193 DELIAISERRFTTKEQLKAAKRFT-----RIALKPYLGGKPLKSRELFVAMI 239


>gi|15642455|ref|NP_232088.1| DNA repair protein RecO [Vibrio cholerae O1 biovar El Tor str.
           N16961]
 gi|121590991|ref|ZP_01678310.1| DNA repair protein RecO [Vibrio cholerae 2740-80]
 gi|121728978|ref|ZP_01681982.1| DNA repair protein RecO [Vibrio cholerae V52]
 gi|147673381|ref|YP_001217961.1| DNA repair protein RecO [Vibrio cholerae O395]
 gi|153214505|ref|ZP_01949414.1| DNA repair protein RecO [Vibrio cholerae 1587]
 gi|227082580|ref|YP_002811131.1| DNA repair protein RecO [Vibrio cholerae M66-2]
 gi|229507481|ref|ZP_04396986.1| DNA recombination and repair protein RecO [Vibrio cholerae BX
           330286]
 gi|229512324|ref|ZP_04401803.1| DNA recombination and repair protein RecO [Vibrio cholerae B33]
 gi|229519460|ref|ZP_04408903.1| DNA recombination and repair protein RecO [Vibrio cholerae RC9]
 gi|229606986|ref|YP_002877634.1| DNA repair protein RecO [Vibrio cholerae MJ-1236]
 gi|254226244|ref|ZP_04919837.1| DNA repair protein RecO [Vibrio cholerae V51]
 gi|254849584|ref|ZP_05238934.1| DNA repair protein recO [Vibrio cholerae MO10]
 gi|255746870|ref|ZP_05420815.1| DNA recombination and repair protein RecO [Vibrio cholera CIRS 101]
 gi|258622343|ref|ZP_05717368.1| DNA repair protein recO [Vibrio mimicus VM573]
 gi|258626727|ref|ZP_05721549.1| DNA repair protein recO [Vibrio mimicus VM603]
 gi|261211553|ref|ZP_05925841.1| DNA recombination and repair protein RecO [Vibrio sp. RC341]
 gi|262162035|ref|ZP_06031051.1| DNA recombination and repair protein RecO [Vibrio cholerae INDRE
           91/1]
 gi|262167290|ref|ZP_06035000.1| DNA recombination and repair protein RecO [Vibrio cholerae RC27]
 gi|262170592|ref|ZP_06038270.1| DNA recombination and repair protein RecO [Vibrio mimicus MB-451]
 gi|298500184|ref|ZP_07009989.1| DNA repair protein RecO [Vibrio cholerae MAK 757]
 gi|20139781|sp|Q9KPB4|RECO_VIBCH RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|172047581|sp|A5F5H6|RECO_VIBC3 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|254790740|sp|C3LR02|RECO_VIBCM RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|9657037|gb|AAF95601.1| DNA repair protein RecO [Vibrio cholerae O1 biovar El Tor str.
           N16961]
 gi|121547168|gb|EAX57297.1| DNA repair protein RecO [Vibrio cholerae 2740-80]
 gi|121628744|gb|EAX61211.1| DNA repair protein RecO [Vibrio cholerae V52]
 gi|124115307|gb|EAY34127.1| DNA repair protein RecO [Vibrio cholerae 1587]
 gi|125621217|gb|EAZ49558.1| DNA repair protein RecO [Vibrio cholerae V51]
 gi|146315264|gb|ABQ19803.1| DNA repair protein RecO [Vibrio cholerae O395]
 gi|227010468|gb|ACP06680.1| DNA repair protein RecO [Vibrio cholerae M66-2]
 gi|227014351|gb|ACP10561.1| DNA repair protein RecO [Vibrio cholerae O395]
 gi|229344149|gb|EEO09124.1| DNA recombination and repair protein RecO [Vibrio cholerae RC9]
 gi|229352289|gb|EEO17230.1| DNA recombination and repair protein RecO [Vibrio cholerae B33]
 gi|229354986|gb|EEO19907.1| DNA recombination and repair protein RecO [Vibrio cholerae BX
           330286]
 gi|229369641|gb|ACQ60064.1| DNA recombination and repair protein RecO [Vibrio cholerae MJ-1236]
 gi|254845289|gb|EET23703.1| DNA repair protein recO [Vibrio cholerae MO10]
 gi|255735272|gb|EET90672.1| DNA recombination and repair protein RecO [Vibrio cholera CIRS 101]
 gi|258580983|gb|EEW05910.1| DNA repair protein recO [Vibrio mimicus VM603]
 gi|258585359|gb|EEW10083.1| DNA repair protein recO [Vibrio mimicus VM573]
 gi|260839508|gb|EEX66134.1| DNA recombination and repair protein RecO [Vibrio sp. RC341]
 gi|261891668|gb|EEY37654.1| DNA recombination and repair protein RecO [Vibrio mimicus MB-451]
 gi|262024265|gb|EEY42956.1| DNA recombination and repair protein RecO [Vibrio cholerae RC27]
 gi|262028284|gb|EEY46941.1| DNA recombination and repair protein RecO [Vibrio cholerae INDRE
           91/1]
 gi|297540877|gb|EFH76931.1| DNA repair protein RecO [Vibrio cholerae MAK 757]
          Length = 241

 Score =  124 bits (310), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 40/228 (17%), Positives = 71/228 (31%), Gaps = 11/228 (4%)

Query: 8   IILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLAQN 65
            +L  R Y E ++IL+V + +YGR     +  +  R   +  LQ    + + W    +  
Sbjct: 9   FVLHRRPYSESSLILDVFSEEYGRVTLMAKGARGKRSNLKGALQPFTPLLLKWSGNGS-- 66

Query: 66  LGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPS 125
             +   +         LS       +     + R L        L+      L      +
Sbjct: 67  -MKTLRQAEPISLGLPLSGVYLYSAMYINELVDRVLMPEVASPGLFHDYLFALTELAQST 125

Query: 126 VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKMLV 185
                  + EL LL  +G+G+D   C  TG                  +         L 
Sbjct: 126 NPEPALRRFELALLAAMGYGVDFLHCAGTGEPVSPDMTYRYREQKGFIASVRRDNLTFLG 185

Query: 186 LPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENF 232
                  E +    + L++A + T     + AL+  +       RE F
Sbjct: 186 NELIAISERRFTSKEQLQAAKRFT-----RLALKPYLGGKPLKSRELF 228


>gi|332188696|ref|ZP_08390410.1| DNA repair protein RecO [Sphingomonas sp. S17]
 gi|332011260|gb|EGI53351.1| DNA repair protein RecO [Sphingomonas sp. S17]
          Length = 243

 Score =  124 bits (310), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 77/243 (31%), Positives = 108/243 (44%), Gaps = 4/243 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M+    AIIL VR +GE   I+  +TR  G   G+VR G+S  ++P+LQ GN +   WR+
Sbjct: 1   MHRVAPAIILSVRPHGEHGAIVRALTRDDGVQPGYVRGGRSRALRPVLQPGNAIIGEWRA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           R A+ L     E   S                        LPE +P   LYD L+  L  
Sbjct: 61  RTAEQLPALTLEPGHSRAGLHGEPLAAAGIEWLCALTAAALPEEQPYPILYDALDAVLTA 120

Query: 121 HKIPSV---IGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGL 177
            +            V+ EL+LL  +GFGLDL +C VTG T DL +VSPKSG AV      
Sbjct: 121 IESAPSARGWAGALVRYELLLLGQLGFGLDLERCTVTGGTDDLAFVSPKSGAAVSVGAAF 180

Query: 178 PYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLL 237
            Y  ++  LP FL +     D   + +A ++T +FL +  L          R     +  
Sbjct: 181 GYEARLFSLPLFLREGGAA-DWPDIFAAGRITAHFLARDILAGLRHDPMPARARLFDRFK 239

Query: 238 ELI 240
             +
Sbjct: 240 RAV 242


>gi|225631179|ref|ZP_03787882.1| DNA repair protein RecO [Wolbachia endosymbiont of Muscidifurax
           uniraptor]
 gi|225591127|gb|EEH12306.1| DNA repair protein RecO [Wolbachia endosymbiont of Muscidifurax
           uniraptor]
          Length = 240

 Score =  124 bits (310), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 79/242 (32%), Positives = 122/242 (50%), Gaps = 9/242 (3%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D+ II+  + YG+KN+IL + T+ +G+  G  +   +   +   Q  NL+   W +
Sbjct: 1   MRWKDEGIIIAAKKYGDKNLILSLFTKNHGKRRGLTKLTNNSNYK--FQISNLLHAEWSA 58

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLF-RFLPEREPCLELYDMLNIFLN 119
           +L +NLG F  E++ES         L    + S   +  + LPE EPC  LYD    F++
Sbjct: 59  KLPENLGFFECELIESPFHHFFQDRLKSITIVSFSSILEKVLPESEPCAMLYDNFRYFID 118

Query: 120 CHKIPSV-IGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
             K  +      ++ +EL+LL  +GF LDL+KC VTGV ++L ++SPK+G AV + VG  
Sbjct: 119 VIKHNNQSWQSHYLNLELLLLTQLGFKLDLSKCAVTGVKENLQFISPKTGRAVSKKVGDY 178

Query: 179 YAEKMLVLPSFLWKEEQT-----IDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFL 233
           YA+K+L  P  L                 +   ++T YFLNKY      +    LR   L
Sbjct: 179 YADKLLPFPQMLHDVYNNTLQNSYSFQEFQLGLKVTGYFLNKYLFLQLNVKFPELRNLML 238

Query: 234 GK 235
             
Sbjct: 239 SL 240


>gi|262404772|ref|ZP_06081327.1| DNA recombination and repair protein RecO [Vibrio sp. RC586]
 gi|262349804|gb|EEY98942.1| DNA recombination and repair protein RecO [Vibrio sp. RC586]
          Length = 241

 Score =  124 bits (310), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 39/228 (17%), Positives = 71/228 (31%), Gaps = 11/228 (4%)

Query: 8   IILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLAQN 65
            +L  R Y E ++IL++ + +YGR     +  +  R   +  LQ    + + W    +  
Sbjct: 9   FVLHRRPYSESSLILDIFSEEYGRVTLMAKGARGKRSNLKGALQPFTPLLLKWSGNGS-- 66

Query: 66  LGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPS 125
             +   +         LS       +     + R L        L+      L      +
Sbjct: 67  -MKTLRQAEPISLGLPLSGVYLYSAMYINELVDRVLMPEVASPGLFHDYLFALTELAQST 125

Query: 126 VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKMLV 185
                  + EL LL  +G+G+D   C  TG                  +         L 
Sbjct: 126 NPEPALRRFELALLAAMGYGVDFLHCAGTGEPVSPDMTYRYREQKGFIASVRRDNLTFLG 185

Query: 186 LPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENF 232
                  E +    + L++A + T     + AL+  +       RE F
Sbjct: 186 NELIAISERRFTSKEQLQAAKRFT-----RLALKPYLGGKPLKSRELF 228


>gi|262166500|ref|ZP_06034237.1| DNA recombination and repair protein RecO [Vibrio mimicus VM223]
 gi|262026216|gb|EEY44884.1| DNA recombination and repair protein RecO [Vibrio mimicus VM223]
          Length = 241

 Score =  123 bits (309), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 40/228 (17%), Positives = 71/228 (31%), Gaps = 11/228 (4%)

Query: 8   IILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLAQN 65
            +L  R Y E ++IL+V + +YGR     +  +  R   +  LQ    + + W    +  
Sbjct: 9   FVLHRRPYSESSLILDVFSEEYGRVTLMAKGARGKRSNLKGALQPFTPLLLKWSGNGS-- 66

Query: 66  LGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPS 125
             +   +         LS       +     + R L        L+      L      +
Sbjct: 67  -MKTLRQAEPISLGLPLSGVYLYSAMYINELVDRVLMPEVATPGLFHDYLFALTELAQST 125

Query: 126 VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKMLV 185
                  + EL LL ++G+G+D   C  TG                  +         L 
Sbjct: 126 NPEPALRRFELALLASMGYGVDFLHCAGTGEPVSPDMTYRYREQKGFIASVRRDNLTFLG 185

Query: 186 LPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENF 232
                  E      + L++A + T     + AL+  +       RE F
Sbjct: 186 NELIAISERSFTSKEQLQAAKRFT-----RLALKPYLGGKPLKSRELF 228


>gi|320155322|ref|YP_004187701.1| DNA recombination and repair protein RecO [Vibrio vulnificus
           MO6-24/O]
 gi|319930634|gb|ADV85498.1| DNA recombination and repair protein RecO [Vibrio vulnificus
           MO6-24/O]
          Length = 243

 Score =  123 bits (309), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 41/231 (17%), Positives = 76/231 (32%), Gaps = 11/231 (4%)

Query: 8   IILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLAQN 65
            +L  R Y E ++IL+V + ++GR     +  +S R   +  LQ    + + W  +    
Sbjct: 11  FVLHRRPYSESSLILDVFSEEFGRITLMSKGARSKRSNLKGALQPFTPLLLKWSGKG--- 67

Query: 66  LGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPS 125
             +   +         L+       +     + R L +  P   L+      L       
Sbjct: 68  AMKTLRQAEPISLGLPLTGIYLYSAMYVNELVGRVLMQEVPMPGLFHDYLFALTELAQAD 127

Query: 126 VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKMLV 185
                  + EL LL  +G+G+D   C  TG   D              +         L 
Sbjct: 128 NPEPALRRFELALLAAMGYGVDFLHCAGTGEPIDPQMTYRYREQKGFIASVRRDNLTFLG 187

Query: 186 LPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENFLGK 235
                  E + +  + L++A + T     + AL+  +       RE F+  
Sbjct: 188 NELIAISERRFLTKEQLQAAKRFT-----RIALKPYLGGKPLKSRELFIQM 233


>gi|218660067|ref|ZP_03515997.1| DNA repair protein RecO [Rhizobium etli IE4771]
          Length = 174

 Score =  123 bits (309), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 77/155 (49%), Positives = 110/155 (70%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M WQD AIILGV+ +GE ++I+EVMTR  GRHLG VR+G+S  MQP+LQ GN V V WR+
Sbjct: 19  MQWQDHAIILGVKRHGETSVIVEVMTRDRGRHLGLVRSGRSRAMQPVLQPGNAVEVIWRA 78

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           RL ++LGEFR E +    A+++ ++  +YG+Q++  L R LPER+P   L+D L + L+ 
Sbjct: 79  RLDEHLGEFRVEPVTLRAARMMETATAVYGVQAMGALLRLLPERDPHPHLFDALEVILDH 138

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTG 155
              P+  G++FV+ EL +L ++GFGLDL +C  TG
Sbjct: 139 LHNPADAGELFVRFELAVLNDLGFGLDLAECAATG 173


>gi|229514085|ref|ZP_04403547.1| DNA recombination and repair protein RecO [Vibrio cholerae TMA 21]
 gi|229349266|gb|EEO14223.1| DNA recombination and repair protein RecO [Vibrio cholerae TMA 21]
          Length = 241

 Score =  123 bits (309), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 40/228 (17%), Positives = 71/228 (31%), Gaps = 11/228 (4%)

Query: 8   IILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLAQN 65
            +L  R Y E ++IL+V + +YGR     +  +  R   +  LQ    + + W    +  
Sbjct: 9   FVLHRRPYSESSLILDVFSEEYGRVTLMAKGARGKRSNLKGALQPFTPLLLKWSGNSS-- 66

Query: 66  LGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPS 125
             +   +         LS       +     + R L        L+      L      +
Sbjct: 67  -MKTLRQAEPISLGLPLSGVYLYSAMYINELVDRVLMPEVASPGLFHDYLFALTELAQST 125

Query: 126 VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKMLV 185
                  + EL LL  +G+G+D   C  TG                  +         L 
Sbjct: 126 NPEPALRRFELALLAAMGYGVDFLHCAGTGEPVSPDMTYRYREQKGFIASIRRDNLTFLG 185

Query: 186 LPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENF 232
                  E +    + L++A + T     + AL+  +       RE F
Sbjct: 186 NELIAISERRFTSKEQLQAAKRFT-----RLALKPYLGGKPLKSRELF 228


>gi|156932892|ref|YP_001436808.1| hypothetical protein ESA_00694 [Cronobacter sakazakii ATCC BAA-894]
 gi|166221891|sp|A7MH01|RECO_ENTS8 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|156531146|gb|ABU75972.1| hypothetical protein ESA_00694 [Cronobacter sakazakii ATCC BAA-894]
          Length = 245

 Score =  123 bits (309), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 46/237 (19%), Positives = 77/237 (32%), Gaps = 14/237 (5%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVN 57
           M  WQ  A +L  R + E ++I+++ + + GR     +  +  R   +  LQ    + V 
Sbjct: 1   MEGWQ-RAFVLHARPWSETSLIIDLFSEESGRVRVVAKGARRKRSNLKGALQPFTPLLVR 59

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
           W  R                 A  LS      GL     + R L       EL+      
Sbjct: 60  WSGRGDVKN---LTSAEAVSLALPLSGITLYSGLYVNELVARVLEPETRFSELFFDYLHC 116

Query: 118 LNCHKI-PSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVG 176
           +               + EL LL ++G+G+D   C  TG   D              +  
Sbjct: 117 IQALAGASGSPEPALRRFELALLGHLGYGVDFLHCAGTGDEVDDAMTYRYREEKGFIASL 176

Query: 177 LPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENF 232
           +                 +  D D+L++A + T     + AL+  +       RE F
Sbjct: 177 VIDNTSFTGRQLKALATREFPDVDTLRAAKRFT-----RMALKPYLGGKPLKSRELF 228


>gi|58697108|ref|ZP_00372549.1| DNA repair protein RecO [Wolbachia endosymbiont of Drosophila
           simulans]
 gi|58698226|ref|ZP_00373146.1| DNA repair protein RecO [Wolbachia endosymbiont of Drosophila
           ananassae]
 gi|225630040|ref|YP_002726831.1| DNA repair protein RecO [Wolbachia sp. wRi]
 gi|254790743|sp|C0R5J8|RECO_WOLWR RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|58535253|gb|EAL59332.1| DNA repair protein RecO [Wolbachia endosymbiont of Drosophila
           ananassae]
 gi|58536603|gb|EAL59934.1| DNA repair protein RecO [Wolbachia endosymbiont of Drosophila
           simulans]
 gi|225592021|gb|ACN95040.1| DNA repair protein RecO [Wolbachia sp. wRi]
          Length = 240

 Score =  123 bits (309), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 78/242 (32%), Positives = 122/242 (50%), Gaps = 9/242 (3%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D+ II+  + YG+KN+IL + T+ +G+  G  +   +   +   Q  NL+   W +
Sbjct: 1   MRWKDEGIIIAAKKYGDKNLILSLFTKNHGKRRGLTKLTNNSNYK--FQISNLLHAEWSA 58

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLF-RFLPEREPCLELYDMLNIFLN 119
           +L +NLG F+ E++ES         L    + S   +  + LPE EPC  LYD    F++
Sbjct: 59  KLPENLGFFKCELIESSFHHFFQDRLKSITIVSFSSILEKVLPESEPCAVLYDNFRYFID 118

Query: 120 CHKIPSV-IGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
             K  +      ++ +EL+LL  +GF LDL+KC VTGV ++L ++SPK+G AV +  G  
Sbjct: 119 VIKHNNQSWQSHYLNLELLLLTQLGFKLDLSKCAVTGVKENLQFISPKTGRAVSKKAGDY 178

Query: 179 YAEKMLVLPSFLWKEEQT-----IDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFL 233
           YA+K+L  P  L                 +   ++T YFLNKY      +    LR   L
Sbjct: 179 YADKLLPFPQMLHDVYNNNLQNSYSFQEFQLGLKVTGYFLNKYLFLQLNVKFPELRNLML 238

Query: 234 GK 235
             
Sbjct: 239 SL 240


>gi|190149856|ref|YP_001968381.1| DNA repair protein RecO [Actinobacillus pleuropneumoniae serovar 7
           str. AP76]
 gi|307263179|ref|ZP_07544800.1| DNA repair protein recO [Actinobacillus pleuropneumoniae serovar 13
           str. N273]
 gi|238692329|sp|B3GX87|RECO_ACTP7 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|189914987|gb|ACE61239.1| DNA repair protein RecO [Actinobacillus pleuropneumoniae serovar 7
           str. AP76]
 gi|306871541|gb|EFN03264.1| DNA repair protein recO [Actinobacillus pleuropneumoniae serovar 13
           str. N273]
          Length = 240

 Score =  123 bits (309), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 41/243 (16%), Positives = 80/243 (32%), Gaps = 13/243 (5%)

Query: 2   YWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWR 59
            W     +L  R Y E +++++  T ++GR     +  +  R   + +LQ    + + W 
Sbjct: 4   NWH-RGFVLHRREYSETSLLVDFFTEEHGRITLLAKGARRPRSPLKAVLQPFTPLLLRWS 62

Query: 60  SRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLN 119
            +              +     + +     G      L R L  +    EL+      + 
Sbjct: 63  GKGDLKTLTKAEP---ASLTLPMQTLALYSGFYVNEVLARVLENQTAYPELFQHYLQCMT 119

Query: 120 CHK-IPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
                P  I  I    E  +LK +G+G++ + C  TG                  +  L 
Sbjct: 120 RLATQPEQIEPILRTFEFQMLKALGYGVNFSICAATGDPVSPSMTYQFKENEGFIASLLR 179

Query: 179 YAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENFLGKLL 237
                L      +++    D  +L++A + T     + AL+  +       RE F   L 
Sbjct: 180 NNASFLGKDLLAFEQLDFSDKATLQAAKRFT-----RMALKPYLGSQPLKSRELFQSILP 234

Query: 238 ELI 240
             +
Sbjct: 235 NKL 237


>gi|218710567|ref|YP_002418188.1| DNA repair protein RecO [Vibrio splendidus LGP32]
 gi|254790741|sp|B7VK77|RECO_VIBSL RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|218323586|emb|CAV19825.1| DNA repair protein recO [Vibrio splendidus LGP32]
          Length = 242

 Score =  123 bits (308), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 41/232 (17%), Positives = 74/232 (31%), Gaps = 11/232 (4%)

Query: 8   IILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLAQN 65
            +L  R Y E ++IL+V + +YGR     +  +S R   +  LQ    + + W    +  
Sbjct: 9   FVLHRRPYSESSLILDVFSEEYGRVTLMSKGARSKRSNLKGALQPFTPLLLKWSGNGS-- 66

Query: 66  LGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPS 125
             +   +         L+       +     + R L         +      L       
Sbjct: 67  -MKTLRQAEPISLGLPLAGINLYSAMYVNELVGRVLMAEVAMPAFFHDYLHALTELAHNE 125

Query: 126 VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKMLV 185
                  + EL LL  +G+G+D   C  TG   D              +         + 
Sbjct: 126 NPEPALRRFELALLSAMGYGVDFLHCAGTGEAIDPSMTYRYREQKGFIASVRRDNLTFMG 185

Query: 186 LPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENFLGKL 236
                  E + I  + LK+A + T     + AL+  +       RE F+  +
Sbjct: 186 DELIAISERRFITKEQLKAAKRFT-----RIALKPYLGGKPLKSRELFMPTI 232


>gi|303252177|ref|ZP_07338345.1| DNA repair protein RecO [Actinobacillus pleuropneumoniae serovar 2
           str. 4226]
 gi|307247517|ref|ZP_07529562.1| DNA repair protein recO [Actinobacillus pleuropneumoniae serovar 2
           str. S1536]
 gi|302648960|gb|EFL79148.1| DNA repair protein RecO [Actinobacillus pleuropneumoniae serovar 2
           str. 4226]
 gi|306856020|gb|EFM88178.1| DNA repair protein recO [Actinobacillus pleuropneumoniae serovar 2
           str. S1536]
          Length = 240

 Score =  123 bits (308), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 41/243 (16%), Positives = 80/243 (32%), Gaps = 13/243 (5%)

Query: 2   YWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWR 59
            W     +L  R Y E +++++  T ++GR     +  +  R   + +LQ    + + W 
Sbjct: 4   NWH-RGFVLHRREYSETSLLVDFFTEEHGRITLLAKGARRPRSPLKAVLQPFTPLLLRWS 62

Query: 60  SRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLN 119
            +              +     + +     G      L R L  +    EL+      + 
Sbjct: 63  GKGDLKTLTKAEP---ASLTLPMQTLALYSGFYVNEVLARVLENQTAYPELFQHYLQCMT 119

Query: 120 CHK-IPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
                P  I  I    E  +LK +G+G++ + C  TG                  +  L 
Sbjct: 120 RLATQPKQIEPILRTFEFQMLKALGYGVNFSICAATGDPVSPSMTYQFRENQGFIASLLQ 179

Query: 179 YAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENFLGKLL 237
                L      +++    D  +L++A + T     + AL+  +       RE F   L 
Sbjct: 180 NNYTFLGKDLLAFEQLDFSDKATLQAAKRFT-----RIALKPYLGSQPLKSRELFQSVLP 234

Query: 238 ELI 240
             +
Sbjct: 235 NKL 237


>gi|42520114|ref|NP_966029.1| DNA repair protein RecO [Wolbachia endosymbiont of Drosophila
           melanogaster]
 gi|81652824|sp|Q73IE9|RECO_WOLPM RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|42409851|gb|AAS13963.1| recO-related protein [Wolbachia endosymbiont of Drosophila
           melanogaster]
          Length = 240

 Score =  123 bits (308), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 79/242 (32%), Positives = 123/242 (50%), Gaps = 9/242 (3%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D+ II+  + YG+KN+IL + T+ +G+  G  +   +   +   Q  NL+   W +
Sbjct: 1   MRWKDEGIIIAAKKYGDKNLILSLFTKNHGKRRGLTKLTNNSNYK--FQISNLLHAEWSA 58

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLF-RFLPEREPCLELYDMLNIFLN 119
           +L +NLG  + E++ES         L    + S   +  + LPE EPC  LYD L  F++
Sbjct: 59  KLPENLGFLKCELIESPFHHFFQDRLKSITIVSFSSILEKVLPESEPCAMLYDNLRYFID 118

Query: 120 CHKIPSV-IGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
             K  +      ++ +EL+LL  +GF LDL+KC VTGV ++L ++SPK+G AV + VG  
Sbjct: 119 VIKHNNQSWQSHYLNLELLLLTQLGFKLDLSKCAVTGVKENLQFISPKTGRAVSKKVGDY 178

Query: 179 YAEKMLVLPSFLWKEEQT-----IDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFL 233
           YA+K+L  P  L                 +   ++T YFLNKY      +    LR   L
Sbjct: 179 YADKLLPFPQMLHDVYNNNLQNSYSFQEFQLGLKVTGYFLNKYLFLQLNVKFPELRNLML 238

Query: 234 GK 235
             
Sbjct: 239 SL 240


>gi|222475203|ref|YP_002563619.1| DNA repair protein RecO [Anaplasma marginale str. Florida]
 gi|254790506|sp|B9KIQ1|RECO_ANAMF RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|222419340|gb|ACM49363.1| DNA repair protein RecO [Anaplasma marginale str. Florida]
          Length = 238

 Score =  123 bits (308), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 75/242 (30%), Positives = 123/242 (50%), Gaps = 11/242 (4%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W++  +++G R YG+++++L ++TR  G   G  R  +       LQ G+L+   WR+
Sbjct: 1   MQWREMGVVMGTRPYGDEHLLLSILTRNRGLRRGLTRLTKKR----PLQIGDLIDATWRA 56

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLN 119
           +L  NLG F  EV+ S         + L  L SI  +    LPE EP   LYD    F  
Sbjct: 57  KLPTNLGHFTCEVIASAFYSYFRDRIKLMCLSSITHIMSTALPENEPHPTLYDSFQDFAA 116

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
             +  +     ++++EL++L  +GF LDL+KC V+    +LL++SPK+G A+  +VG  Y
Sbjct: 117 AAEAEAPWYNHYLKLELLVLSQLGFALDLSKCAVSNSKDNLLFISPKTGRALSEAVGHAY 176

Query: 180 AEKMLVLPSFLWK-----EEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLG 234
             K+L LP  L       E +   AD    + ++  +FL+++ LQ +       R+   G
Sbjct: 177 RNKLLPLPKVLRSISCGVETECCSADEFALSLKILGFFLHRHLLQESH-TFQESRKILTG 235

Query: 235 KL 236
            L
Sbjct: 236 LL 237


>gi|37681013|ref|NP_935622.1| DNA repair protein RecO [Vibrio vulnificus YJ016]
 gi|42559437|sp|Q7MHP0|RECO_VIBVY RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|37199763|dbj|BAC95593.1| Recombinational DNA repair protein [Vibrio vulnificus YJ016]
          Length = 243

 Score =  123 bits (308), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 42/231 (18%), Positives = 76/231 (32%), Gaps = 11/231 (4%)

Query: 8   IILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLAQN 65
            +L  R Y E ++IL+V + ++GR     +  +S R   +  LQ    + + W  +    
Sbjct: 11  FVLHRRPYSESSLILDVFSEEFGRITLMSKGARSKRSNLKGALQPFTPLLLKWSGKG--- 67

Query: 66  LGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPS 125
             +   +         L+       L     + R L +  P   L+      L       
Sbjct: 68  AMKTLRQAEPISLGLPLTGINLYSALYVNELIGRVLMQEVPMPGLFHDYLFALTELAQAD 127

Query: 126 VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKMLV 185
                  + EL LL  +G+G+D   C  TG   D              +         L 
Sbjct: 128 NPEPALRRFELALLAAMGYGVDFLHCAGTGEPIDPQMTYRYREQKGFIASVRRDNLTFLG 187

Query: 186 LPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENFLGK 235
                  E + +  + L++A + T     + AL+  +       RE F+  
Sbjct: 188 NELIAISERRFLTKEQLQAAKRFT-----RIALKPYLGGKPLKSRELFIQM 233


>gi|99035892|ref|ZP_01314943.1| hypothetical protein Wendoof_01000221 [Wolbachia endosymbiont of
           Drosophila willistoni TSC#14030-0811.24]
          Length = 240

 Score =  123 bits (308), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 79/242 (32%), Positives = 123/242 (50%), Gaps = 9/242 (3%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D+ II+  + YG+KN+IL + T+ +G+  G  +   +   +   Q  NL+   W +
Sbjct: 1   MRWKDEGIIIAAKKYGDKNLILSLFTKNHGKRRGLTKLTNNSNYK--FQISNLLHAEWSA 58

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLF-RFLPEREPCLELYDMLNIFLN 119
           +L +NLG F+ E++ES         L    + S   +  + LPE EPC  LYD    F++
Sbjct: 59  KLPENLGFFKCELIESPFHHFFQDRLKSITIVSFSSILEKVLPESEPCAMLYDNFRYFID 118

Query: 120 CHKIPSV-IGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
             K  +      ++ +EL+LL  +GF LDL+KC VTGV ++L ++SPK+G AV + VG  
Sbjct: 119 VIKHNNQSWQSHYLNLELLLLTQLGFKLDLSKCAVTGVKENLQFISPKTGRAVSKKVGDY 178

Query: 179 YAEKMLVLPSFLWKEEQT-----IDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFL 233
           YA+K+L  P  L                 +   ++T YFLNKY      +    LR   L
Sbjct: 179 YADKLLPFPQMLHDVYNNNLQNSYSFQEFQLGLKVTGYFLNKYLFLQLNVKFPELRNLML 238

Query: 234 GK 235
             
Sbjct: 239 SL 240


>gi|323499983|ref|ZP_08104939.1| DNA repair protein RecO [Vibrio sinaloensis DSM 21326]
 gi|323314949|gb|EGA68004.1| DNA repair protein RecO [Vibrio sinaloensis DSM 21326]
          Length = 240

 Score =  122 bits (307), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 42/229 (18%), Positives = 72/229 (31%), Gaps = 11/229 (4%)

Query: 8   IILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLAQN 65
            +L  R Y E ++IL+V + ++GR     +  +S R   +  LQ    + + W    +  
Sbjct: 10  FVLHRRPYSESSLILDVFSEEFGRVTLMSKGARSKRSNLKGALQPFTPLLLKWSGNGS-- 67

Query: 66  LGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPS 125
             +   +         L        +     + R L    P   L+      L       
Sbjct: 68  -MKTLRQAEPISLGLPLFGINLYSAMYVNELVGRVLMAEVPMPALFHDYLHALTELAQSD 126

Query: 126 VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKMLV 185
                  + EL LL  +G+G+D   C  TG   D              +           
Sbjct: 127 NPEPALRRFELALLSAMGYGVDFMHCAGTGEPVDPGMTYRYREQKGFIASVRRDNLTFYG 186

Query: 186 LPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENFL 233
                  E +    + LK+A + T     + AL+  +       RE FL
Sbjct: 187 SELIAISERRFTTKEQLKAAKRFT-----RIALKPYLGGKPLKSRELFL 230


>gi|261253898|ref|ZP_05946471.1| DNA recombination and repair protein RecO [Vibrio orientalis CIP
           102891]
 gi|260937289|gb|EEX93278.1| DNA recombination and repair protein RecO [Vibrio orientalis CIP
           102891]
          Length = 255

 Score =  122 bits (307), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 41/232 (17%), Positives = 74/232 (31%), Gaps = 11/232 (4%)

Query: 8   IILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLAQN 65
            +L  R Y E ++IL+V + +YGR     +  +S R   +  LQ    + + W    +  
Sbjct: 24  FVLHRRPYSESSLILDVFSEEYGRVTLMSKGARSKRSNLKGALQPFTPLLLKWSGNGS-- 81

Query: 66  LGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPS 125
             +   +         L+      G+     + R L        L+      L       
Sbjct: 82  -MKTLRQAEPISLGLPLTGINLYSGMYVNELIGRVLMAEVAMPALFHDYLHALTELAQAD 140

Query: 126 VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKMLV 185
                  + EL LL  +G+G+D   C  +G   D              +           
Sbjct: 141 NPEPALRRFELALLSAMGYGVDFLHCAGSGEPIDPGMTYRYREQKGFIASVRHDNLTFRG 200

Query: 186 LPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENFLGKL 236
                  E +    + LK+A + T     + AL+  +       RE F+  +
Sbjct: 201 DELIAISERRFTTKEQLKAAKRFT-----RIALKPYLGGKPLKSRELFMSMI 247


>gi|260775206|ref|ZP_05884104.1| DNA recombination and repair protein RecO [Vibrio coralliilyticus
           ATCC BAA-450]
 gi|260608907|gb|EEX35069.1| DNA recombination and repair protein RecO [Vibrio coralliilyticus
           ATCC BAA-450]
          Length = 242

 Score =  122 bits (307), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 40/232 (17%), Positives = 75/232 (32%), Gaps = 11/232 (4%)

Query: 8   IILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLAQN 65
            +L  R Y E ++IL+V + ++GR     +  +S R   +  LQ    + + W  + +  
Sbjct: 10  FVLHRRPYSESSLILDVFSEEFGRVTLMSKGARSKRSNLKGALQPFTPLLLKWSGKGS-- 67

Query: 66  LGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPS 125
             +   +         L+       +     + R L        L+      L       
Sbjct: 68  -MKTLRQAEPISLGLPLTGINLYSAMYVNELIGRVLMAEVSMPALFHDYLHALTELAQCE 126

Query: 126 VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKMLV 185
                  + EL LL  +G+G+D   C  TG   +              +         + 
Sbjct: 127 NPEPALRRFELALLSAMGYGVDFLHCAGTGEPIEPEMTYRYREQKGFIASVRRDNLTFVG 186

Query: 186 LPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENFLGKL 236
                  E +    + LK+A + T     + AL+  +       RE F+  L
Sbjct: 187 NELIAISERRFTTKEQLKAAKRFT-----RIALKPYLGGKPLKSRELFMQIL 233


>gi|254360746|ref|ZP_04976894.1| DNA recombination protein RecO [Mannheimia haemolytica PHL213]
 gi|153091316|gb|EDN73290.1| DNA recombination protein RecO [Mannheimia haemolytica PHL213]
          Length = 240

 Score =  122 bits (307), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 44/242 (18%), Positives = 80/242 (33%), Gaps = 12/242 (4%)

Query: 2   YWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWR 59
            WQ  A +L  R Y E ++++E  T  +GR     +  +  R   + +LQ    + + W 
Sbjct: 5   QWQ-RAFVLHRREYSENSLLVEFFTEHHGRITLLAKGARRARSPLKAVLQPFTPLLLRWS 63

Query: 60  SRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLN 119
            +              +     + +     G      L R L  +    EL+      + 
Sbjct: 64  GKGDLKTLTKAEP---AALTLPMETLSLYSGFYINEVLARVLENQTAYPELFQHYLRCIT 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                  I  I    E   LK +G+G+D T C  TG+  D              +  L  
Sbjct: 121 ELATQKQIEPILRTFEFHTLKALGYGVDFTHCAATGLPVDPKMTYQFQENQGFIASLLQN 180

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENFLGKLLE 238
            +  L      + +    +  + ++A + T     + AL+  +       RE F   L  
Sbjct: 181 NQSFLGSDLLAFAQLDFSEKSTQQAAKRFT-----RMALKPYLGSQPLKSRELFQSILPN 235

Query: 239 LI 240
            +
Sbjct: 236 KL 237


>gi|303251582|ref|ZP_07337756.1| DNA repair protein RecO [Actinobacillus pleuropneumoniae serovar 6
           str. Femo]
 gi|307245402|ref|ZP_07527490.1| DNA repair protein recO [Actinobacillus pleuropneumoniae serovar 1
           str. 4074]
 gi|307249748|ref|ZP_07531727.1| DNA repair protein recO [Actinobacillus pleuropneumoniae serovar 4
           str. M62]
 gi|307252105|ref|ZP_07534004.1| DNA repair protein recO [Actinobacillus pleuropneumoniae serovar 6
           str. Femo]
 gi|307254357|ref|ZP_07536195.1| DNA repair protein recO [Actinobacillus pleuropneumoniae serovar 9
           str. CVJ13261]
 gi|307256564|ref|ZP_07538345.1| DNA repair protein recO [Actinobacillus pleuropneumoniae serovar 10
           str. D13039]
 gi|307258815|ref|ZP_07540547.1| DNA repair protein recO [Actinobacillus pleuropneumoniae serovar 11
           str. 56153]
 gi|302649580|gb|EFL79762.1| DNA repair protein RecO [Actinobacillus pleuropneumoniae serovar 6
           str. Femo]
 gi|306853743|gb|EFM85960.1| DNA repair protein recO [Actinobacillus pleuropneumoniae serovar 1
           str. 4074]
 gi|306858256|gb|EFM90333.1| DNA repair protein recO [Actinobacillus pleuropneumoniae serovar 4
           str. M62]
 gi|306860405|gb|EFM92419.1| DNA repair protein recO [Actinobacillus pleuropneumoniae serovar 6
           str. Femo]
 gi|306862656|gb|EFM94612.1| DNA repair protein recO [Actinobacillus pleuropneumoniae serovar 9
           str. CVJ13261]
 gi|306864974|gb|EFM96876.1| DNA repair protein recO [Actinobacillus pleuropneumoniae serovar 10
           str. D13039]
 gi|306867166|gb|EFM99022.1| DNA repair protein recO [Actinobacillus pleuropneumoniae serovar 11
           str. 56153]
          Length = 240

 Score =  122 bits (306), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 41/243 (16%), Positives = 80/243 (32%), Gaps = 13/243 (5%)

Query: 2   YWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWR 59
            W     +L  R Y E +++++  T ++GR     +  +  R   + +LQ    + + W 
Sbjct: 4   NWH-RGFVLHRREYSETSLLVDFFTEEHGRITLLAKGARRPRSPLKAVLQPFTPLLLRWS 62

Query: 60  SRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLN 119
            +              +     + +     G      L R L  +    EL+      + 
Sbjct: 63  GKGDLKTLTKAEP---ASLTLPMQTLALYSGFYVNEVLARVLENQTAYPELFQHYLQCMT 119

Query: 120 CHK-IPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
                P  I  I    E  +LK +G+G++ + C  TG                  +  L 
Sbjct: 120 RLATQPKQIEPILRTFEFQMLKALGYGVNFSICAATGDPVSPSMTYQFRENQGFIASLLQ 179

Query: 179 YAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENFLGKLL 237
                L      +++    D  +L++A + T     + AL+  +       RE F   L 
Sbjct: 180 NNYTFLGKDLLAFEQLDFSDKATLQAAKRFT-----RMALKPYLGSQPLKSRELFQSILP 234

Query: 238 ELI 240
             +
Sbjct: 235 NKL 237


>gi|237732551|ref|ZP_04563032.1| DNA repair protein recO [Citrobacter sp. 30_2]
 gi|226908090|gb|EEH94008.1| DNA repair protein recO [Citrobacter sp. 30_2]
          Length = 236

 Score =  122 bits (306), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 47/237 (19%), Positives = 81/237 (34%), Gaps = 14/237 (5%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVN 57
           M  WQ  A +L  R + E +++L+V T + GR     +  +S R   +  LQ    + + 
Sbjct: 1   MEGWQ-RAFVLHSRPWSETSLVLDVFTEESGRVRLVAKGARSKRSNLKGALQPFTPLLLR 59

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
           +  R                 A  LS      GL     + R L        L+      
Sbjct: 60  FGGRGEVKTLR---SAEAVSLALPLSGITLYSGLYINELISRVLEYETRFSALFFDYLNC 116

Query: 118 LNCHKIPS-VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVG 176
           +      +        + EL LL ++G+G+D T C  +G   D              +  
Sbjct: 117 IQALAGATGSPEPALRRFELALLGHLGYGVDFTHCAGSGEPVDDTMTYRYREEKGFIASV 176

Query: 177 LPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENF 232
           +              +  +  DAD+L++A + T     + AL+  +       RE F
Sbjct: 177 VIDNATFTGRHLKALESREFPDADTLRAAKRFT-----RMALKPYLGGKPLKSRELF 228


>gi|172045973|sp|A4WDD6|RECO_ENT38 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
          Length = 235

 Score =  122 bits (306), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 48/237 (20%), Positives = 80/237 (33%), Gaps = 14/237 (5%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVN 57
           M  WQ  A +L  R + E +++L+V T + GR     +  +S R   +  LQ    + V 
Sbjct: 1   MEGWQ-RAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKRSNLKGALQPFTPLLVR 59

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
           +  R                 A  LS      GL     + R L       EL+      
Sbjct: 60  FGGRGEVKTLR---SAEAVSLALPLSGITLYSGLYVNELISRVLEHETRFSELFFDYLHC 116

Query: 118 LNCHK-IPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVG 176
           +               + EL LL ++G+G+D   C  +G + D              +  
Sbjct: 117 IQALAGATDSPEPALRRFELALLGHLGYGVDFLHCAGSGDSVDDTMTYRYREEKGFIASI 176

Query: 177 LPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENF 232
           +               E +  D D+L++A + T     + AL+  +       RE F
Sbjct: 177 VIDNTTFTGRHLRALSEREFPDQDTLRAAKRFT-----RIALKPYLGGKPLKSRELF 228


>gi|46143334|ref|ZP_00135440.2| COG1381: Recombinational DNA repair protein (RecF pathway)
           [Actinobacillus pleuropneumoniae serovar 1 str. 4074]
 gi|126208027|ref|YP_001053252.1| DNA repair protein RecO [Actinobacillus pleuropneumoniae L20]
 gi|166221881|sp|A3MZR1|RECO_ACTP2 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|126096819|gb|ABN73647.1| DNA repair protein RecO [Actinobacillus pleuropneumoniae serovar 5b
           str. L20]
          Length = 240

 Score =  122 bits (306), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 41/243 (16%), Positives = 80/243 (32%), Gaps = 13/243 (5%)

Query: 2   YWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWR 59
            W     +L  R Y E +++++  T ++GR     +  +  R   + +LQ    + + W 
Sbjct: 4   NWH-RGFVLHRREYSETSLLVDFFTEEHGRVTLLAKGARRPRSPLKAVLQPFTPLLLRWS 62

Query: 60  SRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLN 119
            +              +     + +     G      L R L  +    EL+      + 
Sbjct: 63  GKGDLKTLTKAEP---ASLTLPMQTLALYSGFYVNEVLARVLENQTAYPELFQHYLQCMT 119

Query: 120 CHK-IPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
                P  I  I    E  +LK +G+G++ + C  TG                  +  L 
Sbjct: 120 RLATQPKQIEPILRTFEFQMLKALGYGVNFSICAATGDPVSPSMTYQFRENQGFIASLLQ 179

Query: 179 YAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENFLGKLL 237
                L      +++    D  +L++A + T     + AL+  +       RE F   L 
Sbjct: 180 NNYTFLGKDLLAFEQLNFSDKATLQAAKRFT-----RMALKPYLGSQPLKSRELFQSILP 234

Query: 238 ELI 240
             +
Sbjct: 235 NKL 237


>gi|168821431|ref|ZP_02833431.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|205342020|gb|EDZ28784.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|320087080|emb|CBY96849.1| DNA repair protein recO Recombination protein O [Salmonella
           enterica subsp. enterica serovar Weltevreden str.
           2007-60-3289-1]
          Length = 242

 Score =  122 bits (306), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 48/237 (20%), Positives = 81/237 (34%), Gaps = 14/237 (5%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVN 57
           M  WQ  A +L  R + E +++L+V T + GR     +  +S R   +  LQ    + + 
Sbjct: 1   MEGWQ-RAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKRSNLKGALQPFTPLLLR 59

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
           +  R                 A  LS      GL     L R L       EL+      
Sbjct: 60  YSGRGEVKTLR---SAEAVSLALPLSGITLYSGLYINELLSRVLEYETRFSELFFDYLNC 116

Query: 118 LNCHK-IPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVG 176
           +               + EL LL ++G+G++ T C  +G   D              +  
Sbjct: 117 IQALAGTTGSPEPALRRFELALLGHLGYGVNFTHCAGSGERVDDTMTYRYREEKGFFASV 176

Query: 177 LPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENF 232
           +              +E +  D D+L++A + T     + AL+  +       RE F
Sbjct: 177 VIDNNTFTGRHLKALEEREFPDVDTLRAAKRFT-----RMALKPYLGGKPLKSRELF 228


>gi|168238324|ref|ZP_02663382.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
 gi|194738093|ref|YP_002115642.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|238693669|sp|B4TS12|RECO_SALSV RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|194713595|gb|ACF92816.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|197288836|gb|EDY28209.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
 gi|322613349|gb|EFY10291.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315996572]
 gi|322620447|gb|EFY17312.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-1]
 gi|322625085|gb|EFY21914.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-3]
 gi|322629471|gb|EFY26247.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-4]
 gi|322633858|gb|EFY30597.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-1]
 gi|322635464|gb|EFY32175.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-2]
 gi|322639860|gb|EFY36539.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Montevideo str. 531954]
 gi|322644254|gb|EFY40798.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Montevideo str. NC_MB110209-0054]
 gi|322649946|gb|EFY46366.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Montevideo str. OH_2009072675]
 gi|322654871|gb|EFY51188.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Montevideo str. CASC_09SCPH15965]
 gi|322658201|gb|EFY54467.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Montevideo str. 19N]
 gi|322661727|gb|EFY57945.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Montevideo str. 81038-01]
 gi|322669708|gb|EFY65854.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Montevideo str. MD_MDA09249507]
 gi|322673285|gb|EFY69390.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Montevideo str. 414877]
 gi|322674926|gb|EFY71013.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Montevideo str. 366867]
 gi|322682949|gb|EFY78967.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Montevideo str. 413180]
 gi|322685610|gb|EFY81605.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Montevideo str. 446600]
 gi|323191962|gb|EFZ77200.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609458-1]
 gi|323200405|gb|EFZ85486.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556150-1]
 gi|323201305|gb|EFZ86372.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609460]
 gi|323208375|gb|EFZ93315.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Montevideo str. 507440-20]
 gi|323211549|gb|EFZ96387.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556152]
 gi|323215981|gb|EGA00713.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB101509-0077]
 gi|323221762|gb|EGA06170.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB102109-0047]
 gi|323225630|gb|EGA09857.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB110209-0055]
 gi|323229348|gb|EGA13472.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB111609-0052]
 gi|323235337|gb|EGA19421.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009083312]
 gi|323237477|gb|EGA21540.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009085258]
 gi|323245232|gb|EGA29233.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315731156]
 gi|323248806|gb|EGA32733.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2009159199]
 gi|323254014|gb|EGA37835.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008282]
 gi|323259062|gb|EGA42710.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008283]
 gi|323267768|gb|EGA51249.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008285]
 gi|323269673|gb|EGA53125.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008287]
          Length = 242

 Score =  122 bits (306), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 47/237 (19%), Positives = 79/237 (33%), Gaps = 14/237 (5%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVN 57
           M  WQ  A +L  R + E +++L+V T + GR     +  +S R   +  LQ    + + 
Sbjct: 1   MEGWQ-RAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKRSNLKGALQPFTPLLLR 59

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
           +  R                 A  LS      GL     L R L       EL+      
Sbjct: 60  YSGRGEVKTLR---SAEAVSLALPLSGITLYSGLYINELLSRVLEYETRFSELFFDYLNC 116

Query: 118 LNCHK-IPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVG 176
           +               + EL LL ++G+G++ T C  +G   D              +  
Sbjct: 117 IQALAGTTGSPEPALRRFELALLGHLGYGVNFTHCAGSGERVDDTMTYRYREEKGFFASV 176

Query: 177 LPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENF 232
           +                 +  D D+L++A + T     + AL+  +       RE F
Sbjct: 177 VIDNNTFTGRHLKALDAREFPDVDTLRAAKRFT-----RMALKPYLGGKPLKSRELF 228


>gi|56416838|ref|YP_153912.1| DNA repair protein RecO [Anaplasma marginale str. St. Maries]
 gi|81599148|sp|Q5PAM3|RECO_ANAMM RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|56388070|gb|AAV86657.1| hypothetical protein AM680 [Anaplasma marginale str. St. Maries]
          Length = 238

 Score =  122 bits (306), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 75/242 (30%), Positives = 123/242 (50%), Gaps = 11/242 (4%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W++  +++G R YG+++++L ++TR  G   G  R  +       LQ G+L+   WR+
Sbjct: 1   MQWREMGVVMGTRPYGDEHLLLSILTRNRGLRRGLTRFTKKR----PLQIGDLIDATWRA 56

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLN 119
           +L  NLG F  EV+ S         + L  L SI  +    LPE EP   LYD    F  
Sbjct: 57  KLPTNLGHFTCEVIASAFYSYFRDRIKLMCLSSITHIMSTALPENEPHPTLYDSFQDFAA 116

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
             +  +     ++++EL++L  +GF LDL+KC V+    +LL++SPK+G A+  +VG  Y
Sbjct: 117 AAEAEAPWYNHYLKLELLVLSQLGFALDLSKCAVSNSKDNLLFISPKTGRALSEAVGCAY 176

Query: 180 AEKMLVLPSFLWK-----EEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLG 234
            +K+L LP  L       E +   AD    + ++  +FL ++ LQ +       R+   G
Sbjct: 177 RDKLLPLPKVLRSISCGVETECCSADEFALSLRILGFFLRRHLLQESH-TFQESRKILTG 235

Query: 235 KL 236
            L
Sbjct: 236 LL 237


>gi|270265298|ref|ZP_06193559.1| hypothetical protein SOD_m00300 [Serratia odorifera 4Rx13]
 gi|270040702|gb|EFA13805.1| hypothetical protein SOD_m00300 [Serratia odorifera 4Rx13]
          Length = 243

 Score =  122 bits (306), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 49/238 (20%), Positives = 80/238 (33%), Gaps = 12/238 (5%)

Query: 5   DDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRL 62
           + A +L  R Y E +++L++ T  +GR     +  +S R   +  LQ    + V W  R 
Sbjct: 5   ERAFVLHGRPYSETSLMLDMFTEGHGRVRLLAKGARSRRSNLKGCLQPFTPLLVRWGGRG 64

Query: 63  AQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCH- 121
                              LS  +   GL     L R L +      L+      L    
Sbjct: 65  EVKTLRNAEA---VSLGLPLSGMMLYSGLYVNELLSRVLEQEANYSVLFFDYLQCLQALA 121

Query: 122 KIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAE 181
                  +   Q EL LL ++G+GLD   C  +G   D              +  +    
Sbjct: 122 AEDISPEQALRQFELALLNHLGYGLDFLHCAGSGQPVDDGMTYRYREEKGFIASLVVDHY 181

Query: 182 KMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENFLGKLLE 238
                      E Q  DA +L++A + T     + AL+  +       RE F   + +
Sbjct: 182 SFTGRELRALAERQFPDAQTLRAAKRFT-----RMALKPYLGGKPLKSRELFRQFVRK 234


>gi|85059763|ref|YP_455465.1| DNA repair protein RecO [Sodalis glossinidius str. 'morsitans']
 gi|119361486|sp|Q2NS15|RECO_SODGM RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|84780283|dbj|BAE75060.1| DNA repair protein RecO [Sodalis glossinidius str. 'morsitans']
          Length = 260

 Score =  122 bits (306), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 48/234 (20%), Positives = 77/234 (32%), Gaps = 13/234 (5%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRS 60
           WQ  A +L  R Y E +++L+  T Q GR     +  +S R   + +LQ    +   W  
Sbjct: 4   WQ-RAFVLHARPYSETSLLLDFFTEQQGRVRVLAKGARSRRSALKGVLQPFTPLLARWSG 62

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           R                    LS  +   GL     L R L       +L+      L  
Sbjct: 63  RGEVKTLRSAEP---VSLGLPLSGLMLYSGLYINELLSRVLDHETDYSKLFYDYLHCLQW 119

Query: 121 HKIPS-VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
               +        + EL LL ++G+G+D   C  +G   D              +  L  
Sbjct: 120 LAGATGSPEPALRRFELALLSHLGYGVDFLHCAGSGEPVDDAMTYRYREEKGFTASVLLD 179

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENF 232
                        E +  D D+L++A + T     + AL+  +        E F
Sbjct: 180 RYSFSGRELRALAEGEFPDIDTLRAAKRFT-----RMALKPYLGGKPLKSHELF 228


>gi|190570798|ref|YP_001975156.1| recO-related protein [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|213019675|ref|ZP_03335480.1| recO-related protein [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
 gi|254790742|sp|B3CPG9|RECO_WOLPP RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|190357070|emb|CAQ54467.1| recO-related protein [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|212994716|gb|EEB55359.1| recO-related protein [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
          Length = 242

 Score =  122 bits (306), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 78/241 (32%), Positives = 122/241 (50%), Gaps = 9/241 (3%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+D+ +I+ V+ YG+KN+IL + T+ +G+  G  R   +   +   Q  NL+   W +
Sbjct: 1   MRWKDEGVIIAVKKYGDKNLILSLFTKNHGKCRGLTRLTNNSNYK--FQISNLLHAEWSA 58

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLF-RFLPEREPCLELYDMLNIFLN 119
           +L +NLG  + E++ES         L    + S   +  + LPE E C++LYD    F++
Sbjct: 59  KLPENLGFLKCELIESPFHHFFQDRLKSIAIVSFSSILEKVLPESESCIKLYDNFRHFID 118

Query: 120 CHKIP-SVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
             K         ++ +EL+LL  +GF LDL+KC VTGV ++L ++SPK+G AV + VG  
Sbjct: 119 VIKHNSQFWQSHYLNLELLLLTQLGFKLDLSKCAVTGVKENLQFISPKTGRAVSKKVGDC 178

Query: 179 YAEKMLVLPSFLWKEEQT-----IDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFL 233
           YA+K+L  P  L                 +   ++T YFLNKY           LR   L
Sbjct: 179 YADKLLPFPQMLHDVYNNNLQNSYSYQEFRLGLKITGYFLNKYLFLQLNAKFPELRNFML 238

Query: 234 G 234
            
Sbjct: 239 S 239


>gi|198245563|ref|YP_002216646.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|238690360|sp|B5FRC3|RECO_SALDC RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|197940079|gb|ACH77412.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|326624401|gb|EGE30746.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Dublin str. 3246]
          Length = 242

 Score =  122 bits (306), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 48/237 (20%), Positives = 82/237 (34%), Gaps = 14/237 (5%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVN 57
           M  WQ  A +L  R + E +++L+V T + GR     +  +S R   + +LQ    + + 
Sbjct: 1   MEGWQ-RAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKRSNLKGVLQPFTPLLLR 59

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
           +  R                 A  LS      GL     L R L       EL+      
Sbjct: 60  YSGRGEVKTLR---SAEAVSLALPLSGITLYSGLYINELLSRVLEYETRFSELFFDYLNC 116

Query: 118 LNCHK-IPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVG 176
           +               + EL LL ++G+G++ T C  +G   D              +  
Sbjct: 117 IQALAGTTGSPEPALRRFELALLGHLGYGVNFTHCAGSGERVDDTMTYRYREEKGFFASV 176

Query: 177 LPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENF 232
           +              +E +  D D+L++A + T     + AL+  +       RE F
Sbjct: 177 VIDNNTFTGRHLKALEEREFPDVDTLRAAKRFT-----RMALKPYLGGKPLKSRELF 228


>gi|27364936|ref|NP_760464.1| DNA repair protein RecO [Vibrio vulnificus CMCP6]
 gi|31340326|sp|Q8DC74|RECO_VIBVU RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|27361082|gb|AAO09991.1| DNA repair protein RecO [Vibrio vulnificus CMCP6]
          Length = 243

 Score =  122 bits (305), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 40/231 (17%), Positives = 75/231 (32%), Gaps = 11/231 (4%)

Query: 8   IILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLAQN 65
            +L  R Y E ++IL++ + ++GR     +  +S R   +  LQ    + + W  +    
Sbjct: 11  FVLHRRPYSESSLILDIFSEEFGRITLMSKGARSKRSNLKGALQPFTPLLLKWSGKG--- 67

Query: 66  LGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPS 125
             +   +         L+       L     + R L +      L+      L       
Sbjct: 68  AMKTLRQAEPISLGLPLTGINLYSALYVNELIGRVLMQEVSMPGLFHDYLFALTELAQAD 127

Query: 126 VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKMLV 185
                  + EL LL  +G+G+D   C  TG   D              +         L 
Sbjct: 128 NPEPALRRFELALLAAMGYGVDFLHCAGTGEPIDPQMTYRYREQKGFIASVRRDNLTFLG 187

Query: 186 LPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENFLGK 235
                  E + +  + L++A + T     + AL+  +       RE F+  
Sbjct: 188 NELIAISERRFLTKEQLQAAKRFT-----RIALKPYLGGKPLKSRELFIQM 233


>gi|322514174|ref|ZP_08067239.1| recombination protein O [Actinobacillus ureae ATCC 25976]
 gi|322119960|gb|EFX91962.1| recombination protein O [Actinobacillus ureae ATCC 25976]
          Length = 240

 Score =  122 bits (305), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 37/243 (15%), Positives = 74/243 (30%), Gaps = 13/243 (5%)

Query: 2   YWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWR 59
            W     +L  R Y E +++++  T  +GR     +  +  R   + +LQ    + + W 
Sbjct: 4   NWH-RGFVLHRREYSETSLLVDFFTEDHGRITLLAKGARRPRSSLKAVLQPFTPLLLRWS 62

Query: 60  SRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLN 119
            +              +     + +     G      L + L  +     L+      + 
Sbjct: 63  GKGELKTLTKAEP---ASLTLPMQTLALYSGFYVNEVLAKVLENQTAYPALFQHYLQCVT 119

Query: 120 CHKIPSVI-GKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
                      I    E   LK +G+G++   C  TG                  +  L 
Sbjct: 120 HLATQPDNLEAILRTFEFHTLKALGYGVNFGVCAATGDPVSPSMTYQFKENQGFIASLLQ 179

Query: 179 YAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENFLGKLL 237
                L      +++    D  +L++A + T     + AL+  +       RE F   L 
Sbjct: 180 NNASFLGKDLLAFEQLDFSDKATLQAAKRFT-----RIALKPYLGSQPLKSRELFQSILP 234

Query: 238 ELI 240
             +
Sbjct: 235 NKL 237


>gi|146312693|ref|YP_001177767.1| DNA repair protein RecO [Enterobacter sp. 638]
 gi|145319569|gb|ABP61716.1| DNA replication and repair protein RecO [Enterobacter sp. 638]
          Length = 236

 Score =  122 bits (305), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 48/237 (20%), Positives = 80/237 (33%), Gaps = 14/237 (5%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVN 57
           M  WQ  A +L  R + E +++L+V T + GR     +  +S R   +  LQ    + V 
Sbjct: 2   MEGWQ-RAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKRSNLKGALQPFTPLLVR 60

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
           +  R                 A  LS      GL     + R L       EL+      
Sbjct: 61  FGGRGEVKTLR---SAEAVSLALPLSGITLYSGLYVNELISRVLEHETRFSELFFDYLHC 117

Query: 118 LNCHK-IPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVG 176
           +               + EL LL ++G+G+D   C  +G + D              +  
Sbjct: 118 IQALAGATDSPEPALRRFELALLGHLGYGVDFLHCAGSGDSVDDTMTYRYREEKGFIASI 177

Query: 177 LPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENF 232
           +               E +  D D+L++A + T     + AL+  +       RE F
Sbjct: 178 VIDNTTFTGRHLRALSEREFPDQDTLRAAKRFT-----RIALKPYLGGKPLKSRELF 229


>gi|269958745|ref|YP_003328532.1| DNA repair protein RecO [Anaplasma centrale str. Israel]
 gi|269848574|gb|ACZ49218.1| DNA repair protein RecO [Anaplasma centrale str. Israel]
          Length = 238

 Score =  122 bits (305), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 75/242 (30%), Positives = 125/242 (51%), Gaps = 11/242 (4%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W++  +++G R YG+++++L ++TR  G   G  R  +       LQ G+L+   WR+
Sbjct: 1   MQWREMGVVMGTRPYGDEHLLLSILTRNRGLRRGLTRFTKKR----PLQIGDLIDATWRA 56

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLN 119
           +L  NLG F +EV+ S         + L  L SI  +    LPE EP   LYD    F  
Sbjct: 57  KLPTNLGHFTYEVITSAFYSYFRDRIKLMCLSSITHIMSTALPENEPHPTLYDSFQDFAA 116

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
             +  +     ++++EL++L  +GF LDL+KC V+    +LL++SPK+G A+  +VG  Y
Sbjct: 117 AAEAEAPWYNHYLKLELLVLSQLGFALDLSKCAVSNSKDNLLFISPKTGRALSEAVGCAY 176

Query: 180 AEKMLVLPSFLWK-----EEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLG 234
            +K+L LP  L       E +   AD    + ++  +FL+++ LQ +       R+   G
Sbjct: 177 RDKLLPLPKVLRSISCGVETECCSADEFALSLKILGFFLHRHLLQESH-TFQESRKILTG 235

Query: 235 KL 236
            L
Sbjct: 236 LL 237


>gi|165975964|ref|YP_001651557.1| DNA repair protein RecO [Actinobacillus pleuropneumoniae serovar 3
           str. JL03]
 gi|238687534|sp|B0BUA8|RECO_ACTPJ RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|165876065|gb|ABY69113.1| DNA repair protein [Actinobacillus pleuropneumoniae serovar 3 str.
           JL03]
          Length = 240

 Score =  122 bits (305), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 40/243 (16%), Positives = 79/243 (32%), Gaps = 13/243 (5%)

Query: 2   YWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWR 59
            W     +L  R Y E +++++  T ++GR     +  +      + +LQ    + + W 
Sbjct: 4   NWH-RGFVLHRREYSETSLLVDFFTEEHGRITLLAKGARRPHSPLKAVLQPFTPLLLRWS 62

Query: 60  SRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLN 119
            +              +     + +     G      L R L  +    EL+      + 
Sbjct: 63  GKGDLKTLTKAEP---ASLTLPMQTLALYSGFYVNEVLARVLENQTAYPELFQHYLQCMT 119

Query: 120 CHK-IPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
                P  I  I    E  +LK +G+G++ + C  TG                  +  L 
Sbjct: 120 RLATQPEQIEPILRTFEFQMLKALGYGVNFSICAATGDPVSPSMTYQFRENQGFIASLLQ 179

Query: 179 YAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENFLGKLL 237
                L      +++    D  +L++A + T     + AL+  +       RE F   L 
Sbjct: 180 NNYTFLGKDLLAFEQLDFSDKATLQAAKRFT-----RMALKPYLGSQPLKSRELFQNILP 234

Query: 238 ELI 240
             +
Sbjct: 235 NKL 237


>gi|269101848|ref|ZP_06154545.1| DNA recombination and repair protein RecO [Photobacterium damselae
           subsp. damselae CIP 102761]
 gi|268161746|gb|EEZ40242.1| DNA recombination and repair protein RecO [Photobacterium damselae
           subsp. damselae CIP 102761]
          Length = 236

 Score =  122 bits (305), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 38/236 (16%), Positives = 74/236 (31%), Gaps = 11/236 (4%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNW 58
           M       +L  R Y E ++IL+V +   GR     +  +  R   +  LQ    + + W
Sbjct: 1   MEGLQRCFVLHSRPYSETSLILDVFSEDSGRLSILSKGARRKRSNLKGALQPFTPLFMKW 60

Query: 59  RSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFL 118
             + +                  + S +    +     L R L  + P   L+      L
Sbjct: 61  SGKGS---MPVLTHAEPISIGLPMRSYILYSAMYVNEVLCRVLEAQTPYPVLFLDYLNVL 117

Query: 119 NCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
                         + EL LL+++G+G+D   C  +G+  +              +    
Sbjct: 118 RELAQADNPEPALRRFELALLQHLGYGIDFLHCAGSGLPVEDNMTYNYREQQGFIASIKM 177

Query: 179 YAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENFL 233
                           +    + L++A + T     + AL+  +       RE F+
Sbjct: 178 GQLTFTGEQLKAIDARRFETPEQLRAAKRFT-----RIALKPYLGSKPLKSRELFI 228


>gi|1228148|gb|AAA92442.1| RecO [Salmonella enterica subsp. enterica serovar Typhimurium]
          Length = 241

 Score =  122 bits (305), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 47/237 (19%), Positives = 80/237 (33%), Gaps = 14/237 (5%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVN 57
           M  WQ  A +L  R + E +++L+V T + GR     +  +S R   +  LQ    + + 
Sbjct: 1   MEGWQ-RAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKRSNLKGALQPFTPLLLR 59

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
           +  R                 A  LS      GL     L R L       EL+      
Sbjct: 60  YSGRGEVKTLR---SAEAVSLALPLSGITLYSGLYINELLSRVLEYETRFSELFFDYLNC 116

Query: 118 LNCHK-IPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVG 176
           +               + EL LL ++G+G++ T C  +G   D              +  
Sbjct: 117 IQALAGTTGSPEPALRRFELALLGHLGYGVNFTHCAGSGERVDDTMTYRYREEKGFFASV 176

Query: 177 LPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENF 232
           +              +  +  D D+L++A + T     + AL+  +       RE F
Sbjct: 177 VIDNNTFTGRHLKALEAREFPDVDTLRAAKRFT-----RMALKPYLGGKPLKSRELF 228


>gi|16761491|ref|NP_457108.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Typhi str. CT18]
 gi|16765899|ref|NP_461514.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|29140812|ref|NP_804154.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|56412545|ref|YP_149620.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|62181144|ref|YP_217561.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|161612651|ref|YP_001586616.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Paratyphi B str. SPB7]
 gi|167549389|ref|ZP_02343148.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
 gi|167992710|ref|ZP_02573806.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|168243369|ref|ZP_02668301.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|194446629|ref|YP_002041842.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|194451401|ref|YP_002046641.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|197248854|ref|YP_002147537.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|197265533|ref|ZP_03165607.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|197361480|ref|YP_002141116.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|204929727|ref|ZP_03220801.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
 gi|213425278|ref|ZP_03358028.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Typhi str. E02-1180]
 gi|213583125|ref|ZP_03364951.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-0664]
 gi|213646355|ref|ZP_03376408.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Typhi str. J185]
 gi|224582879|ref|YP_002636677.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|238912697|ref|ZP_04656534.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Tennessee str. CDC07-0191]
 gi|289804219|ref|ZP_06534848.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Typhi str. AG3]
 gi|289825503|ref|ZP_06544710.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-3139]
 gi|61230222|sp|P0A285|RECO_SALTY RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|61230223|sp|P0A286|RECO_SALTI RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|62287383|sp|Q5PIG3|RECO_SALPA RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|75481600|sp|Q57LD2|RECO_SALCH RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|189039772|sp|A9N1T3|RECO_SALPB RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|238689917|sp|B5BAT2|RECO_SALPK RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|238690022|sp|B5F1F9|RECO_SALA4 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|238690622|sp|B4TE13|RECO_SALHS RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|238693589|sp|B4T1F6|RECO_SALNS RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|25300564|pir||AI0828 DNA repair protein RecO [imported] - Salmonella enterica subsp.
           enterica serovar Typhi (strain CT18)
 gi|16421126|gb|AAL21473.1| gap repair gene [Salmonella enterica subsp. enterica serovar
           Typhimurium str. LT2]
 gi|16503791|emb|CAD02781.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Typhi]
 gi|29136437|gb|AAO68003.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|56126802|gb|AAV76308.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|62128777|gb|AAX66480.1| gap repair gene [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. SC-B67]
 gi|161362015|gb|ABX65783.1| hypothetical protein SPAB_00347 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194405292|gb|ACF65514.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|194409705|gb|ACF69924.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|197092956|emb|CAR58386.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|197212557|gb|ACH49954.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|197243788|gb|EDY26408.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|204321446|gb|EDZ06646.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
 gi|205325288|gb|EDZ13127.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
 gi|205329107|gb|EDZ15871.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|205337667|gb|EDZ24431.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|224467406|gb|ACN45236.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|261247774|emb|CBG25602.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Typhimurium str. D23580]
 gi|267994705|gb|ACY89590.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 14028S]
 gi|301159127|emb|CBW18641.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Typhimurium str. SL1344]
 gi|312913568|dbj|BAJ37542.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Typhimurium str. T000240]
 gi|321222716|gb|EFX47787.1| DNA recombination and repair protein RecO [Salmonella enterica
           subsp. enterica serovar Typhimurium str. TN061786]
 gi|322715634|gb|EFZ07205.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. A50]
 gi|323130910|gb|ADX18340.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 4/74]
 gi|332989506|gb|AEF08489.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Typhimurium str. UK-1]
          Length = 242

 Score =  122 bits (305), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 47/237 (19%), Positives = 80/237 (33%), Gaps = 14/237 (5%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVN 57
           M  WQ  A +L  R + E +++L+V T + GR     +  +S R   +  LQ    + + 
Sbjct: 1   MEGWQ-RAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKRSNLKGALQPFTPLLLR 59

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
           +  R                 A  LS      GL     L R L       EL+      
Sbjct: 60  YSGRGEVKTLR---SAEAVSLALPLSGITLYSGLYINELLSRVLEYETRFSELFFDYLNC 116

Query: 118 LNCHK-IPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVG 176
           +               + EL LL ++G+G++ T C  +G   D              +  
Sbjct: 117 IQALAGTTGSPEPALRRFELALLGHLGYGVNFTHCAGSGERVDDTMTYRYREEKGFFASV 176

Query: 177 LPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENF 232
           +              +  +  D D+L++A + T     + AL+  +       RE F
Sbjct: 177 VIDNNTFTGRHLKALEAREFPDVDTLRAAKRFT-----RMALKPYLGGKPLKSRELF 228


>gi|293394831|ref|ZP_06639121.1| recombination protein O [Serratia odorifera DSM 4582]
 gi|291422582|gb|EFE95821.1| recombination protein O [Serratia odorifera DSM 4582]
          Length = 243

 Score =  122 bits (305), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 52/243 (21%), Positives = 83/243 (34%), Gaps = 14/243 (5%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVN 57
           M  WQ  A +L  R Y E +++L++ T  +GR     +  +S R   +  LQ    + V 
Sbjct: 1   MEGWQ-RAFVLHGRPYSETSLMLDLFTEGHGRVRLLAKGARSRRSNLKGCLQPFTPLLVR 59

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
           W  R                    LS  +   GL     L R L +      L+      
Sbjct: 60  WGGRGDIKTLRNAEA---VSLGLPLSGMMLYSGLYVNELLSRVLEQEADYSLLFFDYLQC 116

Query: 118 LNCH-KIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVG 176
           L           +   Q EL LL ++G+G+D   C  +G   D              +  
Sbjct: 117 LQALAAAERSPEQALRQFELALLHHLGYGVDFLHCAGSGEPVDDGMTYRYREEKGFIASL 176

Query: 177 LPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENFLGK 235
           +               E Q  DAD+L++A + T     + AL+  +       RE F   
Sbjct: 177 VVDHYSFTGRELRALAERQFPDADTLRAAKRFT-----RMALKPYLGGKPLKSRELFRQF 231

Query: 236 LLE 238
           + +
Sbjct: 232 VRK 234


>gi|207857986|ref|YP_002244637.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|238690389|sp|B5QTU6|RECO_SALEP RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|206709789|emb|CAR34141.1| DNA repair protein recO [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
          Length = 242

 Score =  121 bits (304), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 48/237 (20%), Positives = 81/237 (34%), Gaps = 14/237 (5%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVN 57
           M  WQ  A +L  R + E +++L+V T + GR     +  +S R   +  LQ    + + 
Sbjct: 1   MEGWQ-RAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKRSNLKGALQPFTPLLLR 59

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
           +  R                 A  LS      GL     L R L       EL+      
Sbjct: 60  YSGRGEVKTLR---SAEAVSLALPLSGITLYSGLYINELLSRVLEYETRFSELFFDYLNC 116

Query: 118 LNCHK-IPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVG 176
           +               + EL LL ++G+G++ T C  +G   D              +  
Sbjct: 117 IQALAGTTGSPEPALRRFELALLGHLGYGVNFTHCAGSGERVDDTMTYRYREEKGFFASV 176

Query: 177 LPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENF 232
           +              +E +  D D+L++A + T     + AL+  +       RE F
Sbjct: 177 VIDNNTFTGRHLKALEEREFPDVDTLRAAKRFT-----RMALKPYLGGKPLKSRELF 228


>gi|168466660|ref|ZP_02700514.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|195630758|gb|EDX49350.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
          Length = 242

 Score =  121 bits (304), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 47/237 (19%), Positives = 80/237 (33%), Gaps = 14/237 (5%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVN 57
           M  WQ  A +L  R + E +++L+V T + GR     +  +S R   +  LQ    + + 
Sbjct: 1   MEGWQ-RAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKRSNLKGALQPFTPLLLR 59

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
           +  R                 A  LS      GL     L R L       EL+      
Sbjct: 60  YSGRGEVKTLR---SAEAVSLALPLSGITLYSGLYINELLSRVLEYETRFSELFFDYLNC 116

Query: 118 LNCHK-IPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVG 176
           +               + EL LL ++G+G++ T C  +G   D              +  
Sbjct: 117 IQALAGTTGSPEPALRRFELALLGHLGYGVNFTHCAGSGKRVDDTMTYRYREEKGFFASV 176

Query: 177 LPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENF 232
           +              +  +  D D+L++A + T     + AL+  +       RE F
Sbjct: 177 VIDNNTFTGRHLKALEAREFPDVDTLRAAKRFT-----RMALKPYLGGKPLKSRELF 228


>gi|323941172|gb|EGB37357.1| recombination protein O [Escherichia coli E482]
          Length = 242

 Score =  121 bits (304), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 49/237 (20%), Positives = 82/237 (34%), Gaps = 14/237 (5%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVN 57
           M  WQ  A +L  R + E +++L+V T + GR     +  +S R   +  LQ    + + 
Sbjct: 1   MEGWQ-RAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKRSTLKGALQPFTPLLLR 59

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
           +  R                 A  LS      GL     L R L       EL+      
Sbjct: 60  FGGRGEVKTLR---SAEAVSLALPLSGITLYSGLYINELLSRVLEYETRFSELFFDYLHC 116

Query: 118 LNCHK-IPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVG 176
           +     +         + EL LL ++G+GL+ T C  +G   D              +  
Sbjct: 117 IQSLAGVTGTPEPALRRFELALLGHLGYGLNFTHCAGSGEPVDDTMTYRYREEKGFIASV 176

Query: 177 LPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENF 232
           +   +             +  DAD+L++A + T     + AL+  +       RE F
Sbjct: 177 VIDNKTFTGRQLKALNAREFPDADTLRAAKRFT-----RMALKPYLGGKPLKSRELF 228


>gi|168232157|ref|ZP_02657215.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
 gi|194469835|ref|ZP_03075819.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|194456199|gb|EDX45038.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|205333544|gb|EDZ20308.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
          Length = 242

 Score =  121 bits (304), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 47/237 (19%), Positives = 81/237 (34%), Gaps = 14/237 (5%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVN 57
           M  WQ  A +L  R + E +++L+V T + GR     +  +S R   +  LQ    + + 
Sbjct: 1   MEGWQ-RAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKRSNLKGALQPFTPLLLR 59

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
           +  R                 A  LS      GL     L R L       EL+      
Sbjct: 60  YSGRGEVKTLR---SAEAVSLALPLSGITLYSGLYINELLSRVLEYETRFSELFFDYLNC 116

Query: 118 LNCHK-IPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVG 176
           +               + EL LL ++G+G++ T+C  +G   D              +  
Sbjct: 117 IQALAGTTGSPEPALRRFELALLGHLGYGVNFTRCAGSGERVDDTMTYRYREEKGFFASV 176

Query: 177 LPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENF 232
           +              +  +  D D+L++A + T     + AL+  +       RE F
Sbjct: 177 VIDNNTFTGRHLKALEAREFPDVDTLRAAKRFT-----RMALKPYLGGKPLKSRELF 228


>gi|157371902|ref|YP_001479891.1| DNA repair protein RecO [Serratia proteamaculans 568]
 gi|166918732|sp|A8GI23|RECO_SERP5 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|157323666|gb|ABV42763.1| DNA repair protein RecO [Serratia proteamaculans 568]
          Length = 243

 Score =  121 bits (304), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 48/238 (20%), Positives = 80/238 (33%), Gaps = 12/238 (5%)

Query: 5   DDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRL 62
           + A +L  R Y E +++L++ T  +GR     +  +S R   +  LQ    + V W  R 
Sbjct: 5   ERAFVLHGRPYSETSLMLDMFTEGHGRVRLLAKGARSRRSNLKGCLQPFTPLLVRWGGRG 64

Query: 63  AQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCH- 121
                              LS  +   GL     L R L +      L+      L    
Sbjct: 65  EVKTLR---SAEAVSLGLPLSGMMLYSGLYVNELLSRVLEQEANYSVLFFDYLQCLQALA 121

Query: 122 KIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAE 181
                  +   Q EL LL ++G+GLD   C  +G+  D              +  +    
Sbjct: 122 AEDVSPEQALRQFELALLNHLGYGLDFLHCAGSGLPVDDGMTYRYREEKGFIASLVVDHY 181

Query: 182 KMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENFLGKLLE 238
                      E Q  D  +L++A + T     + AL+  +       RE F   + +
Sbjct: 182 SFTGRELRALAERQFPDVQTLRAAKRFT-----RMALKPYLGGKPLKSRELFRQFVRK 234


>gi|329890071|ref|ZP_08268414.1| recombinational DNA repair protein RecF pathway [Brevundimonas
           diminuta ATCC 11568]
 gi|328845372|gb|EGF94936.1| recombinational DNA repair protein RecF pathway [Brevundimonas
           diminuta ATCC 11568]
          Length = 200

 Score =  121 bits (304), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 70/197 (35%), Positives = 101/197 (51%), Gaps = 1/197 (0%)

Query: 44  MQPILQAGNLVRVNWRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LP 102
           M+P LQ G  V  + RSR +  LG  R E +    A L    L L GL +   + +  LP
Sbjct: 1   MRPFLQPGARVVADLRSRTSDQLGSARLEPVGEGPAALFDDPLALTGLSAAAAVAQGALP 60

Query: 103 EREPCLELYDMLNIFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLW 162
           EREP    +      +    +P V   IFV+ E  LL+++GFGLDL++C  TG   DL+W
Sbjct: 61  EREPHPGAFYAFEALMGAFAVPEVWPAIFVRFEAGLLEDLGFGLDLSRCASTGSMDDLVW 120

Query: 163 VSPKSGGAVCRSVGLPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNI 222
           VSP++G AV R  G PYA+K+L LP F+   +  +    +K+  +LT +FL ++      
Sbjct: 121 VSPRTGRAVSREAGAPYADKLLALPPFMLGAQAGLGEGDVKAGLELTGHFLEQFVFHALN 180

Query: 223 IHCHLLRENFLGKLLEL 239
                 R   + KL E 
Sbjct: 181 RPLPPARVWMIDKLGEA 197


>gi|283786181|ref|YP_003366046.1| DNA repair protein [Citrobacter rodentium ICC168]
 gi|282949635|emb|CBG89254.1| DNA repair protein [Citrobacter rodentium ICC168]
          Length = 236

 Score =  121 bits (304), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 48/234 (20%), Positives = 79/234 (33%), Gaps = 13/234 (5%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRS 60
           WQ  A +L  R + E +++L+V T + GR     +  +S R   +  LQ    + V +  
Sbjct: 4   WQ-RAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKRSNLKGALQPFTPLLVRFGG 62

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           R                 A  LS      GL     L R L        L+      +  
Sbjct: 63  RGEVKTLRNAEA---VSLALPLSGITLYSGLYVNELLARVLEHETRFSALFFDYLHCIQA 119

Query: 121 HK-IPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
              +      +  + EL LL ++G+G+D   C  +G   D              +  +  
Sbjct: 120 LAGVSGTPEPVLRRFELALLGHLGYGVDFLHCAGSGEPVDDTMTYRYREEKGFIASVVID 179

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENF 232
                        E    DAD+L++A + T     + AL+  +       RE F
Sbjct: 180 NSTFTGRELRALAERDFPDADTLRAAKRFT-----RIALKPYLGGKPLKSRELF 228


>gi|168261370|ref|ZP_02683343.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
 gi|200388266|ref|ZP_03214878.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|199605364|gb|EDZ03909.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|205349603|gb|EDZ36234.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
          Length = 242

 Score =  121 bits (303), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 47/237 (19%), Positives = 80/237 (33%), Gaps = 14/237 (5%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVN 57
           M  WQ  A +L  R + E +++L+V T + GR     +  +S R   +  LQ    + + 
Sbjct: 1   MEGWQ-RAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKRSNLKGALQPFTPLLLR 59

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
           +  R                 A  LS      GL     L R L       EL+      
Sbjct: 60  YSGRGEVKTLR---SAEAVSLALPLSGITLYSGLYINELLSRVLEYETRFSELFFDYLNC 116

Query: 118 LNCHK-IPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVG 176
           +               + EL LL ++G+G++ T C  +G   D              +  
Sbjct: 117 IQALAGTTGSPEPALRRFELALLGHLGYGVNFTHCAGSGERVDDTMTYRYREEKGFFASV 176

Query: 177 LPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENF 232
           +              +  +  D D+L++A + T     + AL+  +       RE F
Sbjct: 177 VIDNNTFTGRHLKALEAREFPDVDTLRAAKRFT-----RMALKPYLGGKPLKSRELF 228


>gi|33152640|ref|NP_873993.1| DNA repair protein RecO [Haemophilus ducreyi 35000HP]
 gi|42559454|sp|Q7VL77|RECO_HAEDU RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|33148864|gb|AAP96382.1| DNA repair protein RecO [Haemophilus ducreyi 35000HP]
          Length = 240

 Score =  121 bits (303), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 44/240 (18%), Positives = 83/240 (34%), Gaps = 15/240 (6%)

Query: 2   YWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWR 59
            WQ    +L  R Y E +++++  T Q+GR     +  +  R   + +LQ    + + W 
Sbjct: 4   QWQ-RGFVLHRREYRETSLLVDFFTEQHGRITLLAKGAKRVRSPLKAVLQPFTPLLLRWS 62

Query: 60  SRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLN 119
            +    +         +     +  +    GL     L R L  +     L+      + 
Sbjct: 63  GKGDLKVLTKAEP---AALTLPMHHTALYSGLYVNEILIRVLENQTAYTALFQHYLQCIT 119

Query: 120 CHKIPSVIGKIFVQ-IELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
                    ++ ++  E  LLK +G+G++ + C  TG   D       S         L 
Sbjct: 120 QLATQPEKLQVTLRTFEFHLLKALGYGVNFSICAATGQPIDAGMYYQFSE-NKGFFASLL 178

Query: 179 YAEKMLVLPSFLW-KEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENFLGKL 236
                      L  ++    D D+L++A + T     + AL+  +       RE F   L
Sbjct: 179 RNHYTFCGKDLLAFEKGDFSDTDTLQAAKRFT-----RIALRPYLGSQPLKSRELFQAIL 233


>gi|206576021|ref|YP_002237092.1| DNA repair protein RecO [Klebsiella pneumoniae 342]
 gi|288934054|ref|YP_003438113.1| DNA repair protein RecO [Klebsiella variicola At-22]
 gi|290508250|ref|ZP_06547621.1| DNA repair protein RecO [Klebsiella sp. 1_1_55]
 gi|238058670|sp|B5XNH2|RECO_KLEP3 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|206565079|gb|ACI06855.1| DNA repair protein RecO [Klebsiella pneumoniae 342]
 gi|288888783|gb|ADC57101.1| DNA repair protein RecO [Klebsiella variicola At-22]
 gi|289777644|gb|EFD85641.1| DNA repair protein RecO [Klebsiella sp. 1_1_55]
          Length = 245

 Score =  121 bits (303), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 46/234 (19%), Positives = 77/234 (32%), Gaps = 13/234 (5%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRS 60
           WQ  A +L  R + E +++L+V T + GR     +  +S R   +  LQ    + V +  
Sbjct: 4   WQ-RAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKRSNLKGALQPFTPLLVRFGG 62

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           R                 A  LS      GL     + R L       EL+      +  
Sbjct: 63  RGEVKTLR---SAEAVSLALPLSGITLYSGLYVNELISRVLEHETRFSELFFDYLHCIQA 119

Query: 121 HK-IPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                        + EL LL ++G+G+D   C  +G   D              +  +  
Sbjct: 120 LAGTSGSPEPALRRFELALLGHLGYGVDFLHCAGSGEPVDDTMTYRYREEKGFIASLVID 179

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENF 232
                          +  D D+L++A + T     + AL+  +       RE F
Sbjct: 180 NNTFTGHHLKALASREFPDVDTLRAAKRFT-----RIALKPYLGGKPLKSRELF 228


>gi|291085017|ref|ZP_06351784.2| DNA repair protein RecO [Citrobacter youngae ATCC 29220]
 gi|291071662|gb|EFE09771.1| DNA repair protein RecO [Citrobacter youngae ATCC 29220]
          Length = 237

 Score =  121 bits (303), Expect = 9e-26,   Method: Composition-based stats.
 Identities = 46/237 (19%), Positives = 79/237 (33%), Gaps = 14/237 (5%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVN 57
           M  WQ  A +L  R + E +++L+V T + GR     +  +S R   +  LQ    + + 
Sbjct: 2   MEGWQ-RAFVLHSRPWSETSLVLDVFTEESGRVRLVAKGARSKRSNLKGALQPFTPLLLR 60

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
           +  R                 A  LS      GL     + R L       EL+      
Sbjct: 61  FGGRGEVKTLR---SAEAVSLALPLSGITLYSGLYINELISRVLEYETRFSELFFDYLNC 117

Query: 118 LNCHKIPS-VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVG 176
           +      +        + EL LL ++G+G+D   C  +G   D              +  
Sbjct: 118 IQALAGATGSPEPALRRFELALLGHLGYGVDFLHCAGSGDEVDDTMTYRYREEKGFIASV 177

Query: 177 LPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENF 232
           +                 +  D D+L++A + T     + AL+  +       RE F
Sbjct: 178 VIDNNTFTGHQLKALANREFPDVDTLRAAKRFT-----RMALKPYLGGKPLKSRELF 229


>gi|152971421|ref|YP_001336530.1| DNA repair protein RecO [Klebsiella pneumoniae subsp. pneumoniae
           MGH 78578]
 gi|238896016|ref|YP_002920752.1| DNA repair protein RecO [Klebsiella pneumoniae NTUH-K2044]
 gi|166221895|sp|A6TCH9|RECO_KLEP7 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|150956270|gb|ABR78300.1| DNA repair protein RecO [Klebsiella pneumoniae subsp. pneumoniae
           MGH 78578]
 gi|238548334|dbj|BAH64685.1| DNA repair protein [Klebsiella pneumoniae subsp. pneumoniae
           NTUH-K2044]
          Length = 245

 Score =  121 bits (303), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 46/234 (19%), Positives = 77/234 (32%), Gaps = 13/234 (5%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRS 60
           WQ  A +L  R + E +++L+V T + GR     +  +S R   +  LQ    + V +  
Sbjct: 4   WQ-RAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKRSNLKGALQPFTPLLVRFGG 62

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           R                 A  LS      GL     + R L       EL+      +  
Sbjct: 63  RGEVKTLR---SAEAVSLALPLSGITLYSGLYVNELISRVLEHETRFSELFFDYLHCIQA 119

Query: 121 HK-IPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                        + EL LL ++G+G+D   C  +G   D              +  +  
Sbjct: 120 LAGASGSPEPALRRFELALLGHLGYGVDFLHCAGSGEPVDDTMTYRYREEKGFIASLVID 179

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENF 232
                          +  D D+L++A + T     + AL+  +       RE F
Sbjct: 180 NNTFTGHHLKALASREFPDVDTLRAAKRFT-----RIALKPYLGGKPLKSRELF 228


>gi|148260213|ref|YP_001234340.1| DNA repair protein RecO [Acidiphilium cryptum JF-5]
 gi|254790500|sp|A5FXT9|RECO_ACICJ RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|146401894|gb|ABQ30421.1| DNA repair protein RecO [Acidiphilium cryptum JF-5]
          Length = 251

 Score =  121 bits (302), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 74/244 (30%), Positives = 113/244 (46%), Gaps = 4/244 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W + AI+L V ++GE ++   V+   +G   G  R G   R  PI Q GNL+   W +
Sbjct: 1   MEWSEPAIVLSVAAFGESDLRTIVLAETHGAWHGLARGGAGRRGAPIWQEGNLINARWVA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGL-QSIVPLFRFLPEREPCLELYDMLNIFLN 119
           RL + LG    E++    A  ++  L L  L  +       LPERE     +  L   L 
Sbjct: 61  RLPEQLGSISGELVHPAAAIAMADPLALAVLRAACAVAAGALPEREAHRGAFIRLARLLG 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
              I        V+ EL LL+ +G+GLDL+ C ++G  +DL +VSP++G AV R     +
Sbjct: 121 GIGIAGTALPALVRFELELLRELGYGLDLSSCALSGAAEDLAFVSPRTGRAVARGAAGDW 180

Query: 180 AEKMLVLPSFLWKEEQTIDADSL---KSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKL 236
             ++L LP+FL  E+   D   L   +    LT +FL + A           R +   +L
Sbjct: 181 VPRLLKLPAFLLDEDAADDKADLAACRDGLALTGHFLARDAFGARHAPLPTARLDLYDRL 240

Query: 237 LELI 240
              +
Sbjct: 241 TRRL 244


>gi|332344440|gb|AEE57774.1| DNA repair protein RecO [Escherichia coli UMNK88]
          Length = 242

 Score =  121 bits (302), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 48/237 (20%), Positives = 82/237 (34%), Gaps = 14/237 (5%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVN 57
           M  WQ  A +L  R + E +++L+V T + GR     +  +S R   +  LQ    + + 
Sbjct: 1   MEGWQ-RAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKRSTLKGALQPFTPLLLR 59

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
           +  R                 A  LS      GL     L R L       EL+      
Sbjct: 60  FGGRGEVKTLR---SAEAVSLALPLSGITLYSGLYINELLSRVLEYETRFSELFFDYLHC 116

Query: 118 LNCHKIPS-VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVG 176
           +      +        + EL LL ++G+G++ T C  +G   D              +  
Sbjct: 117 IESLAGATGTPEPALRRFELALLGHLGYGVNFTHCAGSGEPVDDTMTYRYREEKGFIASV 176

Query: 177 LPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENF 232
           +   +             +  DAD+L++A + T     + AL+  +       RE F
Sbjct: 177 VIDNKTFTGRQLKALNAREFPDADTLRAAKRFT-----RMALKPYLGGKPLKSRELF 228


>gi|15803091|ref|NP_289122.1| DNA repair protein RecO [Escherichia coli O157:H7 EDL933]
 gi|15832685|ref|NP_311458.1| DNA repair protein RecO [Escherichia coli O157:H7 str. Sakai]
 gi|16130490|ref|NP_417060.1| gap repair protein [Escherichia coli str. K-12 substr. MG1655]
 gi|26248930|ref|NP_754970.1| DNA repair protein RecO [Escherichia coli CFT073]
 gi|82777991|ref|YP_404340.1| DNA repair protein RecO [Shigella dysenteriae Sd197]
 gi|89109371|ref|AP_003151.1| gap repair protein [Escherichia coli str. K-12 substr. W3110]
 gi|91211891|ref|YP_541877.1| DNA repair protein RecO [Escherichia coli UTI89]
 gi|110642727|ref|YP_670457.1| DNA repair protein RecO [Escherichia coli 536]
 gi|117624786|ref|YP_853699.1| DNA repair protein RecO [Escherichia coli APEC O1]
 gi|168748365|ref|ZP_02773387.1| DNA repair protein RecO [Escherichia coli O157:H7 str. EC4113]
 gi|168757774|ref|ZP_02782781.1| DNA repair protein RecO [Escherichia coli O157:H7 str. EC4401]
 gi|168761186|ref|ZP_02786193.1| DNA repair protein RecO [Escherichia coli O157:H7 str. EC4501]
 gi|168768669|ref|ZP_02793676.1| DNA repair protein RecO [Escherichia coli O157:H7 str. EC4486]
 gi|168773509|ref|ZP_02798516.1| DNA repair protein RecO [Escherichia coli O157:H7 str. EC4196]
 gi|168778542|ref|ZP_02803549.1| DNA repair protein RecO [Escherichia coli O157:H7 str. EC4076]
 gi|168787925|ref|ZP_02812932.1| DNA repair protein RecO [Escherichia coli O157:H7 str. EC869]
 gi|168798947|ref|ZP_02823954.1| DNA repair protein RecO [Escherichia coli O157:H7 str. EC508]
 gi|170019152|ref|YP_001724106.1| DNA repair protein RecO [Escherichia coli ATCC 8739]
 gi|170082174|ref|YP_001731494.1| gap repair protein [Escherichia coli str. K-12 substr. DH10B]
 gi|188492218|ref|ZP_02999488.1| DNA repair protein RecO [Escherichia coli 53638]
 gi|191174023|ref|ZP_03035540.1| DNA repair protein RecO [Escherichia coli F11]
 gi|194437625|ref|ZP_03069721.1| DNA repair protein RecO [Escherichia coli 101-1]
 gi|195936712|ref|ZP_03082094.1| DNA repair protein RecO [Escherichia coli O157:H7 str. EC4024]
 gi|208808195|ref|ZP_03250532.1| DNA repair protein RecO [Escherichia coli O157:H7 str. EC4206]
 gi|208813327|ref|ZP_03254656.1| DNA repair protein RecO [Escherichia coli O157:H7 str. EC4045]
 gi|208821700|ref|ZP_03262020.1| DNA repair protein RecO [Escherichia coli O157:H7 str. EC4042]
 gi|209396972|ref|YP_002272040.1| DNA repair protein RecO [Escherichia coli O157:H7 str. EC4115]
 gi|217327334|ref|ZP_03443417.1| DNA repair protein RecO [Escherichia coli O157:H7 str. TW14588]
 gi|218559486|ref|YP_002392399.1| DNA repair protein RecO [Escherichia coli S88]
 gi|218690681|ref|YP_002398893.1| DNA repair protein RecO [Escherichia coli ED1a]
 gi|227887601|ref|ZP_04005406.1| recombination protein O [Escherichia coli 83972]
 gi|237705075|ref|ZP_04535556.1| gap repair protein RecO [Escherichia sp. 3_2_53FAA]
 gi|238901730|ref|YP_002927526.1| gap repair protein [Escherichia coli BW2952]
 gi|253772536|ref|YP_003035367.1| DNA repair protein RecO [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|254162540|ref|YP_003045648.1| DNA repair protein RecO [Escherichia coli B str. REL606]
 gi|254794515|ref|YP_003079352.1| DNA repair protein RecO [Escherichia coli O157:H7 str. TW14359]
 gi|256021749|ref|ZP_05435614.1| DNA repair protein RecO [Escherichia sp. 4_1_40B]
 gi|261222999|ref|ZP_05937280.1| gap repair protein [Escherichia coli O157:H7 str. FRIK2000]
 gi|261259450|ref|ZP_05951983.1| gap repair protein [Escherichia coli O157:H7 str. FRIK966]
 gi|291283840|ref|YP_003500658.1| DNA repair protein recO [Escherichia coli O55:H7 str. CB9615]
 gi|293415834|ref|ZP_06658477.1| DNA repair protein RecO [Escherichia coli B185]
 gi|300904251|ref|ZP_07122110.1| DNA repair protein RecO [Escherichia coli MS 84-1]
 gi|300927691|ref|ZP_07143259.1| DNA repair protein RecO [Escherichia coli MS 187-1]
 gi|300951717|ref|ZP_07165536.1| DNA repair protein RecO [Escherichia coli MS 116-1]
 gi|300958794|ref|ZP_07170906.1| DNA repair protein RecO [Escherichia coli MS 175-1]
 gi|300974163|ref|ZP_07172481.1| DNA repair protein RecO [Escherichia coli MS 200-1]
 gi|300982269|ref|ZP_07175980.1| DNA repair protein RecO [Escherichia coli MS 45-1]
 gi|301022061|ref|ZP_07185988.1| DNA repair protein RecO [Escherichia coli MS 196-1]
 gi|301047204|ref|ZP_07194296.1| DNA repair protein RecO [Escherichia coli MS 185-1]
 gi|301302932|ref|ZP_07209060.1| DNA repair protein RecO [Escherichia coli MS 124-1]
 gi|301648329|ref|ZP_07248069.1| DNA repair protein RecO [Escherichia coli MS 146-1]
 gi|306814371|ref|ZP_07448533.1| DNA repair protein RecO [Escherichia coli NC101]
 gi|307139201|ref|ZP_07498557.1| DNA repair protein RecO [Escherichia coli H736]
 gi|309784620|ref|ZP_07679255.1| DNA repair protein RecO [Shigella dysenteriae 1617]
 gi|312973189|ref|ZP_07787361.1| DNA repair protein RecO [Escherichia coli 1827-70]
 gi|331643189|ref|ZP_08344324.1| DNA repair protein RecO [Escherichia coli H736]
 gi|331648311|ref|ZP_08349400.1| DNA repair protein RecO [Escherichia coli M605]
 gi|331658709|ref|ZP_08359653.1| DNA repair protein RecO [Escherichia coli TA206]
 gi|331664133|ref|ZP_08365043.1| DNA repair protein RecO [Escherichia coli TA143]
 gi|67471982|sp|P0A7H3|RECO_ECOLI RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|67471983|sp|P0A7H4|RECO_ECOL6 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|67471984|sp|P0A7H5|RECO_ECO57 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|90103525|sp|Q32CV6|RECO_SHIDS RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|119361457|sp|Q0TES3|RECO_ECOL5 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|119361458|sp|Q1R8G8|RECO_ECOUT RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|166221890|sp|A1AE95|RECO_ECOK1 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|189039656|sp|B1IVR2|RECO_ECOLC RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|226737862|sp|B7MIQ0|RECO_ECO45 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|229485533|sp|B1XB39|RECO_ECODH RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|238058644|sp|B5Z139|RECO_ECO5E RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|332138214|pdb|3Q8D|A Chain A, E. Coli Reco Complex With Ssb C-Temrinus
 gi|332138215|pdb|3Q8D|B Chain B, E. Coli Reco Complex With Ssb C-Temrinus
 gi|12516982|gb|AAG57680.1|AE005487_4 protein interacts with RecR and possibly RecF proteins [Escherichia
           coli O157:H7 str. EDL933]
 gi|26109336|gb|AAN81538.1|AE016764_220 DNA repair protein recO [Escherichia coli CFT073]
 gi|147552|gb|AAA24515.1| recombination protein [Escherichia coli]
 gi|499369|gb|AAA21842.1| recO [Escherichia coli]
 gi|987640|dbj|BAA10912.1| recO protein [Escherichia coli K-12]
 gi|2367140|gb|AAC75618.1| gap repair protein [Escherichia coli str. K-12 substr. MG1655]
 gi|13362902|dbj|BAB36854.1| RecO protein [Escherichia coli O157:H7 str. Sakai]
 gi|81242139|gb|ABB62849.1| RecO [Shigella dysenteriae Sd197]
 gi|85675456|dbj|BAE76741.1| gap repair protein [Escherichia coli str. K12 substr. W3110]
 gi|91073465|gb|ABE08346.1| protein interacts with RecR and possibly RecF proteins [Escherichia
           coli UTI89]
 gi|110344319|gb|ABG70556.1| DNA repair protein RecO [Escherichia coli 536]
 gi|115513910|gb|ABJ01985.1| gap repair protein RecO [Escherichia coli APEC O1]
 gi|169754080|gb|ACA76779.1| DNA repair protein RecO [Escherichia coli ATCC 8739]
 gi|169890009|gb|ACB03716.1| gap repair protein [Escherichia coli str. K-12 substr. DH10B]
 gi|187770738|gb|EDU34582.1| DNA repair protein RecO [Escherichia coli O157:H7 str. EC4196]
 gi|188017100|gb|EDU55222.1| DNA repair protein RecO [Escherichia coli O157:H7 str. EC4113]
 gi|188487417|gb|EDU62520.1| DNA repair protein RecO [Escherichia coli 53638]
 gi|189003617|gb|EDU72603.1| DNA repair protein RecO [Escherichia coli O157:H7 str. EC4076]
 gi|189355304|gb|EDU73723.1| DNA repair protein RecO [Escherichia coli O157:H7 str. EC4401]
 gi|189362323|gb|EDU80742.1| DNA repair protein RecO [Escherichia coli O157:H7 str. EC4486]
 gi|189368475|gb|EDU86891.1| DNA repair protein RecO [Escherichia coli O157:H7 str. EC4501]
 gi|189372382|gb|EDU90798.1| DNA repair protein RecO [Escherichia coli O157:H7 str. EC869]
 gi|189378575|gb|EDU96991.1| DNA repair protein RecO [Escherichia coli O157:H7 str. EC508]
 gi|190905714|gb|EDV65336.1| DNA repair protein RecO [Escherichia coli F11]
 gi|194423431|gb|EDX39422.1| DNA repair protein RecO [Escherichia coli 101-1]
 gi|208727996|gb|EDZ77597.1| DNA repair protein RecO [Escherichia coli O157:H7 str. EC4206]
 gi|208734604|gb|EDZ83291.1| DNA repair protein RecO [Escherichia coli O157:H7 str. EC4045]
 gi|208741823|gb|EDZ89505.1| DNA repair protein RecO [Escherichia coli O157:H7 str. EC4042]
 gi|209158372|gb|ACI35805.1| DNA repair protein RecO [Escherichia coli O157:H7 str. EC4115]
 gi|209762898|gb|ACI79761.1| RecO protein [Escherichia coli]
 gi|209762900|gb|ACI79762.1| RecO protein [Escherichia coli]
 gi|209762902|gb|ACI79763.1| RecO protein [Escherichia coli]
 gi|209762904|gb|ACI79764.1| RecO protein [Escherichia coli]
 gi|209762906|gb|ACI79765.1| RecO protein [Escherichia coli]
 gi|217319701|gb|EEC28126.1| DNA repair protein RecO [Escherichia coli O157:H7 str. TW14588]
 gi|218366255|emb|CAR04002.1| gap repair protein [Escherichia coli S88]
 gi|218428245|emb|CAR09162.2| gap repair protein [Escherichia coli ED1a]
 gi|222034270|emb|CAP77011.1| DNA repair protein recO [Escherichia coli LF82]
 gi|226901441|gb|EEH87700.1| gap repair protein RecO [Escherichia sp. 3_2_53FAA]
 gi|227835951|gb|EEJ46417.1| recombination protein O [Escherichia coli 83972]
 gi|238861284|gb|ACR63282.1| gap repair protein [Escherichia coli BW2952]
 gi|242378166|emb|CAQ32940.1| protein interacts with RecR and possibly RecF proteins, subunit of
           RecFOR complex [Escherichia coli BL21(DE3)]
 gi|253323580|gb|ACT28182.1| DNA repair protein RecO [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|253974441|gb|ACT40112.1| DNA repair protein RecO [Escherichia coli B str. REL606]
 gi|253978608|gb|ACT44278.1| DNA repair protein RecO [Escherichia coli BL21(DE3)]
 gi|254593915|gb|ACT73276.1| gap repair protein [Escherichia coli O157:H7 str. TW14359]
 gi|260448355|gb|ACX38777.1| DNA repair protein RecO [Escherichia coli DH1]
 gi|281179614|dbj|BAI55944.1| DNA repair protein RecO [Escherichia coli SE15]
 gi|290763713|gb|ADD57674.1| DNA repair protein recO [Escherichia coli O55:H7 str. CB9615]
 gi|291433482|gb|EFF06461.1| DNA repair protein RecO [Escherichia coli B185]
 gi|294489626|gb|ADE88382.1| DNA repair protein RecO [Escherichia coli IHE3034]
 gi|299881366|gb|EFI89577.1| DNA repair protein RecO [Escherichia coli MS 196-1]
 gi|300300881|gb|EFJ57266.1| DNA repair protein RecO [Escherichia coli MS 185-1]
 gi|300308902|gb|EFJ63422.1| DNA repair protein RecO [Escherichia coli MS 200-1]
 gi|300314542|gb|EFJ64326.1| DNA repair protein RecO [Escherichia coli MS 175-1]
 gi|300403784|gb|EFJ87322.1| DNA repair protein RecO [Escherichia coli MS 84-1]
 gi|300408823|gb|EFJ92361.1| DNA repair protein RecO [Escherichia coli MS 45-1]
 gi|300449001|gb|EFK12621.1| DNA repair protein RecO [Escherichia coli MS 116-1]
 gi|300464244|gb|EFK27737.1| DNA repair protein RecO [Escherichia coli MS 187-1]
 gi|300841867|gb|EFK69627.1| DNA repair protein RecO [Escherichia coli MS 124-1]
 gi|301073605|gb|EFK88411.1| DNA repair protein RecO [Escherichia coli MS 146-1]
 gi|305851765|gb|EFM52217.1| DNA repair protein RecO [Escherichia coli NC101]
 gi|307554584|gb|ADN47359.1| DNA repair protein RecO [Escherichia coli ABU 83972]
 gi|307625887|gb|ADN70191.1| DNA repair protein RecO [Escherichia coli UM146]
 gi|308927517|gb|EFP72989.1| DNA repair protein RecO [Shigella dysenteriae 1617]
 gi|310331784|gb|EFP99019.1| DNA repair protein RecO [Escherichia coli 1827-70]
 gi|315137189|dbj|BAJ44348.1| DNA repair protein recO [Escherichia coli DH1]
 gi|315256593|gb|EFU36561.1| DNA repair protein RecO [Escherichia coli MS 85-1]
 gi|315288042|gb|EFU47444.1| DNA repair protein RecO [Escherichia coli MS 110-3]
 gi|315292459|gb|EFU51811.1| DNA repair protein RecO [Escherichia coli MS 153-1]
 gi|315300508|gb|EFU59737.1| DNA repair protein RecO [Escherichia coli MS 16-3]
 gi|320188906|gb|EFW63565.1| DNA recombination and repair protein RecO [Escherichia coli O157:H7
           str. EC1212]
 gi|320640814|gb|EFX10308.1| DNA repair protein RecO [Escherichia coli O157:H7 str. G5101]
 gi|320646160|gb|EFX15100.1| DNA repair protein RecO [Escherichia coli O157:H- str. 493-89]
 gi|320651455|gb|EFX19851.1| DNA repair protein RecO [Escherichia coli O157:H- str. H 2687]
 gi|320657056|gb|EFX24875.1| DNA repair protein RecO [Escherichia coli O55:H7 str. 3256-97 TW
           07815]
 gi|320662721|gb|EFX30060.1| DNA repair protein RecO [Escherichia coli O55:H7 str. USDA 5905]
 gi|320667541|gb|EFX34461.1| DNA repair protein RecO [Escherichia coli O157:H7 str. LSU-61]
 gi|323188320|gb|EFZ73612.1| DNA repair protein RecO [Escherichia coli RN587/1]
 gi|323949219|gb|EGB45110.1| recombination protein O [Escherichia coli H252]
 gi|323955801|gb|EGB51559.1| recombination protein O [Escherichia coli H263]
 gi|323961180|gb|EGB56793.1| recombination protein O [Escherichia coli H489]
 gi|323971109|gb|EGB66356.1| recombination protein O [Escherichia coli TA007]
 gi|324008474|gb|EGB77693.1| DNA repair protein RecO [Escherichia coli MS 57-2]
 gi|324014390|gb|EGB83609.1| DNA repair protein RecO [Escherichia coli MS 60-1]
 gi|326340371|gb|EGD64175.1| DNA recombination and repair protein RecO [Escherichia coli O157:H7
           str. 1125]
 gi|326345054|gb|EGD68798.1| DNA recombination and repair protein RecO [Escherichia coli O157:H7
           str. 1044]
 gi|330912334|gb|EGH40844.1| DNA recombination and repair protein RecO [Escherichia coli AA86]
 gi|331039987|gb|EGI12207.1| DNA repair protein RecO [Escherichia coli H736]
 gi|331042860|gb|EGI15001.1| DNA repair protein RecO [Escherichia coli M605]
 gi|331054374|gb|EGI26401.1| DNA repair protein RecO [Escherichia coli TA206]
 gi|331059932|gb|EGI31909.1| DNA repair protein RecO [Escherichia coli TA143]
          Length = 242

 Score =  121 bits (302), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 48/237 (20%), Positives = 82/237 (34%), Gaps = 14/237 (5%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVN 57
           M  WQ  A +L  R + E +++L+V T + GR     +  +S R   +  LQ    + + 
Sbjct: 1   MEGWQ-RAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKRSTLKGALQPFTPLLLR 59

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
           +  R                 A  LS      GL     L R L       EL+      
Sbjct: 60  FGGRGEVKTLR---SAEAVSLALPLSGITLYSGLYINELLSRVLEYETRFSELFFDYLHC 116

Query: 118 LNCHK-IPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVG 176
           +     +         + EL LL ++G+G++ T C  +G   D              +  
Sbjct: 117 IQSLAGVTGTPEPALRRFELALLGHLGYGVNFTHCAGSGEPVDDTMTYRYREEKGFIASV 176

Query: 177 LPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENF 232
           +   +             +  DAD+L++A + T     + AL+  +       RE F
Sbjct: 177 VIDNKTFTGRQLKALNAREFPDADTLRAAKRFT-----RMALKPYLGGKPLKSRELF 228


>gi|215487909|ref|YP_002330340.1| DNA repair protein RecO [Escherichia coli O127:H6 str. E2348/69]
 gi|215265981|emb|CAS10390.1| gap repair protein [Escherichia coli O127:H6 str. E2348/69]
          Length = 242

 Score =  121 bits (302), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 49/237 (20%), Positives = 83/237 (35%), Gaps = 14/237 (5%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVN 57
           M  WQ  A +L  R + E +++L+V T + GR     +  +S R   +  LQ    + + 
Sbjct: 1   MEGWQ-RAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKRSTLKGALQPFTPLLLR 59

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
           +  R                 A  LS      GL     L R L       EL+      
Sbjct: 60  FGGRGEVKTLR---SAEAVSLALPLSGITLYSGLYINELLSRVLEYETRFSELFFDYLHC 116

Query: 118 LNCHKIPS-VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVG 176
           +      +        + EL LL ++G+G++ T CV +G   D              +  
Sbjct: 117 IQSLAGATGTPEPALRRFELALLGHLGYGVNFTHCVGSGEPVDDTMTYRYREEKGFIASV 176

Query: 177 LPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENF 232
           +   +             +  DAD+L++A + T     + AL+  +       RE F
Sbjct: 177 VIDNKTFTGRQLKALNAREFPDADTLRAAKRFT-----RMALKPYLGGKPLKSRELF 228


>gi|74313127|ref|YP_311546.1| DNA repair protein RecO [Shigella sonnei Ss046]
 gi|157158543|ref|YP_001463888.1| DNA repair protein RecO [Escherichia coli E24377A]
 gi|157162044|ref|YP_001459362.1| DNA repair protein RecO [Escherichia coli HS]
 gi|170681019|ref|YP_001744754.1| DNA repair protein RecO [Escherichia coli SMS-3-5]
 gi|191167983|ref|ZP_03029785.1| DNA repair protein RecO [Escherichia coli B7A]
 gi|193064044|ref|ZP_03045129.1| DNA repair protein RecO [Escherichia coli E22]
 gi|193068426|ref|ZP_03049389.1| DNA repair protein RecO [Escherichia coli E110019]
 gi|194429295|ref|ZP_03061822.1| DNA repair protein RecO [Escherichia coli B171]
 gi|194432090|ref|ZP_03064379.1| DNA repair protein RecO [Shigella dysenteriae 1012]
 gi|209920044|ref|YP_002294128.1| DNA repair protein RecO [Escherichia coli SE11]
 gi|218547907|ref|YP_002381698.1| DNA repair protein RecO [Escherichia fergusonii ATCC 35469]
 gi|218555146|ref|YP_002388059.1| DNA repair protein RecO [Escherichia coli IAI1]
 gi|218696193|ref|YP_002403860.1| DNA repair protein RecO [Escherichia coli 55989]
 gi|218701079|ref|YP_002408708.1| DNA repair protein RecO [Escherichia coli IAI39]
 gi|218706069|ref|YP_002413588.1| DNA repair protein RecO [Escherichia coli UMN026]
 gi|260845250|ref|YP_003223028.1| gap repair protein RecO [Escherichia coli O103:H2 str. 12009]
 gi|260856659|ref|YP_003230550.1| gap repair protein RecO [Escherichia coli O26:H11 str. 11368]
 gi|293406007|ref|ZP_06649999.1| DNA repair protein recO [Escherichia coli FVEC1412]
 gi|293410981|ref|ZP_06654557.1| DNA repair protein RecO [Escherichia coli B354]
 gi|293446919|ref|ZP_06663341.1| DNA repair protein RecO [Escherichia coli B088]
 gi|298381807|ref|ZP_06991406.1| DNA repair protein recO [Escherichia coli FVEC1302]
 gi|300817658|ref|ZP_07097873.1| DNA repair protein RecO [Escherichia coli MS 107-1]
 gi|300820756|ref|ZP_07100906.1| DNA repair protein RecO [Escherichia coli MS 119-7]
 gi|300898320|ref|ZP_07116668.1| DNA repair protein RecO [Escherichia coli MS 198-1]
 gi|300920733|ref|ZP_07137139.1| DNA repair protein RecO [Escherichia coli MS 115-1]
 gi|300927058|ref|ZP_07142810.1| DNA repair protein RecO [Escherichia coli MS 182-1]
 gi|301024852|ref|ZP_07188489.1| DNA repair protein RecO [Escherichia coli MS 69-1]
 gi|301330333|ref|ZP_07222980.1| DNA repair protein RecO [Escherichia coli MS 78-1]
 gi|307313864|ref|ZP_07593480.1| DNA repair protein RecO [Escherichia coli W]
 gi|309794381|ref|ZP_07688804.1| DNA repair protein RecO [Escherichia coli MS 145-7]
 gi|312965481|ref|ZP_07779713.1| DNA repair protein RecO [Escherichia coli 2362-75]
 gi|331669315|ref|ZP_08370163.1| DNA repair protein RecO [Escherichia coli TA271]
 gi|331678561|ref|ZP_08379236.1| DNA repair protein RecO [Escherichia coli H591]
 gi|331684215|ref|ZP_08384811.1| DNA repair protein RecO [Escherichia coli H299]
 gi|92087034|sp|Q3YYV1|RECO_SHISS RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|166918729|sp|A7ZQ09|RECO_ECO24 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|166918730|sp|A8A375|RECO_ECOHS RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|226737863|sp|B7NRL8|RECO_ECO7I RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|226737864|sp|B7M8H8|RECO_ECO8A RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|226737865|sp|B7N6F3|RECO_ECOLU RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|226737866|sp|B1LP78|RECO_ECOSM RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|226737867|sp|B7LUZ9|RECO_ESCF3 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|238058645|sp|B6I5D9|RECO_ECOSE RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|73856604|gb|AAZ89311.1| protein interacts with RecR and possibly RecF proteins [Shigella
           sonnei Ss046]
 gi|157067724|gb|ABV06979.1| DNA repair protein RecO [Escherichia coli HS]
 gi|157080573|gb|ABV20281.1| DNA repair protein RecO [Escherichia coli E24377A]
 gi|170518737|gb|ACB16915.1| DNA repair protein RecO [Escherichia coli SMS-3-5]
 gi|190901990|gb|EDV61737.1| DNA repair protein RecO [Escherichia coli B7A]
 gi|192929279|gb|EDV82888.1| DNA repair protein RecO [Escherichia coli E22]
 gi|192958378|gb|EDV88818.1| DNA repair protein RecO [Escherichia coli E110019]
 gi|194412703|gb|EDX28998.1| DNA repair protein RecO [Escherichia coli B171]
 gi|194419619|gb|EDX35699.1| DNA repair protein RecO [Shigella dysenteriae 1012]
 gi|209913303|dbj|BAG78377.1| DNA repair protein RecO [Escherichia coli SE11]
 gi|218352925|emb|CAU98724.1| gap repair protein [Escherichia coli 55989]
 gi|218355448|emb|CAQ88057.1| gap repair protein [Escherichia fergusonii ATCC 35469]
 gi|218361914|emb|CAQ99514.1| gap repair protein [Escherichia coli IAI1]
 gi|218371065|emb|CAR18892.1| gap repair protein [Escherichia coli IAI39]
 gi|218433166|emb|CAR14062.1| gap repair protein [Escherichia coli UMN026]
 gi|257755308|dbj|BAI26810.1| gap repair protein RecO [Escherichia coli O26:H11 str. 11368]
 gi|257760397|dbj|BAI31894.1| gap repair protein RecO [Escherichia coli O103:H2 str. 12009]
 gi|284922515|emb|CBG35602.1| DNA repair protein [Escherichia coli 042]
 gi|291323749|gb|EFE63177.1| DNA repair protein RecO [Escherichia coli B088]
 gi|291428215|gb|EFF01242.1| DNA repair protein recO [Escherichia coli FVEC1412]
 gi|291471449|gb|EFF13933.1| DNA repair protein RecO [Escherichia coli B354]
 gi|298279249|gb|EFI20763.1| DNA repair protein recO [Escherichia coli FVEC1302]
 gi|300357982|gb|EFJ73852.1| DNA repair protein RecO [Escherichia coli MS 198-1]
 gi|300396383|gb|EFJ79921.1| DNA repair protein RecO [Escherichia coli MS 69-1]
 gi|300412304|gb|EFJ95614.1| DNA repair protein RecO [Escherichia coli MS 115-1]
 gi|300416942|gb|EFK00253.1| DNA repair protein RecO [Escherichia coli MS 182-1]
 gi|300526509|gb|EFK47578.1| DNA repair protein RecO [Escherichia coli MS 119-7]
 gi|300529646|gb|EFK50708.1| DNA repair protein RecO [Escherichia coli MS 107-1]
 gi|300843667|gb|EFK71427.1| DNA repair protein RecO [Escherichia coli MS 78-1]
 gi|306906365|gb|EFN36880.1| DNA repair protein RecO [Escherichia coli W]
 gi|308121837|gb|EFO59099.1| DNA repair protein RecO [Escherichia coli MS 145-7]
 gi|309702951|emb|CBJ02282.1| DNA repair protein [Escherichia coli ETEC H10407]
 gi|312289901|gb|EFR17789.1| DNA repair protein RecO [Escherichia coli 2362-75]
 gi|315061884|gb|ADT76211.1| gap repair protein [Escherichia coli W]
 gi|320182110|gb|EFW57014.1| DNA recombination and repair protein RecO [Shigella boydii ATCC
           9905]
 gi|320196401|gb|EFW71025.1| DNA recombination and repair protein RecO [Escherichia coli
           WV_060327]
 gi|320200129|gb|EFW74718.1| DNA recombination and repair protein RecO [Escherichia coli
           EC4100B]
 gi|323156223|gb|EFZ42382.1| DNA repair protein RecO [Escherichia coli EPECa14]
 gi|323159222|gb|EFZ45212.1| DNA repair protein RecO [Escherichia coli E128010]
 gi|323167801|gb|EFZ53496.1| DNA repair protein RecO [Shigella sonnei 53G]
 gi|323173117|gb|EFZ58748.1| DNA repair protein RecO [Escherichia coli LT-68]
 gi|323184555|gb|EFZ69929.1| DNA repair protein RecO [Escherichia coli 1357]
 gi|323377535|gb|ADX49803.1| DNA repair protein RecO [Escherichia coli KO11]
 gi|323936305|gb|EGB32596.1| recombination protein O [Escherichia coli E1520]
 gi|323944622|gb|EGB40690.1| recombination protein O [Escherichia coli H120]
 gi|323968013|gb|EGB63425.1| recombination protein O [Escherichia coli M863]
 gi|324020023|gb|EGB89242.1| DNA repair protein RecO [Escherichia coli MS 117-3]
 gi|324118225|gb|EGC12121.1| recombination protein O [Escherichia coli E1167]
 gi|327252275|gb|EGE63947.1| DNA repair protein RecO [Escherichia coli STEC_7v]
 gi|331064509|gb|EGI36420.1| DNA repair protein RecO [Escherichia coli TA271]
 gi|331075021|gb|EGI46341.1| DNA repair protein RecO [Escherichia coli H591]
 gi|331079167|gb|EGI50369.1| DNA repair protein RecO [Escherichia coli H299]
 gi|332088077|gb|EGI93202.1| DNA repair protein RecO [Shigella boydii 5216-82]
 gi|332089248|gb|EGI94355.1| DNA repair protein RecO [Shigella dysenteriae 155-74]
 gi|333000425|gb|EGK20007.1| DNA repair protein RecO [Shigella flexneri VA-6]
          Length = 242

 Score =  121 bits (302), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 48/237 (20%), Positives = 82/237 (34%), Gaps = 14/237 (5%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVN 57
           M  WQ  A +L  R + E +++L+V T + GR     +  +S R   +  LQ    + + 
Sbjct: 1   MEGWQ-RAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKRSTLKGALQPFTPLLLR 59

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
           +  R                 A  LS      GL     L R L       EL+      
Sbjct: 60  FGGRGEVKTLR---SAEAVSLALPLSGITLYSGLYINELLSRVLEYETRFSELFFDYLHC 116

Query: 118 LNCHKIPS-VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVG 176
           +      +        + EL LL ++G+G++ T C  +G   D              +  
Sbjct: 117 IQSLAGATGTPEPALRRFELALLGHLGYGVNFTHCAGSGEPVDDTMTYRYREEKGFIASV 176

Query: 177 LPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENF 232
           +   +             +  DAD+L++A + T     + AL+  +       RE F
Sbjct: 177 VIDNKTFTGRQLKALNAREFPDADTLRAAKRFT-----RMALKPYLGGKPLKSRELF 228


>gi|331654027|ref|ZP_08355028.1| DNA repair protein RecO [Escherichia coli M718]
 gi|331048876|gb|EGI20952.1| DNA repair protein RecO [Escherichia coli M718]
          Length = 242

 Score =  120 bits (301), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 48/237 (20%), Positives = 82/237 (34%), Gaps = 14/237 (5%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVN 57
           M  WQ  A +L  R + E +++L+V T + GR     +  +S R   +  LQ    + + 
Sbjct: 1   MEGWQ-RAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKRSTLKGALQPFTPLLLR 59

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
           +  R                 A  LS      GL     L R L       EL+      
Sbjct: 60  FGGRGEVKTLR---SAEAVSLALPLSGITLYSGLYINELLSRVLEYETRFSELFFDYLHC 116

Query: 118 LNCHKIPS-VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVG 176
           +      +        + EL LL ++G+G++ T C  +G   D              +  
Sbjct: 117 IQSLAGGTGTPEPALRRFELALLGHLGYGVNFTHCAGSGEPVDDTMTYRYREEKGFIASV 176

Query: 177 LPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENF 232
           +   +             +  DAD+L++A + T     + AL+  +       RE F
Sbjct: 177 VIDNKTFTGRQLKALNAREFPDADTLRAAKRFT-----RMALKPYLGGKPLKSRELF 228


>gi|205353675|ref|YP_002227476.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|238690509|sp|B5RD47|RECO_SALG2 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|205273456|emb|CAR38433.1| DNA repair protein recO [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|326628779|gb|EGE35122.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 9]
          Length = 242

 Score =  120 bits (301), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 47/237 (19%), Positives = 81/237 (34%), Gaps = 14/237 (5%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVN 57
           M  WQ  A +L  R + E +++L+V T + GR     +  +S R   +  LQ    + + 
Sbjct: 1   MEGWQ-RAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKRSNLKGALQPFTPLLLR 59

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
           +  R                 A  LS      GL     L R L       EL+      
Sbjct: 60  YSGRGEVKTLR---SAEAVSLALPLSGITLYSGLYINELLSRVLEYETRFSELFFDYLNC 116

Query: 118 LNCHK-IPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVG 176
           +               + EL LL ++G+G++ T C  +G   D              +  
Sbjct: 117 IQALAGTTGSPEPALRRFELALLGHLGYGVNFTHCAGSGERVDDTMTYRYREEKGFFASV 176

Query: 177 LPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENF 232
           +              +E +  D D+L+++ + T     + AL+  +       RE F
Sbjct: 177 VIDNNTFTGRHLKALEEREFPDVDTLRASKRFT-----RMALKPYLGGKPLKSRELF 228


>gi|260771920|ref|ZP_05880838.1| DNA recombination and repair protein RecO [Vibrio metschnikovii CIP
           69.14]
 gi|260613212|gb|EEX38413.1| DNA recombination and repair protein RecO [Vibrio metschnikovii CIP
           69.14]
          Length = 241

 Score =  120 bits (301), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 40/228 (17%), Positives = 71/228 (31%), Gaps = 11/228 (4%)

Query: 8   IILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLAQN 65
            +L  R Y E ++IL+V + +YGR     +  +  R   +  LQ    + + W      +
Sbjct: 9   FVLNRRPYSESSLILDVFSEEYGRLTLMAKGARGKRSQLKGALQPFTPLLLKW---SGNS 65

Query: 66  LGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPS 125
             +   +         LS       +     + R L    P   L+      L       
Sbjct: 66  TMKTLRQAESISLGLPLSGISLYSAMYVNELVGRVLANDVPSPALFHDYLFALTELAQSD 125

Query: 126 VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKMLV 185
                  + EL LL ++G+G+D   C  TG                  +           
Sbjct: 126 NPEPALRRFELALLSSLGYGVDFLHCAGTGEPITPTMTYRYREQKGFIASVRRDNLTFYG 185

Query: 186 LPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENF 232
                  E +    + L++A + T     + AL+  +       RE F
Sbjct: 186 DELIAISERRFTTKNQLQAAKRFT-----RIALKPYLGGKPLKSRELF 228


>gi|295097902|emb|CBK86992.1| DNA replication and repair protein RecO [Enterobacter cloacae
           subsp. cloacae NCTC 9394]
          Length = 235

 Score =  120 bits (301), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 47/234 (20%), Positives = 81/234 (34%), Gaps = 13/234 (5%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRS 60
           WQ  A +L  R + E +++L+V T + GR     +  +S R   +  LQ    + V +  
Sbjct: 4   WQ-RAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSRRSNLKGALQPFTPLLVRFGG 62

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           R                 A  LS      GL     + R L       EL+      +  
Sbjct: 63  RGEVKTLR---SAEAVSLALPLSGITLYSGLYVNELISRVLEHETRFSELFFDYLHCIQA 119

Query: 121 HKIPS-VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
               +     +  + EL LL ++G+G+D   C  +G   +              +  +  
Sbjct: 120 LAGATGTPEPVLRRFELALLGHLGYGVDFLHCAGSGDEVEDTMTYRYREEKGFIASVVVD 179

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENF 232
                        E +  DAD+L++A + T     + AL+  +       RE F
Sbjct: 180 NSTFTGRQLRALYEREFPDADTLRAAKRFT-----RIALKPYLGGKPLKSRELF 228


>gi|307260994|ref|ZP_07542676.1| DNA repair protein recO [Actinobacillus pleuropneumoniae serovar 12
           str. 1096]
 gi|306869296|gb|EFN01091.1| DNA repair protein recO [Actinobacillus pleuropneumoniae serovar 12
           str. 1096]
          Length = 240

 Score =  120 bits (301), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 40/243 (16%), Positives = 79/243 (32%), Gaps = 13/243 (5%)

Query: 2   YWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWR 59
            W     +L  R Y E +++++  T ++GR     +  +      + +LQ    + + W 
Sbjct: 4   NWH-RGFVLHRREYSETSLLVDFFTEEHGRITLLAKGARRPHSPLKAVLQPFTPLLLRWS 62

Query: 60  SRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLN 119
            +              +     + +     G      L R L  +    EL+      + 
Sbjct: 63  GKGDLKTLTKAEP---ASLTLPMQTLALYSGFYVNEVLARVLENQTAYPELFQHYLQCMT 119

Query: 120 CHK-IPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
                P  I  I    E  +LK +G+G++ + C  TG                  +  L 
Sbjct: 120 RLATQPEKIESILRTFEFQMLKVLGYGVNFSICAATGDPVSPSMTYQFKENEGFIASLLR 179

Query: 179 YAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENFLGKLL 237
                L      +++    D  +L++A + T     + AL+  +       RE F   L 
Sbjct: 180 NNASFLGKDLLAFEQLDFSDKATLQAAKRFT-----RIALKPYLGSQPLKSRELFQSVLP 234

Query: 238 ELI 240
             +
Sbjct: 235 NKL 237


>gi|331674014|ref|ZP_08374777.1| DNA repair protein RecO [Escherichia coli TA280]
 gi|331069287|gb|EGI40679.1| DNA repair protein RecO [Escherichia coli TA280]
          Length = 242

 Score =  120 bits (301), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 48/237 (20%), Positives = 82/237 (34%), Gaps = 14/237 (5%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVN 57
           M  WQ  A +L  R + E +++L+V T + GR     +  +S R   +  LQ    + + 
Sbjct: 1   MEGWQ-RAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKRSTLKGALQPFTPLLLR 59

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
           +  R                 A  LS      GL     L R L       EL+      
Sbjct: 60  FGGRGEVKTLR---SAEAVSLALPLSGITLYSGLYINELLSRVLEYETRFSELFFDYLHC 116

Query: 118 LNCHK-IPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVG 176
           +     +         + EL LL ++G+G++ T C  +G   D              +  
Sbjct: 117 IQSLAGVTGTPEPALRRFELALLGHLGYGVNFTHCAGSGEPVDDTMTYRYREEKGFIASV 176

Query: 177 LPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENF 232
           +   +             +  DAD+L++A + T     + AL+  +       RE F
Sbjct: 177 VIDNKTFTGRQLKALNTREFPDADTLRAAKRFT-----RMALKPYLGGKPLKSRELF 228


>gi|333001658|gb|EGK21225.1| DNA repair protein RecO [Shigella flexneri K-272]
 gi|333015934|gb|EGK35269.1| DNA repair protein RecO [Shigella flexneri K-227]
          Length = 242

 Score =  120 bits (301), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 48/237 (20%), Positives = 82/237 (34%), Gaps = 14/237 (5%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVN 57
           M  WQ  A +L  R + E +++L+V T + GR     +  +S R   +  LQ    + + 
Sbjct: 1   MEGWQ-RAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKRSTLKGALQPFTPLLLR 59

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
           +  R                 A  LS      GL     L R L       EL+      
Sbjct: 60  FGGRGEVKTLR---SAEAVSLALPLSGITLYSGLYINELLSRVLEYETRFSELFFDYLHC 116

Query: 118 LNCHKIPS-VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVG 176
           +      +        + EL LL ++G+G++ T C  +G   D              +  
Sbjct: 117 IQSLAGATGTPEPALRRFELALLGHLGYGVNFTHCAGSGEPVDDTMTYRYREEKGFITSV 176

Query: 177 LPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENF 232
           +   +             +  DAD+L++A + T     + AL+  +       RE F
Sbjct: 177 VIDNKTFTGRQLKALNAREFPDADTLRAAKRFT-----RMALKPYLGGKPLKSRELF 228


>gi|323978405|gb|EGB73490.1| recombination protein O [Escherichia coli TW10509]
          Length = 243

 Score =  120 bits (301), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 48/237 (20%), Positives = 82/237 (34%), Gaps = 14/237 (5%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVN 57
           M  WQ  A +L  R + E +++L+V T + GR     +  +S R   +  LQ    + + 
Sbjct: 2   MEGWQ-RAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKRSTLKGALQPFTPLLLR 60

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
           +  R                 A  LS      GL     L R L       EL+      
Sbjct: 61  FGGRGEVKTLR---SAEAVSLALPLSGITLYSGLYINELLSRVLEYETRFSELFFDYLHC 117

Query: 118 LNCHKIPS-VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVG 176
           +      +        + EL LL ++G+G++ T C  +G   D              +  
Sbjct: 118 IQSLAGATGTPEPALRRFELALLGHLGYGVNFTHCAGSGEPVDDTMTYRYREEKGFIASV 177

Query: 177 LPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENF 232
           +   +             +  DAD+L++A + T     + AL+  +       RE F
Sbjct: 178 VIDNKTFTGRQLKALNAREFPDADTLRAAKRFT-----RMALKPYLGGKPLKSRELF 229


>gi|242240201|ref|YP_002988382.1| DNA repair protein RecO [Dickeya dadantii Ech703]
 gi|242132258|gb|ACS86560.1| DNA repair protein RecO [Dickeya dadantii Ech703]
          Length = 244

 Score =  120 bits (301), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 45/237 (18%), Positives = 75/237 (31%), Gaps = 14/237 (5%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRN--GQSHRMQPILQAGNLVRVN 57
           M  WQ  A +L  R Y E +++L++ T   GR     +    +   ++  LQ    + V 
Sbjct: 1   MEGWQ-RAFVLHGRPYSETSLLLDLFTENEGRVRVLAKGARARRSNLKGALQPFTPLLVR 59

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
           W  R                 A  L  +L   GL     L R L        L+      
Sbjct: 60  WGGRGEVKTLRNAEP---VSLALPLHGALLYSGLYVNELLMRVLEFETDYSALFFDYLYC 116

Query: 118 LNCHKIPS-VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVG 176
           L               + EL LL ++G+G+D   C  +G                  +  
Sbjct: 117 LQQLAAAQGSPEPALRRFELALLAHLGYGVDFLHCAGSGQPVSDTMTYRYREEKGFIASL 176

Query: 177 LPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENF 232
           +                 +  D ++L++A + T     + AL+  +       RE F
Sbjct: 177 VVDNRSFTGRELQALAAREFPDMETLRAAKRFT-----RIALKPYLGPRPLKSRELF 228


>gi|167854944|ref|ZP_02477719.1| DNA repair protein RecO [Haemophilus parasuis 29755]
 gi|167853901|gb|EDS25140.1| DNA repair protein RecO [Haemophilus parasuis 29755]
          Length = 239

 Score =  120 bits (300), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 44/243 (18%), Positives = 79/243 (32%), Gaps = 13/243 (5%)

Query: 2   YWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWR 59
            WQ    +L  R Y E +++++  T  +GR     +  +  R   + +LQ    + + W 
Sbjct: 4   QWQ-RGFVLHRREYSESSLLVDFFTENHGRITLLAKGVRRPRSPLKSVLQPFTPLLLKWT 62

Query: 60  SRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLN 119
            +              +     + +     G      L R L       EL+      + 
Sbjct: 63  GKGDLKTLTKAEP---ASLTLPMQTLALYSGFYVNEVLARVLENHTAYPELFQHYLQCMT 119

Query: 120 CHK-IPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
                P+ I  I    E   LK +G+G+D   C  TG   D              +  L 
Sbjct: 120 KLASQPNEIEPILRTFEFQTLKALGYGVDFCHCAATGKPVDPKMSYQFRENEGFIASLLQ 179

Query: 179 YAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENFLGKLL 237
                +      + E    + ++L+SA + T     + AL+  +       RE F   L 
Sbjct: 180 NNYTFIGKDLLAFAEMNFSEKETLQSAKRFT-----RIALKPYLGSAPLKSRELFQSVLP 234

Query: 238 ELI 240
             +
Sbjct: 235 NRL 237


>gi|315615827|gb|EFU96459.1| DNA repair protein RecO [Escherichia coli 3431]
          Length = 242

 Score =  120 bits (300), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 48/237 (20%), Positives = 82/237 (34%), Gaps = 14/237 (5%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVN 57
           M  WQ  A +L  R + E +++L+V T + GR     +  +S R   +  LQ    + + 
Sbjct: 1   MEGWQ-RAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKRSTLKGALQPFTPLLLR 59

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
           +  R                 A  LS      GL     L R L       EL+      
Sbjct: 60  FGGRGEVKTLR---SAEAVSLALPLSGITLYSGLYINELLSRVLEYETRFSELFFDYLHC 116

Query: 118 LNCHK-IPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVG 176
           +     +         + EL LL ++G+G++ T C  +G   D              +  
Sbjct: 117 IQSLAGVTGTPEPALRRFELALLGHLGYGVNFTHCAGSGEPVDDTMSYRYREEKGFIASV 176

Query: 177 LPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENF 232
           +   +             +  DAD+L++A + T     + AL+  +       RE F
Sbjct: 177 VIDNKTFTGRQLKALNAREFPDADTLRAAKRFT-----RMALKPYLGGKPLKSRELF 228


>gi|24113907|ref|NP_708417.1| DNA repair protein RecO [Shigella flexneri 2a str. 301]
 gi|30063967|ref|NP_838138.1| DNA repair protein RecO [Shigella flexneri 2a str. 2457T]
 gi|42559468|sp|Q83QI6|RECO_SHIFL RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|24053008|gb|AAN44124.1| RecO protein [Shigella flexneri 2a str. 301]
 gi|30042223|gb|AAP17948.1| RecO protein [Shigella flexneri 2a str. 2457T]
 gi|281601978|gb|ADA74962.1| DNA repair protein recO [Shigella flexneri 2002017]
 gi|313648243|gb|EFS12687.1| DNA repair protein RecO [Shigella flexneri 2a str. 2457T]
 gi|332753974|gb|EGJ84348.1| DNA repair protein RecO [Shigella flexneri 4343-70]
 gi|332755801|gb|EGJ86159.1| DNA repair protein RecO [Shigella flexneri 2747-71]
 gi|332761958|gb|EGJ92231.1| DNA repair protein RecO [Shigella flexneri K-671]
 gi|332766566|gb|EGJ96771.1| DNA repair protein RecO [Shigella flexneri 2930-71]
 gi|333000822|gb|EGK20394.1| DNA repair protein RecO [Shigella flexneri K-218]
 gi|333016797|gb|EGK36123.1| DNA repair protein RecO [Shigella flexneri K-304]
          Length = 242

 Score =  120 bits (300), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 48/237 (20%), Positives = 81/237 (34%), Gaps = 14/237 (5%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVN 57
           M  WQ  A +L  R + E +++L+V T + GR     +  +S R   +  LQ    + + 
Sbjct: 1   MEGWQ-RAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKRSTLKGALQPFTPLLLR 59

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
           +  R                 A  LS      GL     L R L       EL+      
Sbjct: 60  FGGRGEVKTLR---SAEAVSLALPLSGITLYSGLYINELLSRVLEYETRFSELFFDYLHC 116

Query: 118 LNCHK-IPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVG 176
           +               + EL LL ++G+G++ T C  +G   D              +  
Sbjct: 117 IQSLAGDTGTPEPALRRFELALLGHLGYGVNFTHCAGSGEPVDGTMTYRYREEKGFIASV 176

Query: 177 LPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENF 232
           +   +             +  DAD+L++A + T     + AL+  +       RE F
Sbjct: 177 VIDNKTFTGRQLKALNAREFPDADTLRAAKRFT-----RMALKPYLGGKPLKSRELF 228


>gi|110806510|ref|YP_690030.1| DNA repair protein RecO [Shigella flexneri 5 str. 8401]
 gi|123342607|sp|Q0T1U0|RECO_SHIF8 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|110616058|gb|ABF04725.1| protein interacts with RecR and possibly RecF proteins [Shigella
           flexneri 5 str. 8401]
          Length = 242

 Score =  120 bits (300), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 48/237 (20%), Positives = 82/237 (34%), Gaps = 14/237 (5%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVN 57
           M  WQ  A +L  R + E +++L+V T + GR     +  +S R   +  LQ    + + 
Sbjct: 1   MEGWQ-RAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKRSTLKGALQPFTPLLLR 59

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
           +  R                 A  LS      GL     L R L       EL+      
Sbjct: 60  FGGRGEVKTLR---SAEAVSLALPLSGITLYSGLYINELLSRVLEYETRFSELFFDYLHC 116

Query: 118 LNCHKIPS-VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVG 176
           +      +        + EL LL ++G+G++ T C  +G   D              +  
Sbjct: 117 IQSLAGATGTPEPALRRFELALLGHLGYGVNFTHCAGSGEPVDGTMTYRYREEKGFIASV 176

Query: 177 LPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENF 232
           +   +             +  DAD+L++A + T     + AL+  +       RE F
Sbjct: 177 VIDNKTFTGRQLKALNAREFPDADTLRAAKRFT-----RMALKPYLGGKPLKSRELF 228


>gi|238920903|ref|YP_002934418.1| DNA repair protein RecO, [Edwardsiella ictaluri 93-146]
 gi|238870472|gb|ACR70183.1| DNA repair protein RecO, putative [Edwardsiella ictaluri 93-146]
          Length = 242

 Score =  120 bits (300), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 44/234 (18%), Positives = 73/234 (31%), Gaps = 13/234 (5%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRS 60
           WQ  A +L  R Y E +++L+  T  +GR     +  +S R   +  LQ    + + W  
Sbjct: 4   WQ-RAFVLHARPYSETSLMLDTFTEGHGRVRLLAKGARSRRSLLKGALQPFTPLLIRWGG 62

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           R                 A  LS      GL     L R L +      L+      +  
Sbjct: 63  RGEVKTLR---SAEAVSLALPLSGITLYSGLYVNELLARVLEQETCYNALFFDYLHCIQH 119

Query: 121 H-KIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                        + EL LL  +G+G+D   C  +G                  +  +  
Sbjct: 120 LAAHAGSPEPALRRFELALLAQLGYGVDFLHCAGSGEPVADTMTYRYRAEKGFIASLVVD 179

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENF 232
                          +  D  +L++A + T     + AL+  +       RE F
Sbjct: 180 QLSFTGRDLKALASREFPDGATLRAAKRFT-----RMALKPYLGGKPLKSRELF 228


>gi|300935698|ref|ZP_07150668.1| DNA repair protein RecO [Escherichia coli MS 21-1]
 gi|300459132|gb|EFK22625.1| DNA repair protein RecO [Escherichia coli MS 21-1]
          Length = 242

 Score =  120 bits (300), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 48/237 (20%), Positives = 82/237 (34%), Gaps = 14/237 (5%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVN 57
           M  WQ  A +L  R + E +++L+V T + GR     +  +S R   +  LQ    + + 
Sbjct: 1   MEGWQ-RAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKRSTLKGALQPFTPLLLR 59

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
           +  R                 A  LS      GL     L R L       EL+      
Sbjct: 60  FGGRGEVKTLR---SAEAVSLALPLSGITLYSGLYINELLSRVLEYETRFSELFFDYLHC 116

Query: 118 LNCHKIPS-VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVG 176
           +      +        + EL LL ++G+G++ T C  +G   D              +  
Sbjct: 117 IQSLAGATGTPEPALRRFELALLGHLGYGVNFTHCAGSGEPVDDTMTYRYREEKGFIASV 176

Query: 177 LPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENF 232
           +   +             +  DAD+L++A + T     + AL+  +       RE F
Sbjct: 177 VIDNKTFTGRQLKALNVREFPDADTLRAAKRFT-----RMALKPYLGGKPLKSRELF 228


>gi|330446943|ref|ZP_08310594.1| DNA repair protein RecO [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
 gi|328491134|dbj|GAA05091.1| DNA repair protein RecO [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
          Length = 236

 Score =  120 bits (300), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 38/236 (16%), Positives = 72/236 (30%), Gaps = 11/236 (4%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNW 58
           M       +L  R Y E ++IL+V +  +GR     +  +  R   +  LQ    + + W
Sbjct: 1   MEGLQRCFVLHSRPYSETSLILDVFSEDHGRLTLLSKGARRKRSNLKGTLQPFTPLFMKW 60

Query: 59  RSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFL 118
             +                    + S +    +     L R L    P  +L+      L
Sbjct: 61  SGKG---AMPVLTHAEPISIGLPMRSYILYSAMYVNEILVRVLGNHTPYPQLFLDYLNVL 117

Query: 119 NCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
                         + EL LL ++G+G+D   C  +G+  +              +    
Sbjct: 118 RELAQADNPEPALRRFELSLLHHLGYGIDFLHCAGSGLGVEDDMTYNYREQQGFIASMKI 177

Query: 179 YAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENFL 233
                                + L++A + T     + AL+  +       RE F+
Sbjct: 178 GQMTFKGNELKAIAARCFETPEQLRAAKRFT-----RMALKPYLGSKPLKSRELFI 228


>gi|261867311|ref|YP_003255233.1| DNA repair protein RecO [Aggregatibacter actinomycetemcomitans
           D11S-1]
 gi|261412643|gb|ACX82014.1| DNA repair protein RecO [Aggregatibacter actinomycetemcomitans
           D11S-1]
          Length = 228

 Score =  119 bits (299), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 39/227 (17%), Positives = 78/227 (34%), Gaps = 12/227 (5%)

Query: 10  LGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLAQNLG 67
           L  +SY E +++++++T  +GR     +  ++ R   + +LQ    + + W  R    + 
Sbjct: 2   LHRKSYSETSLLIDLLTEDFGRISVLAKGARAKRSMLKGVLQPFTPLLLRWSGRGELKIL 61

Query: 68  EFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPSVI 127
                   +  A  L +     G      L R L       +L+      L    +    
Sbjct: 62  TKAEP---AAIALPLQNIALYSGFYLNELLCRVLEPETAYPQLFQQYLQCLTQLAMNQQQ 118

Query: 128 -GKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKMLVL 186
                   E  LL+ +G+G+D T C  +G T +              +  +         
Sbjct: 119 VEPALRTFEFQLLRTLGYGIDFTHCAGSGNTVEADMTYRYREEKGFIASLIKDNLTFYGR 178

Query: 187 PSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENF 232
               +++ +  D   L +A + T     + AL+  +       RE F
Sbjct: 179 ELLAFEQTRFDDPSILVAAKRFT-----RIALKPYLGDKPLKSRELF 220


>gi|82545017|ref|YP_408964.1| DNA repair protein RecO [Shigella boydii Sb227]
 gi|187733291|ref|YP_001881344.1| DNA repair protein RecO [Shigella boydii CDC 3083-94]
 gi|90103524|sp|Q31XS2|RECO_SHIBS RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|238691722|sp|B2TXX8|RECO_SHIB3 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|81246428|gb|ABB67136.1| RecO [Shigella boydii Sb227]
 gi|187430283|gb|ACD09557.1| DNA repair protein RecO [Shigella boydii CDC 3083-94]
 gi|320186364|gb|EFW61098.1| DNA recombination and repair protein RecO [Shigella flexneri CDC
           796-83]
 gi|332092621|gb|EGI97693.1| DNA repair protein RecO [Shigella boydii 3594-74]
          Length = 242

 Score =  119 bits (299), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 48/237 (20%), Positives = 82/237 (34%), Gaps = 14/237 (5%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVN 57
           M  WQ  A +L  R + E +++L+V T + GR     +  +S R   +  LQ    + + 
Sbjct: 1   MEGWQ-RAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKRSTLKGALQPFTPLLLR 59

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
           +  R                 A  LS      GL     L R L       EL+      
Sbjct: 60  FGGRGEVKTLR---SAEAVSLALPLSGITLYSGLYINELLSRVLEYETRFSELFFDYLHC 116

Query: 118 LNCHKIPS-VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVG 176
           +      +        + EL LL ++G+G++ T C  +G   D              +  
Sbjct: 117 IQSLAGATGTPEPALRRFELALLGHLGYGVNFTYCAGSGEPVDDTMTYRYREEKGFIASV 176

Query: 177 LPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENF 232
           +   +             +  DAD+L++A + T     + AL+  +       RE F
Sbjct: 177 VIDNKTFTGRQLKALNAREFPDADTLRAAKRFT-----RMALKPYLGGKPLKSRELF 228


>gi|261340866|ref|ZP_05968724.1| DNA repair protein RecO [Enterobacter cancerogenus ATCC 35316]
 gi|288317297|gb|EFC56235.1| DNA repair protein RecO [Enterobacter cancerogenus ATCC 35316]
          Length = 236

 Score =  119 bits (299), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 48/237 (20%), Positives = 81/237 (34%), Gaps = 14/237 (5%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVN 57
           M  WQ  A +L  R + E +++L+V T + GR     +  +S R   +  LQ    + V 
Sbjct: 2   MEGWQ-RAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKRSNLKGALQPFTPLLVR 60

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
           +  R                 A  LS      GL     + R L       EL+      
Sbjct: 61  FGGRGEVKTLR---SAEAVSLALPLSGITLYSGLYVNELISRVLEHETRFSELFFDYLHC 117

Query: 118 LNCHKIPS-VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVG 176
           +      +        + EL LL ++G+G+D   C  +G   +              +  
Sbjct: 118 IQALAGATGTPEPALRRFELALLGHLGYGVDFLHCAGSGEEVEDTMTYRYREEKGFIASI 177

Query: 177 LPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENF 232
           +               E +  DAD+L++A + T     + AL+  +       RE F
Sbjct: 178 VVDNSTFTGRHLRALYEREFPDADTLRAAKRFT-----RIALKPYLGGKPLKSRELF 229


>gi|256017286|ref|ZP_05431151.1| DNA repair protein RecO [Shigella sp. D9]
 gi|332278277|ref|ZP_08390690.1| DNA repair protein recO [Shigella sp. D9]
 gi|332100629|gb|EGJ03975.1| DNA repair protein recO [Shigella sp. D9]
          Length = 242

 Score =  119 bits (299), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 49/237 (20%), Positives = 82/237 (34%), Gaps = 14/237 (5%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVN 57
           M  WQ  A IL  R + E +++L+V T + GR     +  +S R   +  LQ    + + 
Sbjct: 1   MEGWQ-RAFILHSRPWSETSLMLDVFTEESGRVRLVAKGARSKRSTLKGALQPFTPLLLR 59

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
           +  R                 A  LS      GL     L R L       EL+      
Sbjct: 60  FGGRGEVKTLR---SAEAVSLALPLSGITLYSGLYINELLSRVLEYETRFSELFFDYLHC 116

Query: 118 LNCHKIPS-VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVG 176
           +      +        + EL LL ++G+G++ T C  +G   D              +  
Sbjct: 117 IQSLAGATGTPEPALRRFELALLGHLGYGVNFTHCAGSGEPVDDTMTYRYREEKGFIASV 176

Query: 177 LPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENF 232
           +   +             +  DAD+L++A + T     + AL+  +       RE F
Sbjct: 177 VIDNKTFTGRQLKALNAREFPDADTLRAAKRFT-----RMALKPYLGGKPLKSRELF 228


>gi|219870404|ref|YP_002474779.1| DNA repair protein RecO [Haemophilus parasuis SH0165]
 gi|254764635|sp|B8F3C9|RECO_HAEPS RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|219690608|gb|ACL31831.1| recombinational DNA repair protein (RecF pathway) [Haemophilus
           parasuis SH0165]
          Length = 239

 Score =  119 bits (299), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 44/243 (18%), Positives = 79/243 (32%), Gaps = 13/243 (5%)

Query: 2   YWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWR 59
            WQ    +L  R Y E +++++  T  +GR     +  +  R   + +LQ    + + W 
Sbjct: 4   QWQ-RGFVLHRREYSESSLLVDFFTENHGRITLLAKGVRRPRSPLKSVLQPFTPLLLKWT 62

Query: 60  SRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLN 119
            +              +     + +     G      L R L       EL+      + 
Sbjct: 63  GKGDLKTLTKAEP---ASLTLPMQTLALYSGFYVNEVLARVLENHTAYPELFQHYLHCMT 119

Query: 120 CHK-IPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
                P+ I  I    E   LK +G+G+D   C  TG   D              +  L 
Sbjct: 120 KLASQPNEIEPILRTFEFQTLKALGYGVDFCHCAATGKPVDPKMSYQFRENEGFIASLLQ 179

Query: 179 YAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENFLGKLL 237
                +      + E    + ++L+SA + T     + AL+  +       RE F   L 
Sbjct: 180 NNYTFIGKDLLAFAEMDFSEKETLQSAKRFT-----RIALKPYLGSAPLKSRELFQSVLP 234

Query: 238 ELI 240
             +
Sbjct: 235 NRL 237


>gi|296104240|ref|YP_003614386.1| DNA repair protein RecO [Enterobacter cloacae subsp. cloacae ATCC
           13047]
 gi|295058699|gb|ADF63437.1| DNA repair protein RecO [Enterobacter cloacae subsp. cloacae ATCC
           13047]
          Length = 235

 Score =  119 bits (299), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 47/237 (19%), Positives = 80/237 (33%), Gaps = 14/237 (5%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVN 57
           M  WQ  A +L  R + E +++L+V T + GR     +  +S R   +  LQ    + V 
Sbjct: 1   MEGWQ-RAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKRSNLKGALQPFTPLLVR 59

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
           +  R                 A  LS      GL     + R L       EL+      
Sbjct: 60  FGGRGEVKTLR---SAEAVSLALPLSGITLYSGLYVNELISRVLEHETRFSELFFDYLHC 116

Query: 118 LNCHKIPS-VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVG 176
           +      +        + EL LL ++G+G+D   C  +G   +              +  
Sbjct: 117 IQALAGATGSPEPALRRFELALLGHLGYGVDFLHCAGSGDEVEDGMTYRYREEKGFIASV 176

Query: 177 LPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENF 232
           +               E +  D D+L++A + T     + AL+  +       RE F
Sbjct: 177 VIDNNTFTGRQLRALYEREFPDQDTLRAAKRFT-----RIALKPYLGGKPLKSRELF 228


>gi|324113092|gb|EGC07068.1| recombination protein O [Escherichia fergusonii B253]
          Length = 242

 Score =  119 bits (299), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 48/237 (20%), Positives = 82/237 (34%), Gaps = 14/237 (5%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVN 57
           M  WQ  A +L  R + E +++L+V T + GR     +  +S R   +  LQ    + + 
Sbjct: 1   MEGWQ-RAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKRSTLKGALQPFTPLLLR 59

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
           +  R                 A  LS      GL     L R L       EL+      
Sbjct: 60  FGGRGEVKTLR---SAEAVSLALPLSGITLYSGLYINELLSRVLEYETRFSELFFDYLHC 116

Query: 118 LNCHKIPS-VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVG 176
           +      +        + EL LL ++G+G++ T C  +G   D              +  
Sbjct: 117 IQSLAGATGTPEPALRRFELALLGHLGYGVNFTHCAGSGEPVDDTMTYRYREEKGFIASV 176

Query: 177 LPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENF 232
           +   +             +  DAD+L++A + T     + AL+  +       RE F
Sbjct: 177 VIDNKTFTGRQLKALHTREFPDADTLRAAKRFT-----RMALKPYLGGKPLKSRELF 228


>gi|261820521|ref|YP_003258627.1| DNA repair protein RecO [Pectobacterium wasabiae WPP163]
 gi|261604534|gb|ACX87020.1| DNA repair protein RecO [Pectobacterium wasabiae WPP163]
          Length = 245

 Score =  119 bits (299), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 46/237 (19%), Positives = 78/237 (32%), Gaps = 14/237 (5%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVN 57
           M  WQ  A +L  R Y E +++L++ +   GR     +  ++ R   +  LQ    + V 
Sbjct: 1   MEGWQ-RAFVLHGRPYSETSLLLDLFSESDGRVRVLAKGARARRSSLKGCLQPFTPLLVR 59

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
           W  R                 A  L+ S+   GL     L R L        L+      
Sbjct: 60  WSGRGEVKTLRSAEP---VSLALPLTGSMLYSGLYVNELLSRVLEHETNYSALFFDYLHC 116

Query: 118 LNCH-KIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVG 176
           L       +       + EL LL  +G+G+D   C  +G +                +  
Sbjct: 117 LQHLAAQDASPEPALRRFELALLSYLGYGVDFLHCAGSGESVADTMTYQYREERGFIASL 176

Query: 177 LPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENF 232
           +   +             +  D  +LK+A + T     + AL+  +       RE F
Sbjct: 177 VVDNKSFTGHELRSLASREFPDTGTLKAAKRFT-----RIALKPYLGGKPLKSRELF 228


>gi|213613051|ref|ZP_03370877.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-2068]
          Length = 242

 Score =  119 bits (298), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 47/237 (19%), Positives = 80/237 (33%), Gaps = 14/237 (5%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVN 57
           M  WQ  A +L  R + E +++L+V T + GR     +  +S R   +  LQ    + + 
Sbjct: 1   MEGWQ-RAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKRSNLKGALQLFTPLLLR 59

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
           +  R                 A  LS      GL     L R L       EL+      
Sbjct: 60  YSGRGEVKTLR---SAEAVSLALPLSGITLYSGLYINELLSRVLEYETRFSELFFDYLNC 116

Query: 118 LNCHK-IPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVG 176
           +               + EL LL ++G+G++ T C  +G   D              +  
Sbjct: 117 IQALAGTTGSPEPALRRFELALLGHLGYGVNFTHCAGSGERVDDTMTYRYREEKGFFASV 176

Query: 177 LPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENF 232
           +              +  +  D D+L++A + T     + AL+  +       RE F
Sbjct: 177 VIDNNTFTGRHLKALEAREFPDVDTLRAAKRFT-----RMALKPYLGGKPLKSRELF 228


>gi|253689438|ref|YP_003018628.1| DNA repair protein RecO [Pectobacterium carotovorum subsp.
           carotovorum PC1]
 gi|251756016|gb|ACT14092.1| DNA repair protein RecO [Pectobacterium carotovorum subsp.
           carotovorum PC1]
          Length = 245

 Score =  119 bits (298), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 46/237 (19%), Positives = 77/237 (32%), Gaps = 14/237 (5%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVN 57
           M  WQ  A +L  R Y E +++L++ +   GR     +  ++ R   +  LQ    + V 
Sbjct: 1   MEGWQ-RAFVLHGRPYSETSLLLDLFSESDGRVRVLAKGARARRSSLKGCLQPFTPLLVR 59

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
           W  R                 A  L+ S+   GL     L R L        L+      
Sbjct: 60  WSGRGEVKTLRSAEP---VSLALPLTGSMLYSGLYVNELLSRVLEHETNYSALFFDYLHC 116

Query: 118 LNCH-KIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVG 176
           L       +       + EL LL  +G+G+D   C  +G                  +  
Sbjct: 117 LQHLAAQDASPEPALRRFELALLGYLGYGVDFLHCAGSGEPVADTMTYQYREERGFIASL 176

Query: 177 LPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENF 232
           +   +             +  D  +LK+A + T     + AL+  +       RE F
Sbjct: 177 VVDNKSFTGHELRSLASREFPDNGTLKAAKRFT-----RIALKPYLGGKPLKSRELF 228


>gi|90580327|ref|ZP_01236134.1| DNA repair protein RecO [Vibrio angustum S14]
 gi|90438629|gb|EAS63813.1| DNA repair protein RecO [Vibrio angustum S14]
          Length = 236

 Score =  119 bits (298), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 39/236 (16%), Positives = 74/236 (31%), Gaps = 11/236 (4%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNW 58
           M       +L  R Y E ++IL+V +  +GR     +  +  R   +  LQ    + + W
Sbjct: 1   MEGLQRCFVLHSRPYSETSLILDVFSEDHGRLTLLSKGARRKRSNLKGTLQPFTPLFMKW 60

Query: 59  RSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFL 118
             +                    L S +    +     L R L    P  +L+      L
Sbjct: 61  SGKG---AMPVLTHAEPISIGLPLRSYILYSAMYVNEILVRVLGNHTPYPQLFLDYLNVL 117

Query: 119 NCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
                         + EL LL ++G+G+D   C  +G++ +              +    
Sbjct: 118 RELAQADNPEPALRRFELSLLHHLGYGIDFLHCAGSGLSVEDDMTYNYREQQGFIASMKI 177

Query: 179 YAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENFL 233
                           +    + L++A + T     + AL+  +       RE F+
Sbjct: 178 GLLTFRGNELKAIAARRFETPEQLRAAKRFT-----RMALKPYLGSKPLKSRELFI 228


>gi|320176133|gb|EFW51200.1| DNA recombination and repair protein RecO [Shigella dysenteriae CDC
           74-1112]
          Length = 242

 Score =  119 bits (298), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 49/237 (20%), Positives = 83/237 (35%), Gaps = 14/237 (5%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVN 57
           M  WQ  A +L  R + E +++L+V T + GR     +  +S R   +  LQ    + + 
Sbjct: 1   MEGWQ-RAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKRSTLKGALQPFTPLLLR 59

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
           +  R                 A  LSS     GL     L R L       EL+      
Sbjct: 60  FGGRGEVKTLR---SAEAVSLALPLSSITLYSGLYINELLSRVLEYETRFSELFFDYLHC 116

Query: 118 LNCHKIPS-VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVG 176
           +      +        + EL LL ++G+G++ T C  +G   D              +  
Sbjct: 117 IQSLAGATGTPEPALRRFELALLGHLGYGVNFTYCAGSGEPVDDTMTYRYREEKGFIASV 176

Query: 177 LPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENF 232
           +   +             +  DAD+L++A + T     + AL+  +       RE F
Sbjct: 177 VIDNKTFTGRQLKALNAREFPDADTLRAAKRFT-----RMALKPYLGGKPLKSRELF 228


>gi|90412088|ref|ZP_01220095.1| DNA repair protein RecO [Photobacterium profundum 3TCK]
 gi|90327066|gb|EAS43445.1| DNA repair protein RecO [Photobacterium profundum 3TCK]
          Length = 236

 Score =  119 bits (297), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 42/236 (17%), Positives = 75/236 (31%), Gaps = 11/236 (4%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNW 58
           M       +L  R Y E ++IL+V +  YGR     +  +  R   +  LQ    + + W
Sbjct: 1   MEGLQRCFVLHSRPYSETSLILDVFSEDYGRLTILSKGARRKRSNLKGTLQPFTPLFMKW 60

Query: 59  RSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFL 118
             R +    +          +  +   +          L R L    P   L+      L
Sbjct: 61  TGRGS---MKTLTHAEPISISLPMRGYILYSAFYLNEVLARVLENDTPYPVLFMDYLNAL 117

Query: 119 NCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
                         + EL LL ++G+G+D   C  +G+  D L            +  + 
Sbjct: 118 RELVQADNPEPALRRFELALLHHLGYGIDFLHCAGSGLPVDDLMTYNYREQKGFIASMMT 177

Query: 179 YAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENFL 233
                           +    D L++A + T     + AL+  +       RE F+
Sbjct: 178 GHLTFTGNQLLAIAARRFETPDQLRAAKRFT-----RIALKPYLGGKPLKSRELFI 228


>gi|325496355|gb|EGC94214.1| DNA repair protein RecO [Escherichia fergusonii ECD227]
          Length = 242

 Score =  119 bits (297), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 48/237 (20%), Positives = 82/237 (34%), Gaps = 14/237 (5%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVN 57
           M  WQ  A +L  R + E +++L+V T + GR     +  +S R   +  LQ    + + 
Sbjct: 1   MEGWQ-RAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKRSILKGALQPFTPLLLR 59

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
           +  R                 A  LS      GL     L R L       EL+      
Sbjct: 60  FGGRGEVKTLR---SAEAVSLALPLSGITLYSGLYINELLSRVLEYETRFSELFFDYLHC 116

Query: 118 LNCHKIPS-VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVG 176
           +      +        + EL LL ++G+G++ T C  +G   D              +  
Sbjct: 117 IQSLAGATGTPEPALRRFELALLGHLGYGVNFTHCAGSGEPVDDTMTYRYREEKGFIASV 176

Query: 177 LPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENF 232
           +   +             +  DAD+L++A + T     + AL+  +       RE F
Sbjct: 177 VIDNKTFTGRQLKALHTREFPDADTLRAAKRFT-----RMALKPYLGGKPLKSRELF 228


>gi|297581083|ref|ZP_06943008.1| DNA repair protein recO [Vibrio cholerae RC385]
 gi|297534909|gb|EFH73745.1| DNA repair protein recO [Vibrio cholerae RC385]
          Length = 241

 Score =  119 bits (297), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 38/221 (17%), Positives = 69/221 (31%), Gaps = 10/221 (4%)

Query: 8   IILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLAQN 65
            +L  R Y E ++IL+V + +YGR     +  +  R   +  LQ    + + W    +  
Sbjct: 9   FVLHRRPYSESSLILDVFSEEYGRVTLMAKGARGKRSNLKGALQPFTPLLLKWSGNGS-- 66

Query: 66  LGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPS 125
             +   +         LS       +     + R L     C  L+      L      +
Sbjct: 67  -MKTLRQAEPISLGLPLSGVYLYSAMYINELVDRVLMPEVACPGLFHDYLFALTELAQST 125

Query: 126 VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKMLV 185
                  + EL LL  +G+G+D   C  TG                  +         L 
Sbjct: 126 NPEPALRRFELALLAAMGYGVDFLHCAGTGEPVSPDMTYRYREQKGFIASVRRDNLTFLG 185

Query: 186 LPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH 226
                  E +    + L++A + T     + AL+  +    
Sbjct: 186 NELIAISERRFTSKEQLQAAKRFT-----RLALKPYLGGKP 221


>gi|312947136|gb|ADR27963.1| DNA repair protein RecO [Escherichia coli O83:H1 str. NRG 857C]
          Length = 242

 Score =  119 bits (297), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 48/237 (20%), Positives = 82/237 (34%), Gaps = 14/237 (5%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVN 57
           M  WQ  A +L  R + E +++L+V T + GR     +  +S R   +  LQ    + + 
Sbjct: 1   MEGWQ-RAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKRSTLKGALQPFTPLLLR 59

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
           +  R           V        LS      GL     L R L       EL+      
Sbjct: 60  FGGRGEVKTLRSAEAVSLVLP---LSGITLYSGLYINELLSRVLEYETRFSELFFDYLHC 116

Query: 118 LNCHK-IPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVG 176
           +     +         + EL LL ++G+G++ T C  +G   D              +  
Sbjct: 117 IQSLAGVTGTPEPALRRFELALLGHLGYGVNFTHCAGSGEPVDDTMTYRYREEKGFIASV 176

Query: 177 LPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENF 232
           +   +             +  DAD+L++A + T     + AL+  +       RE F
Sbjct: 177 VIDNKTFTGRQLKALNAREFPDADTLRAAKRFT-----RMALKPYLGGKPLKSRELF 228


>gi|183599775|ref|ZP_02961268.1| hypothetical protein PROSTU_03283 [Providencia stuartii ATCC 25827]
 gi|188022039|gb|EDU60079.1| hypothetical protein PROSTU_03283 [Providencia stuartii ATCC 25827]
          Length = 242

 Score =  119 bits (297), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 39/234 (16%), Positives = 75/234 (32%), Gaps = 13/234 (5%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRS 60
           WQ  A +L  R + E +++++  T   G+     +  + +R   +  LQ    + + W  
Sbjct: 4   WQ-RAFVLHSRPFSETSLLVDFFTEGEGKIRLLAKGARRNRSPFRGCLQPFTPLLIRWGG 62

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           +                 +  L+ ++   GL     + R +    P   L+      L  
Sbjct: 63  KGEIKTLTHADP---ISLSLPLTGTVLYSGLYLNELVTRVIEFGTPYSALFFDYLSCLQL 119

Query: 121 H-KIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                        Q EL LL  +G+G+D   C  +G                     +  
Sbjct: 120 LAASEHTPEAALRQFELALLSYLGYGVDFLHCAGSGEPVSDTMTYRYREEKGFIGSLVID 179

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENF 232
                          +  D+D+L++A + T     + AL+  +       RE F
Sbjct: 180 QLSFTGKHLKALAAREFPDSDTLRAAKRFT-----RIALKPYLGGKPLKSRELF 228


>gi|89075086|ref|ZP_01161527.1| DNA repair protein RecO [Photobacterium sp. SKA34]
 gi|89049173|gb|EAR54738.1| DNA repair protein RecO [Photobacterium sp. SKA34]
          Length = 236

 Score =  119 bits (297), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 39/236 (16%), Positives = 74/236 (31%), Gaps = 11/236 (4%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNW 58
           M       +L  R Y E ++IL+V +  +GR     +  +  R   +  LQ    + + W
Sbjct: 1   MEGLQRCFVLHSRPYSETSLILDVFSEDHGRLTLLSKGARRKRSNLKGTLQPFTPLFMKW 60

Query: 59  RSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFL 118
             +                    L S +    +     L R L    P  +L+      L
Sbjct: 61  SGKG---AMPVLTHAEPISIGLPLRSYILYSAMYVNEILVRVLGNHTPYPQLFLDYLNVL 117

Query: 119 NCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
                         + EL LL ++G+G+D   C  +G++ +              +    
Sbjct: 118 RELAQADNPEPALRRFELSLLHHLGYGIDFLHCAGSGLSVEDNMTYNYREQQGFIASMKI 177

Query: 179 YAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENFL 233
                           +    + L++A + T     + AL+  +       RE F+
Sbjct: 178 GLLTFRGNELKAIAARRFETPEQLRAAKRFT-----RMALKPYLGSKPLKSRELFI 228


>gi|269140065|ref|YP_003296766.1| DNA repair protein [Edwardsiella tarda EIB202]
 gi|267985726|gb|ACY85555.1| DNA repair protein [Edwardsiella tarda EIB202]
 gi|304559893|gb|ADM42557.1| DNA recombination and repair protein RecO [Edwardsiella tarda
           FL6-60]
          Length = 242

 Score =  118 bits (296), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 44/234 (18%), Positives = 73/234 (31%), Gaps = 13/234 (5%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRS 60
           WQ  A +L  R Y E +++L+  T  +GR     +  +S R   +  LQ    + + W  
Sbjct: 4   WQ-RAFVLHARPYSETSLMLDTFTEGHGRVRLLAKGARSRRSLLKGALQPFTPLLIRWGG 62

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           R                 A  LS      GL     L R L +      L+      +  
Sbjct: 63  RGEVKTLR---SAEAVSLALPLSGITLYSGLYVNELLARVLEQETCYSALFFDYLHCIQH 119

Query: 121 H-KIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                        + EL LL  +G+G+D   C  +G                  +  +  
Sbjct: 120 LAAHAGSPEPALRRFELALLTQLGYGVDFLHCAGSGEPVADTMTYRYREEKGFIASLVVD 179

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENF 232
                          +  D  +L++A + T     + AL+  +       RE F
Sbjct: 180 QLSFTGRDLKALASREFPDGATLRAAKRFT-----RMALKPYLGGKPLKSRELF 228


>gi|300311262|ref|YP_003775354.1| DNA repair protein [Herbaspirillum seropedicae SmR1]
 gi|300074047|gb|ADJ63446.1| DNA repair protein [Herbaspirillum seropedicae SmR1]
          Length = 286

 Score =  118 bits (296), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 44/234 (18%), Positives = 79/234 (33%), Gaps = 10/234 (4%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQS--HRMQPILQAGNLVRVNWRSRLA 63
              +L    Y E ++I++V +R +GR     +  +    +++  LQ    + ++W  +  
Sbjct: 58  PGFVLHSYPYKETSLIIDVFSRDHGRVALVAKGAKRPHSKLRGALQTFQPLSLSWSGKSE 117

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKI 123
                   +         L  S  L G      L + L   +    L+D     LN    
Sbjct: 118 VRT---LTDAEWVGGLLPLEKSALLCGFYLNELLVKLLAREDAHPALFDHYVATLNKLAH 174

Query: 124 PSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKM 183
                 +  Q E +LLK  G   + + CVV+G T     +         R   L      
Sbjct: 175 GENAPIVLRQFERILLKQTGVAGNWSHCVVSGKTVRPDLIYVVDPEQGTRPERLSDRAPK 234

Query: 184 LVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHN-IIHCHLLRENFLGKL 236
           +   + L  E +     +     QL   FL +Y L H+        R+  +  +
Sbjct: 235 VSGKTLLDMEREDYSDPT----TQLQSKFLMRYLLAHHLGGAQLNTRQILIDLM 284


>gi|227112905|ref|ZP_03826561.1| DNA repair protein RecO [Pectobacterium carotovorum subsp.
           brasiliensis PBR1692]
 gi|227328579|ref|ZP_03832603.1| DNA repair protein RecO [Pectobacterium carotovorum subsp.
           carotovorum WPP14]
          Length = 245

 Score =  118 bits (296), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 46/237 (19%), Positives = 77/237 (32%), Gaps = 14/237 (5%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVN 57
           M  WQ  A +L  R Y E +++L++ +   GR     +  ++ R   +  LQ    + V 
Sbjct: 1   MEGWQ-RAFVLHGRPYSETSLLLDLFSESDGRVRVLAKGARARRSSLKGCLQPFTPLLVR 59

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
           W  R                 A  L+ S+   GL     L R L        L+      
Sbjct: 60  WSGRGEVKTLRSAEP---VSLALPLTGSMLYSGLYVNELLSRVLEHETNYSALFFDYLHC 116

Query: 118 LNCH-KIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVG 176
           L       +       + EL LL  +G+G+D   C  +G                  +  
Sbjct: 117 LQHLAAQDASPEPALRRFELALLGYLGYGVDFLHCAGSGEPVADTMTYQYREERGFIASL 176

Query: 177 LPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENF 232
           +   +             +  D  +LK+A + T     + AL+  +       RE F
Sbjct: 177 VVDNKSFTGHELRSLASREFPDVGTLKAAKRFT-----RIALKPYLGGKPLKSRELF 228


>gi|311278502|ref|YP_003940733.1| DNA repair protein RecO [Enterobacter cloacae SCF1]
 gi|308747697|gb|ADO47449.1| DNA repair protein RecO [Enterobacter cloacae SCF1]
          Length = 242

 Score =  118 bits (296), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 46/237 (19%), Positives = 78/237 (32%), Gaps = 14/237 (5%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVN 57
           M  WQ  A +L  R + E +++L+V T + GR     +  ++ R   +  LQ    + V 
Sbjct: 1   MEGWQ-RAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARAKRSNLKGALQPFTPLLVR 59

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
           +  R                 A  LS      GL     + R L       EL+      
Sbjct: 60  FGGRGDVKTLR---SAEAVSLALPLSGITLYSGLYVNELISRVLEHETRFSELFFDYLHC 116

Query: 118 LNCHK-IPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVG 176
           +               + EL LL ++G+G+D   C  +G   D              +  
Sbjct: 117 IQALAGATRSPEPALRRFELALLGHLGYGVDFLHCAGSGEEVDDGMTYRYREEKGFIASV 176

Query: 177 LPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENF 232
           +                 +  D D+L++A + T     + AL+  +       RE F
Sbjct: 177 VIDNSTFTGRQLKALDAREFPDVDTLRAAKRFT-----RMALKPYLGGKPLKSRELF 228


>gi|260869252|ref|YP_003235654.1| gap repair protein RecO [Escherichia coli O111:H- str. 11128]
 gi|257765608|dbj|BAI37103.1| gap repair protein RecO [Escherichia coli O111:H- str. 11128]
 gi|323177305|gb|EFZ62893.1| DNA repair protein RecO [Escherichia coli 1180]
          Length = 242

 Score =  118 bits (296), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 48/237 (20%), Positives = 81/237 (34%), Gaps = 14/237 (5%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVN 57
           M  WQ  A +L  R + E +++L+V T + GR     +  +S R   +  LQ    + + 
Sbjct: 1   MEGWQ-RAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKRSTLKGALQPFTPLLLR 59

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
           +  R                 A  LS      GL     L R L       EL+      
Sbjct: 60  FGGRGEVKTLR---SAEAVSLALPLSGITLYSGLYINELLSRVLEYETRFSELFFDYLHC 116

Query: 118 LNCHKIPS-VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVG 176
           +      +        + EL LL ++G+G++ T C  +G   D              +  
Sbjct: 117 IQSLAGATGTPEPALRRFELALLGHLGYGVNFTHCAGSGEPVDDTMTYRYREEKGFIASV 176

Query: 177 LPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENF 232
           +   +             +  DAD+L++A + T       AL+  +       RE F
Sbjct: 177 VIDNKTFTGRQLKALNAREFPDADTLRAAKRFTCM-----ALKPYLGGKPLKSRELF 228


>gi|317491020|ref|ZP_07949456.1| recombination protein O [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316920567|gb|EFV41890.1| recombination protein O [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 242

 Score =  118 bits (296), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 46/237 (19%), Positives = 76/237 (32%), Gaps = 14/237 (5%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVN 57
           M  WQ  A +L  R Y E +++L++ T  +GR     +  +S R   +  LQ    + V 
Sbjct: 1   MEGWQ-RAFVLHGRPYSETSLLLDLFTEGHGRVRLLAKGARSKRSSLKGALQPFTPLLVR 59

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
           W  +                    L+      GL     + R L +      L+      
Sbjct: 60  WGGKGEVKTLRNAEP---VSLGLPLTGISLYSGLYVNELVSRVLEQETNYSSLFFDYLNC 116

Query: 118 LNCHKIPS-VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVG 176
           L               + EL LL N+G+G+D   C  +G                  +  
Sbjct: 117 LQNLAATVGSPEHTLREFELALLGNLGYGIDFLHCAGSGEPVSDDMTYRYREEKGFIASL 176

Query: 177 LPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENF 232
           L               E +  D  +L++A + T     + AL+  +       RE F
Sbjct: 177 LVDQLSFTGRDLKALAERRFPDPITLRAAKRFT-----RMALKPYLGGKPLKSRELF 228


>gi|52424294|ref|YP_087431.1| DNA repair protein RecO [Mannheimia succiniciproducens MBEL55E]
 gi|81609676|sp|Q65W14|RECO_MANSM RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|52306346|gb|AAU36846.1| RecO protein [Mannheimia succiniciproducens MBEL55E]
          Length = 228

 Score =  118 bits (296), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 36/234 (15%), Positives = 80/234 (34%), Gaps = 12/234 (5%)

Query: 10  LGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLAQNLG 67
           L  + Y E ++++++ T + GR     +  ++ R   + +LQ    + + W  + +  + 
Sbjct: 2   LHRKPYSETSLLVDLFTEESGRLTVLAKGARAKRSALKSVLQPFTPLLLRWTGKSSLKIL 61

Query: 68  EFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPSVI 127
                   +  A  L  +    G      + R +    P  +L+      L    +    
Sbjct: 62  TKAEP---AAIALPLQQTALFSGFYVNELITRVIEPETPNPQLFQDYLHCLTSLAVSQNF 118

Query: 128 -GKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKMLVL 186
                 + E  LL  +G+G+D   C  +G   D              +  +         
Sbjct: 119 VEPALREFEFKLLNILGYGVDFLHCAGSGEPVDENMTYRYREEKGFIASLIKDNLTFFGR 178

Query: 187 PSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENFLGKLLEL 239
               ++ +   +   L++A + T     + AL+  + +     RE F   +L L
Sbjct: 179 ELIAFERQDFSEKSVLQAAKRFT-----RVALKPYLGNKPLKSRELFTQTILHL 227


>gi|50122198|ref|YP_051365.1| DNA repair protein RecO [Pectobacterium atrosepticum SCRI1043]
 gi|61214937|sp|Q6D221|RECO_ERWCT RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|49612724|emb|CAG76174.1| DNA repair protein [Pectobacterium atrosepticum SCRI1043]
          Length = 245

 Score =  118 bits (296), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 46/237 (19%), Positives = 77/237 (32%), Gaps = 14/237 (5%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVN 57
           M  WQ  A +L  R Y E +++L++ +   GR     +  ++ R   +  LQ    + V 
Sbjct: 1   MEGWQ-RAFVLHGRPYSETSLLLDLFSESDGRVRVLAKGARARRSSLKGCLQPFTPLLVR 59

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
           W  R                 A  L+ S+   GL     L R L        L+      
Sbjct: 60  WSGRGEVKTLRSAEP---VSLALPLTGSMLYSGLYVNELLARVLEHETNYSALFFDYLHC 116

Query: 118 LNCH-KIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVG 176
           L       +       + EL LL  +G+G+D   C  +G                  +  
Sbjct: 117 LQHLAAQDASPEPALRRFELALLGYLGYGVDFLHCAGSGEPVADTMTYQYREERGFTASL 176

Query: 177 LPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENF 232
           +   +             +  D  +LK+A + T     + AL+  +       RE F
Sbjct: 177 VVDNKSFTGHELHSLASREFPDVGTLKAAKRFT-----RIALKPYLGGKPLKSRELF 228


>gi|1033154|gb|AAA79827.1| CG Site No. 17962 [Escherichia coli str. K-12 substr. MG1655]
          Length = 242

 Score =  118 bits (295), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 48/237 (20%), Positives = 82/237 (34%), Gaps = 14/237 (5%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVN 57
           M  WQ  A +L  R + E +++L+V T + GR     +  +S R   +  LQ    + + 
Sbjct: 1   MEGWQ-RAFVLHSRPWSETSLMLDVFTEESGRVRLVXKGARSKRSTLKGALQPFTPLLLR 59

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
           +  R                 A  LS      GL     L R L       EL+      
Sbjct: 60  FGGRGEVKTLR---SAEAVSLALPLSGITLYSGLYINELLSRVLEYETRFSELFFDYLHC 116

Query: 118 LNCHK-IPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVG 176
           +     +         + EL LL ++G+G++ T C  +G   D              +  
Sbjct: 117 IQSLAGVTGTPEPALRRFELALLGHLGYGVNFTHCAGSGEPVDDTMTYRYREEKGFIASV 176

Query: 177 LPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENF 232
           +   +             +  DAD+L++A + T     + AL+  +       RE F
Sbjct: 177 VIDNKTFTGRQLKALNAREFPDADTLRAAKRFT-----RMALKPYLGGKPLKSRELF 228


>gi|238753922|ref|ZP_04615282.1| DNA repair protein recO [Yersinia ruckeri ATCC 29473]
 gi|238707910|gb|EEQ00268.1| DNA repair protein recO [Yersinia ruckeri ATCC 29473]
          Length = 243

 Score =  118 bits (295), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 48/243 (19%), Positives = 82/243 (33%), Gaps = 14/243 (5%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVN 57
           M  WQ  A +L  R Y E +++L++ T   GR     +  +S R   +  LQ    + V 
Sbjct: 1   MEGWQ-RAFVLHSRPYSETSLMLDLFTEGEGRMRVLAKGARSRRSNLKGCLQPFTPLLVR 59

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
           W  R                 A  LS ++   GL     L R L        L+      
Sbjct: 60  WAGRGEVKTLRSAEP---VSLALPLSGTMLYSGLYVNELLSRVLEHGTNYSALFFDYLHC 116

Query: 118 LNCHKIPS-VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVG 176
           L            +  Q EL +L ++G+G+D   C  +G                  +  
Sbjct: 117 LQALAATDGSPECVLRQFELAMLASLGYGVDFLHCAGSGQPVADSMTYRYREEKGFIASL 176

Query: 177 LPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENFLGK 235
           +                 +  D+D+L++A + T     + AL+  +       RE F   
Sbjct: 177 VVDHYSFTGRQLQALANREFPDSDTLRAAKRFT-----RMALRPYLGGKPLKSRELFRQF 231

Query: 236 LLE 238
           +++
Sbjct: 232 VIK 234


>gi|54310185|ref|YP_131205.1| DNA repair protein RecO [Photobacterium profundum SS9]
 gi|61215025|sp|Q6LMS4|RECO_PHOPR RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|46914626|emb|CAG21403.1| putative DNA repair protein RecO [Photobacterium profundum SS9]
          Length = 236

 Score =  118 bits (295), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 43/242 (17%), Positives = 77/242 (31%), Gaps = 11/242 (4%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNW 58
           M       +L  R Y E ++IL+V +  YGR     +  +  R   +  LQ    + + W
Sbjct: 1   MEGLQRCFVLHYRPYSETSLILDVFSEDYGRLTILSKGARRKRSNLKGTLQPFTPLFMKW 60

Query: 59  RSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFL 118
             R +    +          +  +   +          L R L    P   L+      L
Sbjct: 61  TGRGS---MKTLTHAEPISISLPMRGYILYSAFYLNEVLVRVLENDTPYPVLFMDYLNAL 117

Query: 119 NCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
                         + EL LL ++G+G+D   C  +G+  D L            +  + 
Sbjct: 118 RELAQADNPEPALRRFELALLHHLGYGIDFLHCAGSGLPIDDLMTYHYREQKGFIASMMT 177

Query: 179 YAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENFLGKLL 237
                           +    D LK+A + T     + AL+  +       RE F+ +  
Sbjct: 178 GHFTFTGNQLLAIAARRFETPDQLKAAKRFT-----RIALKPYLGGKPLKSRELFIPRTR 232

Query: 238 EL 239
            +
Sbjct: 233 NI 234


>gi|209695941|ref|YP_002263871.1| DNA repair protein RecO [Aliivibrio salmonicida LFI1238]
 gi|238058640|sp|B6EKM7|RECO_ALISL RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|208009894|emb|CAQ80207.1| DNA repair protein RecO (recombination protein O) [Aliivibrio
           salmonicida LFI1238]
          Length = 238

 Score =  118 bits (295), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 44/237 (18%), Positives = 84/237 (35%), Gaps = 12/237 (5%)

Query: 8   IILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLAQN 65
            +L  R Y E ++IL+V + +YGR     +  +S R   + +LQA   + + W  + +  
Sbjct: 9   FVLHRRPYSESSLILDVFSEEYGRLSIISKGARSKRSNLKGVLQAFTPLLMKWSGKGS-- 66

Query: 66  LGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPS 125
                 +      A  L+       L     + R + +  P   L+      L       
Sbjct: 67  -MRTLRQAETISLAIPLTGINLYSALYINELVVRVIEQETPYPALFLDYLTALTELAQTK 125

Query: 126 VIGKIFVQIELMLLKNIGFGLDLTKCVVT-GVTQDLLWVSPKSGGAVCRSVGLPYAEKML 184
                  + EL LL ++G+G+D   C  +  +    +    +       S+         
Sbjct: 126 NPEPALRRFELALLSSLGYGVDFLHCAGSGEMVSPEMTYRYREQKGFMASIRHDPLMSFK 185

Query: 185 VLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENFLGKLLELI 240
                   E + I  + LK+A + T     + AL+  +       RE FL +   ++
Sbjct: 186 GDELIAISERRFITPEQLKAAKRFT-----RIALKPYLGGKPLKSRELFLPRTRSIL 237


>gi|268593248|ref|ZP_06127469.1| DNA repair protein RecO [Providencia rettgeri DSM 1131]
 gi|291311143|gb|EFE51596.1| DNA repair protein RecO [Providencia rettgeri DSM 1131]
          Length = 242

 Score =  118 bits (295), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 44/234 (18%), Positives = 74/234 (31%), Gaps = 13/234 (5%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRS 60
           WQ  A +L  R Y E +++L+  T   G+     +  + +R   +  LQ    + + W  
Sbjct: 4   WQ-RAFVLHSRPYSETSLLLDFFTEGEGKIRLLAKGARRNRSPLRGCLQPFTPLLIRWGG 62

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           +                 A  L+ ++   GL       R L    P   L+      L  
Sbjct: 63  KGEIKTLINADP---VSLALPLTGTVLYSGLYLNELTARVLEFGTPYSSLFFDYLSCLQI 119

Query: 121 H-KIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                        + EL LL  +G+G+D   C  +G                     +  
Sbjct: 120 LAASEHTPEFALRRFELALLSYLGYGVDFLHCAGSGEPVSDTMTYRYREEKGFIGSLVVD 179

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENF 232
                          +  DAD+LK+A + T     + AL+  +       RE F
Sbjct: 180 QLSFTGKQLKALASREFPDADTLKAAKRFT-----RLALKPYLGGKPLKSRELF 228


>gi|326402842|ref|YP_004282923.1| DNA repair protein RecO [Acidiphilium multivorum AIU301]
 gi|325049703|dbj|BAJ80041.1| DNA repair protein RecO [Acidiphilium multivorum AIU301]
          Length = 251

 Score =  118 bits (295), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 75/244 (30%), Positives = 113/244 (46%), Gaps = 4/244 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W + AI+L V ++GE ++   V+   +G   G  R G   R  PI Q GNL+   W +
Sbjct: 1   MEWSEPAIVLSVAAFGESDLRTIVLAETHGAWHGLARGGAGRRGAPIWQEGNLINARWVA 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGL-QSIVPLFRFLPEREPCLELYDMLNIFLN 119
           RL + LG    E++    A  ++  L L  L  +       LPERE     +  L   L 
Sbjct: 61  RLPEQLGSISGELVHPAAAIAMADPLALAVLRAACAVAAGALPEREAHRGAFIRLARLLG 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
              I        V+ EL LL+ +G+GLDL+ C ++G  +DL +VSP++G AV R     +
Sbjct: 121 GIGIAGTALPALVRFELELLRELGYGLDLSSCALSGAAEDLAFVSPRTGRAVARGAAGDW 180

Query: 180 AEKMLVLPSFLWKEEQTIDADSL---KSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKL 236
           A ++L LP+FL  E+   D   L   +    LT +FL + A           R     +L
Sbjct: 181 APRLLKLPAFLLDEDAADDEADLAACRDGLALTGHFLARDAFGARHAPLPTARLGLYDRL 240

Query: 237 LELI 240
              +
Sbjct: 241 TRRL 244


>gi|294637609|ref|ZP_06715889.1| DNA repair protein RecO [Edwardsiella tarda ATCC 23685]
 gi|291089239|gb|EFE21800.1| DNA repair protein RecO [Edwardsiella tarda ATCC 23685]
          Length = 243

 Score =  118 bits (295), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 43/234 (18%), Positives = 73/234 (31%), Gaps = 13/234 (5%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRS 60
           WQ  A +L  R Y E +++L+  T   GR     +  +S R   +  LQ    + + W  
Sbjct: 5   WQ-RAFVLHARPYSETSLLLDTFTEGQGRVRLLAKGARSRRSQLKGALQPFTPLLIRWGG 63

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           +                 A  LS      GL     L R L +      L+      +  
Sbjct: 64  KGEVKTLR---SAEAVSLALPLSGITLYSGLYVNELLARVLEQETCYSALFFDYLHCIQQ 120

Query: 121 HK-IPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                     +  + EL LL  +G+G+D   C  +G                  +  +  
Sbjct: 121 LAGHSGSPEPVLRRFELALLAQLGYGIDFLHCAGSGEPVADGMTYRYREEKGFIASLVVD 180

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENF 232
                          +  D  +L++A + T     + AL+  +       RE F
Sbjct: 181 QHSFTGRDLKALASREFPDVATLRAAKRFT-----RMALKPYLGGKPLKSRELF 229


>gi|307132116|ref|YP_003884132.1| gap repair protein [Dickeya dadantii 3937]
 gi|306529645|gb|ADM99575.1| gap repair protein [Dickeya dadantii 3937]
          Length = 244

 Score =  118 bits (295), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 47/237 (19%), Positives = 77/237 (32%), Gaps = 14/237 (5%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVN 57
           M  WQ  A +L  R Y E +++L++ +   GR     +  ++ R   +  LQ    + V 
Sbjct: 1   MEGWQ-RAFVLHGRPYSETSLLLDLFSENEGRVRVLAKGARARRSSLKGALQPFTPLLVR 59

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
           W  R                 A  LS  L   GL     L R L        L+      
Sbjct: 60  WGGRGEVKTLRNAEP---VSLALPLSGPLLYSGLYVNELLTRVLELETDYSALFFDYLHC 116

Query: 118 LNCH-KIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVG 176
           L               + EL LL+++G+G+D   C  +G                  +  
Sbjct: 117 LQQLAAASGSPEPALRRFELALLEHLGYGVDFLHCAGSGEPVADTMTYRYRAEKGFIASL 176

Query: 177 LPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENF 232
           +                 +  D D+L++A + T     + AL+  +       RE F
Sbjct: 177 VVDNVSFTGRELQALASREFPDIDTLRAAKRFT-----RMALKPYLGGKPLKSRELF 228


>gi|194017652|ref|ZP_03056262.1| DNA repair protein RecO [Bacillus pumilus ATCC 7061]
 gi|194010552|gb|EDW20124.1| DNA repair protein RecO [Bacillus pumilus ATCC 7061]
          Length = 256

 Score =  118 bits (295), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 36/179 (20%), Positives = 73/179 (40%), Gaps = 1/179 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M  + + I+L    YGE N I+ ++TR++G+     R  +    +    +   +   +  
Sbjct: 1   MLIKSEGIVLRTTDYGETNKIVTLLTREHGKIGVMARGAKKSNSRLSAISQPFLYGTFLI 60

Query: 61  RLAQNLGE-FRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLN 119
           + +  LG   + E++ES         L  Y       L +   E++P   L+++L   L 
Sbjct: 61  QSSTGLGTLQQGEMIESMRTIREDLFLTAYAAYMTELLDKGTEEKKPNPYLFELLLQSLR 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
                +    I   +E+ +L  +G   +L +CV  G  +     S +  G +C++    
Sbjct: 121 HLNEGTDADVILFIVEVKMLSVMGMKPELDQCVHCGQKEGQFHFSIRDNGFICQNCFSK 179


>gi|238759684|ref|ZP_04620844.1| DNA repair protein recO [Yersinia aldovae ATCC 35236]
 gi|238702112|gb|EEP94669.1| DNA repair protein recO [Yersinia aldovae ATCC 35236]
          Length = 244

 Score =  117 bits (294), Expect = 9e-25,   Method: Composition-based stats.
 Identities = 47/243 (19%), Positives = 81/243 (33%), Gaps = 14/243 (5%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVN 57
           M  WQ  A +L  R Y E +++L++ T   GR     +  +  R   +  LQ    + V 
Sbjct: 4   MEGWQ-RAFVLHGRPYSETSLMLDLFTEGEGRIRVLAKGARGRRSNLKGCLQPFTPLLVR 62

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
           W  R                 A  L+ S+   GL     L R L  +     L+      
Sbjct: 63  WAGRGEVKTLRSAEP---VSLALPLTGSMLYSGLYVNELLSRVLEHQTNYSALFFDYLHC 119

Query: 118 LNCHKIPS-VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVG 176
           L               Q EL +L ++G+G+D   C  +G                  +  
Sbjct: 120 LQALAGSDGSPEYALRQFELAILAHLGYGVDFLHCAGSGEAVADTMTYRYREEKGFIASL 179

Query: 177 LPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENFLGK 235
           +                 +  DA++L++A + T     + AL+  +       RE F   
Sbjct: 180 VVDHYSFTGRQLLALANREFPDAETLRAAKRFT-----RIALKPYLGGKPLKSRELFRQF 234

Query: 236 LLE 238
           +++
Sbjct: 235 VIK 237


>gi|157693027|ref|YP_001487489.1| DNA repair protein RecO [Bacillus pumilus SAFR-032]
 gi|166918728|sp|A8FFB2|RECO_BACP2 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|157681785|gb|ABV62929.1| DNA repair protein RecO [Bacillus pumilus SAFR-032]
          Length = 256

 Score =  117 bits (294), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 36/179 (20%), Positives = 73/179 (40%), Gaps = 1/179 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M  + + I+L    YGE N I+ ++TR++G+     R  +    +    +   +   +  
Sbjct: 1   MLIKSEGIVLRTTDYGETNKIVTLLTREHGKIGVMARGAKKSNSRLSAISQPFLYGTFLI 60

Query: 61  RLAQNLGE-FRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLN 119
           + +  LG   + E++ES         L  Y       L +   E++P   L+++L   L 
Sbjct: 61  QSSTGLGTLQQGEMIESMRTIREDLFLTAYAAYMTELLDKGTEEKKPNPYLFELLLQSLR 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
                +    I   +E+ +L  +G   +L +CV  G  +     S +  G +C++    
Sbjct: 121 HLNEGTDADIILFIVEVKMLSVMGMKPELDQCVHCGQKEGQFHFSIRDNGFICQNCFSK 179


>gi|21958064|gb|AAM84873.1|AE013732_5 recO protein [Yersinia pestis KIM 10]
 gi|45437170|gb|AAS62722.1| DNA repair protein [Yersinia pestis biovar Microtus str. 91001]
          Length = 243

 Score =  117 bits (294), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 49/240 (20%), Positives = 80/240 (33%), Gaps = 13/240 (5%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRS 60
           WQ  A +L  R Y E +++L++ T   GR     +  +  R   +  LQ    + V W  
Sbjct: 6   WQ-RAFVLHGRPYSETSLMLDLFTEGEGRMRVLAKGARGRRSNLKGCLQPFTPLLVRWSG 64

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           R                 A  LS S+   GL     L R L  +     L+      L  
Sbjct: 65  RGEVKTLRSAEP---VSLALPLSGSMLYSGLYVNELLSRVLEHQTSYSALFFDYLHCLQA 121

Query: 121 HKIPS-VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                        Q EL +L N+G+G+D   C  +G                  +  +  
Sbjct: 122 LAGSDGSPEHALRQFELAMLANLGYGVDFLHCAGSGQPVSDTMTYRYREEKGFIASLVVD 181

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENFLGKLLE 238
                          +  DAD+L++A + T     + AL+  +       RE F   +++
Sbjct: 182 HYSFTGRQLLALANREFPDADTLRAAKRFT-----RIALKPYLGGKPLKSRELFRQFVIK 236


>gi|51597204|ref|YP_071395.1| DNA repair protein RecO [Yersinia pseudotuberculosis IP 32953]
 gi|108808448|ref|YP_652364.1| DNA repair protein RecO [Yersinia pestis Antiqua]
 gi|108811371|ref|YP_647138.1| DNA repair protein RecO [Yersinia pestis Nepal516]
 gi|145598835|ref|YP_001162911.1| DNA repair protein RecO [Yersinia pestis Pestoides F]
 gi|149365388|ref|ZP_01887423.1| DNA repair protein [Yersinia pestis CA88-4125]
 gi|153948747|ref|YP_001400119.1| DNA repair protein RecO [Yersinia pseudotuberculosis IP 31758]
 gi|161484839|ref|NP_668622.2| DNA repair protein RecO [Yersinia pestis KIM 10]
 gi|161511351|ref|NP_993845.2| DNA repair protein RecO [Yersinia pestis biovar Microtus str.
           91001]
 gi|162420369|ref|YP_001607937.1| DNA repair protein RecO [Yersinia pestis Angola]
 gi|165925301|ref|ZP_02221133.1| DNA repair protein RecO [Yersinia pestis biovar Orientalis str.
           F1991016]
 gi|165937188|ref|ZP_02225753.1| DNA repair protein RecO [Yersinia pestis biovar Orientalis str.
           IP275]
 gi|166008243|ref|ZP_02229141.1| DNA repair protein RecO [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166212406|ref|ZP_02238441.1| DNA repair protein RecO [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|167399560|ref|ZP_02305084.1| DNA repair protein RecO [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167421237|ref|ZP_02312990.1| DNA repair protein RecO [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167423802|ref|ZP_02315555.1| DNA repair protein RecO [Yersinia pestis biovar Mediaevalis str.
           K1973002]
 gi|167467392|ref|ZP_02332096.1| DNA repair protein RecO [Yersinia pestis FV-1]
 gi|170023437|ref|YP_001719942.1| DNA repair protein RecO [Yersinia pseudotuberculosis YPIII]
 gi|186896301|ref|YP_001873413.1| DNA repair protein RecO [Yersinia pseudotuberculosis PB1/+]
 gi|218929792|ref|YP_002347667.1| DNA repair protein RecO [Yersinia pestis CO92]
 gi|229838283|ref|ZP_04458442.1| gap repair protein [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|229895521|ref|ZP_04510692.1| gap repair protein [Yersinia pestis Pestoides A]
 gi|229898847|ref|ZP_04513992.1| gap repair protein [Yersinia pestis biovar Orientalis str. India
           195]
 gi|229901621|ref|ZP_04516743.1| gap repair protein [Yersinia pestis Nepal516]
 gi|270489810|ref|ZP_06206884.1| DNA repair protein RecO [Yersinia pestis KIM D27]
 gi|294504511|ref|YP_003568573.1| DNA repair protein RecO [Yersinia pestis Z176003]
 gi|20139503|sp|Q8ZD70|RECO_YERPE RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|61214871|sp|Q667V3|RECO_YERPS RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|119361499|sp|Q1C553|RECO_YERPA RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|119361500|sp|Q1CKE2|RECO_YERPN RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|166221917|sp|A4TKX6|RECO_YERPP RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|166918733|sp|A7FFU1|RECO_YERP3 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|238687296|sp|A9R404|RECO_YERPG RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|238688564|sp|B1JRC9|RECO_YERPY RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|238691450|sp|B2KA45|RECO_YERPB RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|51590486|emb|CAH22126.1| DNA repair protein [Yersinia pseudotuberculosis IP 32953]
 gi|108775019|gb|ABG17538.1| DNA replication and repair protein RecO [Yersinia pestis Nepal516]
 gi|108780361|gb|ABG14419.1| DNA replication and repair protein RecO [Yersinia pestis Antiqua]
 gi|115348403|emb|CAL21339.1| DNA repair protein [Yersinia pestis CO92]
 gi|145210531|gb|ABP39938.1| DNA replication and repair protein RecO [Yersinia pestis Pestoides
           F]
 gi|149291801|gb|EDM41875.1| DNA repair protein [Yersinia pestis CA88-4125]
 gi|152960242|gb|ABS47703.1| DNA repair protein RecO [Yersinia pseudotuberculosis IP 31758]
 gi|162353184|gb|ABX87132.1| DNA repair protein RecO [Yersinia pestis Angola]
 gi|165915051|gb|EDR33663.1| DNA repair protein RecO [Yersinia pestis biovar Orientalis str.
           IP275]
 gi|165922908|gb|EDR40059.1| DNA repair protein RecO [Yersinia pestis biovar Orientalis str.
           F1991016]
 gi|165992625|gb|EDR44926.1| DNA repair protein RecO [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166206337|gb|EDR50817.1| DNA repair protein RecO [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|166960726|gb|EDR56747.1| DNA repair protein RecO [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167052064|gb|EDR63472.1| DNA repair protein RecO [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167057972|gb|EDR67718.1| DNA repair protein RecO [Yersinia pestis biovar Mediaevalis str.
           K1973002]
 gi|169749971|gb|ACA67489.1| DNA repair protein RecO [Yersinia pseudotuberculosis YPIII]
 gi|186699327|gb|ACC89956.1| DNA repair protein RecO [Yersinia pseudotuberculosis PB1/+]
 gi|229681550|gb|EEO77644.1| gap repair protein [Yersinia pestis Nepal516]
 gi|229688395|gb|EEO80466.1| gap repair protein [Yersinia pestis biovar Orientalis str. India
           195]
 gi|229694649|gb|EEO84696.1| gap repair protein [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|229701327|gb|EEO89355.1| gap repair protein [Yersinia pestis Pestoides A]
 gi|262362497|gb|ACY59218.1| DNA repair protein RecO [Yersinia pestis D106004]
 gi|262366498|gb|ACY63055.1| DNA repair protein RecO [Yersinia pestis D182038]
 gi|270338314|gb|EFA49091.1| DNA repair protein RecO [Yersinia pestis KIM D27]
 gi|294354970|gb|ADE65311.1| DNA repair protein RecO [Yersinia pestis Z176003]
 gi|320016073|gb|ADV99644.1| gap repair protein [Yersinia pestis biovar Medievalis str. Harbin
           35]
          Length = 241

 Score =  117 bits (294), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 49/240 (20%), Positives = 80/240 (33%), Gaps = 13/240 (5%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRS 60
           WQ  A +L  R Y E +++L++ T   GR     +  +  R   +  LQ    + V W  
Sbjct: 4   WQ-RAFVLHGRPYSETSLMLDLFTEGEGRMRVLAKGARGRRSNLKGCLQPFTPLLVRWSG 62

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           R                 A  LS S+   GL     L R L  +     L+      L  
Sbjct: 63  RGEVKTLRSAEP---VSLALPLSGSMLYSGLYVNELLSRVLEHQTSYSALFFDYLHCLQA 119

Query: 121 HKIPS-VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                        Q EL +L N+G+G+D   C  +G                  +  +  
Sbjct: 120 LAGSDGSPEHALRQFELAMLANLGYGVDFLHCAGSGQPVSDTMTYRYREEKGFIASLVVD 179

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENFLGKLLE 238
                          +  DAD+L++A + T     + AL+  +       RE F   +++
Sbjct: 180 HYSFTGRQLLALANREFPDADTLRAAKRFT-----RIALKPYLGGKPLKSRELFRQFVIK 234


>gi|109900011|ref|YP_663266.1| DNA repair protein RecO [Pseudoalteromonas atlantica T6c]
 gi|119361472|sp|Q15PH6|RECO_PSEA6 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|109702292|gb|ABG42212.1| DNA replication and repair protein RecO [Pseudoalteromonas
           atlantica T6c]
          Length = 240

 Score =  117 bits (293), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 43/229 (18%), Positives = 76/229 (33%), Gaps = 11/229 (4%)

Query: 7   AIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNWRSRLAQ 64
             +L  R+Y E + ++ + T + G+    V+  +  +   + +LQ    + +    R   
Sbjct: 8   GYVLHRRAYRETSFLVNIFTLENGKVSAVVKGVRGSKSDKKSLLQPFQPLLIGVSGRSEL 67

Query: 65  NLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIP 124
              +             L+       L     L R L +  P  E++ +    ++     
Sbjct: 68  KNLQQVEST---GAMIRLAGQALYCALYLNEVLNRVLADEIPHPEIFVLYQQSMHALVAQ 124

Query: 125 SVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKML 184
           +    +    EL LL  +G+G+DLT    TG                C   G        
Sbjct: 125 TNFEPVLRSFELGLLDALGYGIDLTHDADTGQPVADNGYYRIVPELGCVYQGDIRLSGCY 184

Query: 185 VLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHL-LRENF 232
              S L    +  D DSL +A  +T     +  L   +    L  RE F
Sbjct: 185 SGQSLLNVASENWDKDSLLAAKHIT-----RTTLGELLGSKPLMSRELF 228


>gi|212710661|ref|ZP_03318789.1| hypothetical protein PROVALCAL_01727 [Providencia alcalifaciens DSM
           30120]
 gi|212686742|gb|EEB46270.1| hypothetical protein PROVALCAL_01727 [Providencia alcalifaciens DSM
           30120]
          Length = 241

 Score =  117 bits (293), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 45/239 (18%), Positives = 77/239 (32%), Gaps = 13/239 (5%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRS 60
           WQ  A +L  R Y E +++++  T   G+     +  + +R   +  LQ    + + W  
Sbjct: 4   WQ-RAFVLHSRPYSETSLLIDFFTEGEGKIRLLAKGARRNRSPLRGCLQPFTPLLIRWSG 62

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           +                 A  LS ++   GL       R +    P   L+      L  
Sbjct: 63  KGEIKTLINADP---VSLALPLSGTVLYSGLYLNELTARVIEFGTPYSSLFFDYLNCLQV 119

Query: 121 HK-IPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                        Q EL LL  +G+G+D   C  +G                     +  
Sbjct: 120 LAGSERTPESALRQFELALLSYLGYGVDFLHCAGSGEPVTDAMTYRYREEKGFIGSLVID 179

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENFLGKLL 237
                        E +  DAD+LK+A + T     + AL+  +       RE F   ++
Sbjct: 180 QLTFTGKQLKALAEREFPDADTLKAAKRFT-----RIALKPYLGGKPLKSRELFRQFII 233


>gi|251788700|ref|YP_003003421.1| DNA repair protein RecO [Dickeya zeae Ech1591]
 gi|247537321|gb|ACT05942.1| DNA repair protein RecO [Dickeya zeae Ech1591]
          Length = 244

 Score =  117 bits (293), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 47/237 (19%), Positives = 79/237 (33%), Gaps = 14/237 (5%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVN 57
           M  WQ  A +L  R Y E +++L++ +   GR     +  ++ R   +  LQ    + V 
Sbjct: 1   MEGWQ-RAFVLHGRPYSETSLLLDLFSEDEGRVRVLAKGARARRSSLKGALQPFTPLLVR 59

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
           W  R                 A  LS SL   GL     L R L        L+      
Sbjct: 60  WGGRGEVKTLRNAEP---VSLALPLSGSLLYSGLYVNELLTRVLELETNYSALFFDYLHC 116

Query: 118 LNCHKIPS-VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVG 176
           L      +        + EL LL+++G+G+D   C  +G                  +  
Sbjct: 117 LQQLAAANGSPEPALRRFELALLEHLGYGVDFLHCAGSGEPVADTMTYRYRSEKGFIASL 176

Query: 177 LPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENF 232
           +                 +  D ++L++A + T     + AL+  +       RE F
Sbjct: 177 VVDNVSFTGRELQALASREFPDIETLRAAKRFT-----RMALKPYLGGKPLKSRELF 228


>gi|59712692|ref|YP_205468.1| DNA repair protein RecO [Vibrio fischeri ES114]
 gi|197335983|ref|YP_002156884.1| DNA repair protein RecO [Vibrio fischeri MJ11]
 gi|67461219|sp|Q5E316|RECO_VIBF1 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|238690260|sp|B5FAG8|RECO_VIBFM RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|59480793|gb|AAW86580.1| gap repair protein [Vibrio fischeri ES114]
 gi|197317473|gb|ACH66920.1| DNA repair protein RecO [Vibrio fischeri MJ11]
          Length = 238

 Score =  117 bits (293), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 42/237 (17%), Positives = 80/237 (33%), Gaps = 12/237 (5%)

Query: 8   IILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLAQN 65
            +L  R Y E ++IL+V + +YGR     +  +S R   + +LQA   + + W  + +  
Sbjct: 9   FVLHRRPYSESSLILDVFSEEYGRLSIISKGARSKRSNLKGVLQAFTPLLMKWSGKGS-- 66

Query: 66  LGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPS 125
                 +         L+       +     L R + +  P   L+      L      +
Sbjct: 67  -MRTLRQAETISLGIPLTGINLYSAMYINELLVRVVEQETPYPALFLDYLTALTELAQST 125

Query: 126 VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKMLV 185
                  + EL LL  +G+G+D   C  +G                  +           
Sbjct: 126 NPEPALRRFELALLSAMGYGVDFLHCAGSGEMVSPEMTYRYREQQGFMASIRHDPLMSFK 185

Query: 186 LPSFL-WKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENFLGKLLELI 240
               +   E +    + LK+A + T     + AL+  +       RE FL +   ++
Sbjct: 186 GNELIAISERRFTTPEQLKAAKRFT-----RIALKPYLGGKPLKSRELFLPRTRSIL 237


>gi|170767492|ref|ZP_02901945.1| DNA repair protein RecO [Escherichia albertii TW07627]
 gi|170123826|gb|EDS92757.1| DNA repair protein RecO [Escherichia albertii TW07627]
          Length = 243

 Score =  117 bits (292), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 47/237 (19%), Positives = 82/237 (34%), Gaps = 14/237 (5%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVN 57
           M  WQ  A +L  R + E +++L+V T + GR     +  +S R   +  LQ    + + 
Sbjct: 2   MEGWQ-RAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKRSTLKGALQPFTPLLLR 60

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
           +  R      +          A  LS      GL     L R L       EL+      
Sbjct: 61  FGGRGE---IKTLRSAEAVSLALPLSGITLYSGLYINELLSRVLEYETRFSELFFDYLHC 117

Query: 118 LNCHKIPS-VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVG 176
           +      +        + EL LL ++G+G++   C  +G   D              +  
Sbjct: 118 IQSLAGATGTPEPALRRFELALLGHLGYGVNFMHCAGSGEPVDDTMTYRYREEKGFIASV 177

Query: 177 LPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENF 232
           +   +             +  DAD+L++A + T     + AL+  +       RE F
Sbjct: 178 VIDNKTFTGRQLKALHAREFPDADTLRAAKRFT-----RMALKPYLGGKPLKSRELF 229


>gi|271501619|ref|YP_003334645.1| DNA repair protein RecO [Dickeya dadantii Ech586]
 gi|270345174|gb|ACZ77939.1| DNA repair protein RecO [Dickeya dadantii Ech586]
          Length = 244

 Score =  117 bits (292), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 48/237 (20%), Positives = 79/237 (33%), Gaps = 14/237 (5%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVN 57
           M  WQ  A +L  R Y E +++L++ +   GR     +  ++ R   +  LQ    + V 
Sbjct: 1   MEGWQ-RAFVLHGRPYSETSLLLDLFSENEGRVRVLAKGARARRSSLKGALQPFTPLLVR 59

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
           W  R                 A  LS SL   GL     L R L        L+      
Sbjct: 60  WGGRGEVKTLRNAEP---VSLALPLSGSLLYSGLYVNELLTRVLELETNYSALFFDYLHC 116

Query: 118 LNCHKIPS-VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVG 176
           L      +        + EL LL+++G+G+D   C  +G                  +  
Sbjct: 117 LQQLAGTNGSPEPALRRFELALLEHLGYGVDFLHCAGSGEPVADTMTYRYRSEKGFIASL 176

Query: 177 LPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENF 232
           +                 +  D D+L++A + T     + AL+  +       RE F
Sbjct: 177 VVDNVSFTGRELQALASREFPDTDTLRAAKRFT-----RMALKPYLGGKPLKSRELF 228


>gi|308187804|ref|YP_003931935.1| DNA repair protein recO (Recombination protein O) [Pantoea vagans
           C9-1]
 gi|308058314|gb|ADO10486.1| DNA repair protein recO (Recombination protein O) [Pantoea vagans
           C9-1]
          Length = 259

 Score =  117 bits (292), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 52/238 (21%), Positives = 85/238 (35%), Gaps = 16/238 (6%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVN 57
           M  WQ  A +L  R + E +++L++ +   GR     +  +S R   +  LQ    + V 
Sbjct: 18  MEGWQ-RAFVLHSRPFSETSLLLDLFSENEGRVRVLAKGARSRRSQLKGALQPFTPLLVR 76

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
           W  R                 A  LS      GL     + R L    P  EL+      
Sbjct: 77  WSGRGDVKTLRNAEA---VSLALPLSGITLYCGLYVNELVSRVLQPESPFQELFFDYLNC 133

Query: 118 LNCHKIPS-VIGKIFVQIELMLLKNIGFGLDLTKCVVTGV-TQDLLWVSPKSGGAVCRSV 175
           L               + EL LL ++G+G+D   C  +G    D +  S +       S+
Sbjct: 134 LQALASTHGKPEPALRRFELALLGHLGYGVDFLHCAGSGEPVSDDMTYSYREERGFIASL 193

Query: 176 GLPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENF 232
            +            L  E +  DAD+L++A + T     + AL+  +       +E F
Sbjct: 194 VVNQRSFTGRELHALC-EREFPDADTLRAAKRFT-----RIALKPYLGGKPLKSQELF 245


>gi|322834125|ref|YP_004214152.1| DNA repair protein RecO [Rahnella sp. Y9602]
 gi|321169326|gb|ADW75025.1| DNA repair protein RecO [Rahnella sp. Y9602]
          Length = 245

 Score =  116 bits (291), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 46/237 (19%), Positives = 75/237 (31%), Gaps = 14/237 (5%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVN 57
           M  WQ  A +L  R Y E +++L++ T   GR     +  +  R   +  LQ    + V 
Sbjct: 1   MEGWQ-RAFVLHGRPYSETSLMLDLFTEGQGRVRILAKGARGRRSNLKGCLQPFTPLLVR 59

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
           W  R                 A  LS  +   GL     + R L +      L+      
Sbjct: 60  WSGRGEVKTLRNAEP---VSLALPLSGLMLYSGLYVNELVSRVLEQEANYSSLFFDYLNC 116

Query: 118 LNCHKI-PSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVG 176
           L               Q EL LL ++G+G+D   C  +G                  +  
Sbjct: 117 LQNLASASGSPEYALRQFELSLLHHLGYGVDFLHCAGSGEEVSDTMTYRYREEKGFIASL 176

Query: 177 LPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENF 232
           +                 +  D  +L++A + T     + AL+  +       RE F
Sbjct: 177 VIDNSSFTGRDLKALASREFPDVSTLRAAKRFT-----RMALKPYLGGKPLKSRELF 228


>gi|240949698|ref|ZP_04754033.1| DNA repair protein RecO [Actinobacillus minor NM305]
 gi|240295956|gb|EER46632.1| DNA repair protein RecO [Actinobacillus minor NM305]
          Length = 241

 Score =  116 bits (290), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 43/239 (17%), Positives = 80/239 (33%), Gaps = 13/239 (5%)

Query: 2   YWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWR 59
            WQ    +L  R Y E ++++++ T  YGR     +  +  R   + +LQ    + + W 
Sbjct: 5   QWQ-RGFVLHKREYSETSLLVDLFTENYGRITLLAKGARRPRSPLKALLQPFTPLLLRWS 63

Query: 60  SRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLN 119
            +    +     +V  +     +++     G      L R L  +    EL+      + 
Sbjct: 64  GKGDLKV---LTKVEAAALTLPMNTKALYSGFYINEVLVRVLENQTAYQELFHHYLQCVT 120

Query: 120 CHK-IPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
                   +  I    E  +LK +G+G+D T C+ TG+  D                 L 
Sbjct: 121 HLALRSEELEPILRTFEFHVLKALGYGVDFTHCMATGLEVDPEMTYQFRENEG-FIASLL 179

Query: 179 YAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENFLGKL 236
                 +    L          S++ A +       + AL+  +       RE F   L
Sbjct: 180 QNNLSFLGKDLLAFAALDFSEKSVQQAAKR----FTRIALKPYLGSQPLKSRELFQSIL 234


>gi|161702946|ref|YP_303133.2| DNA repair protein RecO [Ehrlichia canis str. Jake]
          Length = 244

 Score =  116 bits (290), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 71/242 (29%), Positives = 123/242 (50%), Gaps = 8/242 (3%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M WQD  I++ +R YG+  II+ + T+++G   G  R  +    +  LQ G+ V V W +
Sbjct: 1   MRWQDQGIVIAIRKYGDDQIIISIFTQKHGLKKGLARYQKKTIHR--LQIGDHVNVTWSA 58

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGL-QSIVPLFRFLPEREPCLELYDMLNIFLN 119
           +L  NLG F++E+++S     + ++L    +      L + LPE E    +Y+ L+IF+N
Sbjct: 59  KLISNLGYFKYEIIKSTLHHYIHNNLKTMCIAFFTSILDQVLPENEENYTIYNHLDIFMN 118

Query: 120 CH-KIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
                       ++ +EL LL  +GFGLDL++C V    ++L+++SPK+G A+ ++VGLP
Sbjct: 119 SVQNKDVNWQIKYLTLELTLLSELGFGLDLSQCAVNNTNENLIFISPKTGKAISQTVGLP 178

Query: 179 YAE----KMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLG 234
           Y +       +L +              K +  +T YFL K+ L    I     R+  + 
Sbjct: 179 YKKSLLPLPPLLYNVYNNYTYKYSKTDFKVSLNVTGYFLKKHFLTEKNITLIKYRDEIIK 238

Query: 235 KL 236
            +
Sbjct: 239 LI 240


>gi|300717985|ref|YP_003742788.1| DNA repair protein [Erwinia billingiae Eb661]
 gi|299063821|emb|CAX60941.1| DNA repair protein [Erwinia billingiae Eb661]
          Length = 244

 Score =  116 bits (290), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 47/237 (19%), Positives = 79/237 (33%), Gaps = 14/237 (5%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVN 57
           M  WQ  A +L  R Y E +++L++ +  YGR     +  +  R   +  LQ    + V 
Sbjct: 1   MEGWQ-RAFVLHGRPYSETSLLLDLFSENYGRIRVLAKGARGKRSSLKGALQPFTPLLVR 59

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
           W  R                 A  LS      GL     L R L +     EL+      
Sbjct: 60  WGGRGEVKTLRGAEP---ISLALPLSGLTLYCGLYVNELLSRVLEQETAFTELFFDYLYC 116

Query: 118 LNCH-KIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVG 176
           L     +         + EL +L ++G+G+D   C  +G                  +  
Sbjct: 117 LQALAAVTGSPEPALRRFELAMLGHLGYGVDFMHCAGSGEEVADGMTYTYRAEKGFIASL 176

Query: 177 LPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENF 232
           +              +E    D D+L++A + T     + AL+  +       +E F
Sbjct: 177 VMGNNTFTGRQLRALEERSFPDIDTLRAAKRFT-----RIALKPYLGGKPLKSQELF 228


>gi|304398618|ref|ZP_07380490.1| DNA repair protein RecO [Pantoea sp. aB]
 gi|304353829|gb|EFM18204.1| DNA repair protein RecO [Pantoea sp. aB]
          Length = 242

 Score =  116 bits (290), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 52/238 (21%), Positives = 86/238 (36%), Gaps = 16/238 (6%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVN 57
           M  WQ  A +L  R + E +++L++ +   GR     +  +S R   +  LQ    + V 
Sbjct: 1   MEGWQ-RAFVLHSRPFSETSLLLDLFSESEGRVRVLAKGARSRRSNLKGALQPFTPLLVR 59

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
           W  R                 A  LS      GL     + R L +  P  EL+      
Sbjct: 60  WSGRGEVKTLRNAEA---VSLALPLSGITLYCGLYVNELVSRVLQQESPFPELFFDYLNC 116

Query: 118 LNCHKIPS-VIGKIFVQIELMLLKNIGFGLDLTKCVVTGV-TQDLLWVSPKSGGAVCRSV 175
           L               + EL LL ++G+G+D   C  +G    D +  S +       S+
Sbjct: 117 LQALASTHGKPEPALRRFELALLGHLGYGVDFLHCAGSGEPVSDDMTYSYREERGFIASL 176

Query: 176 GLPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENF 232
            +            L  E +  DAD+L++A + T     + AL+  +       +E F
Sbjct: 177 VVNNRSFTGRELHALC-EREFPDADTLRAAKRFT-----RIALKPYLGGKPLKSQELF 228


>gi|261345439|ref|ZP_05973083.1| DNA repair protein RecO [Providencia rustigianii DSM 4541]
 gi|282566486|gb|EFB72021.1| DNA repair protein RecO [Providencia rustigianii DSM 4541]
          Length = 243

 Score =  116 bits (290), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 49/235 (20%), Positives = 79/235 (33%), Gaps = 15/235 (6%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRS 60
           WQ  A +L  R Y E +++L+  T   G+     +  + +R   +  LQ    + + W  
Sbjct: 4   WQ-RAFVLHSRPYSETSLLLDFFTEGEGKIRLLAKGARRNRSPLRGCLQPFTPLLIRWGG 62

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           +                 A  LS ++   GL       R L    P   L+      L  
Sbjct: 63  KGEIKTLINADP---VSLALPLSGTVLYSGLYLNELTARVLEFGTPYSALFFDYLSCLQV 119

Query: 121 HK-IPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGV-TQDLLWVSPKSGGAVCRSVGLP 178
                        Q EL LL  +G+G+D   C  +G    D +    +       S+ + 
Sbjct: 120 LAGSERTPESALRQFELALLSYLGYGVDFLHCAGSGEPVSDTMTYRYREEKGFIGSLVID 179

Query: 179 YAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENF 232
                      L       DAD+LK+A + T     + AL+  +       RE F
Sbjct: 180 QFSFTGKQLKALA-SRDFPDADTLKAAKRFT-----RMALKPYLGGKPLKSRELF 228


>gi|257464704|ref|ZP_05629075.1| DNA repair protein RecO [Actinobacillus minor 202]
 gi|257450364|gb|EEV24407.1| DNA repair protein RecO [Actinobacillus minor 202]
          Length = 241

 Score =  116 bits (289), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 43/239 (17%), Positives = 80/239 (33%), Gaps = 13/239 (5%)

Query: 2   YWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWR 59
            WQ    +L  R Y E ++++++ T  YGR     +  +  R   + +LQ    + + W 
Sbjct: 5   QWQ-RGFVLHKREYSETSLLVDLFTENYGRITLLAKGARRPRSPLKALLQPFTPLLLRWS 63

Query: 60  SRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLN 119
            +    +     +V  +     +++     G      L R L  +    EL+      + 
Sbjct: 64  GKGDLKV---LTKVEAAALTLPMNTKALYSGFYINEVLVRVLENQTAYQELFHHYLQCVT 120

Query: 120 CHK-IPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
                   +  I    E  +LK +G+G+D T C+ TG+  D                 L 
Sbjct: 121 HLALRSEELEPILRTFEFHVLKALGYGVDFTHCMATGLDVDPEMTYQFRENEG-FIASLL 179

Query: 179 YAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENFLGKL 236
                 +    L          S++ A +       + AL+  +       RE F   L
Sbjct: 180 QNNLSFLGKDLLAFAALDFSEKSVQQAAKR----FTRIALKPYLGSQPLKSRELFQSIL 234


>gi|88812351|ref|ZP_01127601.1| Recombination protein O, RecO [Nitrococcus mobilis Nb-231]
 gi|88790358|gb|EAR21475.1| Recombination protein O, RecO [Nitrococcus mobilis Nb-231]
          Length = 249

 Score =  116 bits (289), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 43/235 (18%), Positives = 74/235 (31%), Gaps = 11/235 (4%)

Query: 5   DDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRL 62
           + A +L  R+Y E + I E+ T ++GR     R  +S R   + +LQ    + V+W++R 
Sbjct: 11  EPAYVLHRRAYRESSAIAELFTAEHGRLGVVARGVRSSRSRWRALLQPFTPLSVSWQARG 70

Query: 63  AQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHK 122
                        S           + G      L R L   +P  EL+      +    
Sbjct: 71  DLGTLTDVELQWRSTLPT---GRRLVSGFYLNELLLRVLQREDPYPELFQCYAGAVLMLA 127

Query: 123 IPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEK 182
                  +    E  LL  +G+GL L+        +   W   +                
Sbjct: 128 SRGAEQPLLRCFERDLLAAMGYGLLLSHDADGSPIEPQRWYRYEIDKGAVPVTAPRGRLV 187

Query: 183 MLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENFLGKL 236
           +              +A     A Q     L + AL+ ++       RE +   L
Sbjct: 188 VQGATLSALASGVFPNAGVEVQARQ-----LMRAALRPHVGERPLKSRELYAQYL 237


>gi|238788222|ref|ZP_04632017.1| DNA repair protein recO [Yersinia frederiksenii ATCC 33641]
 gi|238723809|gb|EEQ15454.1| DNA repair protein recO [Yersinia frederiksenii ATCC 33641]
          Length = 241

 Score =  116 bits (289), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 49/243 (20%), Positives = 81/243 (33%), Gaps = 14/243 (5%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVN 57
           M  WQ  A +L  R Y E +++L++ T   GR     +  +  R   +  LQ    + V 
Sbjct: 1   MEGWQ-RAFVLHGRPYSETSLMLDLFTEGEGRMRVLAKGARGRRSNLKGCLQPFTPLLVR 59

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
           W  R                 A  LS S+   GL     L R L  +     L+      
Sbjct: 60  WTGRGEVKTLRSAEP---VSLALPLSGSMLYSGLYVNELLSRVLEHQTNYSALFFDYLHC 116

Query: 118 LNCHKIPS-VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVG 176
           L               Q EL +L ++G+G+D   C  +G                  +  
Sbjct: 117 LQSLAGSDGSPEYALRQFELAILAHLGYGVDFLHCAGSGQPVSDSMTYRYREEKGFIASL 176

Query: 177 LPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENFLGK 235
           +                 +  DAD+L++A + T     + AL+  +       RE F   
Sbjct: 177 VVDHYSFTGRQLLALANREFPDADTLRAAKRFT-----RIALKPYLGGKPLKSRELFRQF 231

Query: 236 LLE 238
           +++
Sbjct: 232 VIK 234


>gi|238762799|ref|ZP_04623768.1| DNA repair protein recO [Yersinia kristensenii ATCC 33638]
 gi|238699104|gb|EEP91852.1| DNA repair protein recO [Yersinia kristensenii ATCC 33638]
          Length = 241

 Score =  116 bits (289), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 48/243 (19%), Positives = 81/243 (33%), Gaps = 14/243 (5%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVN 57
           M  WQ  A +L  R Y E +++L++ T   GR     +  +  R   +  LQ    + V 
Sbjct: 1   MEGWQ-RAFVLHGRPYSETSLMLDLFTEGEGRMRVLAKGARGRRSNLKGCLQPFTPLLVR 59

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
           W  R                 A  L+ S+   GL     L R L  +     L+      
Sbjct: 60  WTGRGEVKTLRSAEP---VSLALPLTGSMLYSGLYVNELLARVLEHQTNYSALFFDYLHC 116

Query: 118 LNCHKIPS-VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVG 176
           L               Q EL +L ++G+G+D   C  +G                  +  
Sbjct: 117 LQSLAGSDGSPEYALRQFELAILAHLGYGVDFLHCAGSGQPVSDSMTYRYREEKGFIASL 176

Query: 177 LPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENFLGK 235
           +                 +  DAD+L++A + T     + AL+  +       RE F   
Sbjct: 177 VVDHYSFTGRQLLALANREFPDADTLRAAKRFT-----RIALKPYLGGKPLKSRELFRQF 231

Query: 236 LLE 238
           +++
Sbjct: 232 VIK 234


>gi|213161853|ref|ZP_03347563.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Typhi str. E00-7866]
          Length = 221

 Score =  116 bits (289), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 43/218 (19%), Positives = 73/218 (33%), Gaps = 8/218 (3%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVN 57
           M  WQ  A +L  R + E +++L+V T + GR     +  +S R   +  LQ    + + 
Sbjct: 1   MEGWQ-RAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKRSNLKGALQPFTPLLLR 59

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
           +  R                 A  LS      GL     L R L       EL+      
Sbjct: 60  YSGRGEVKTLR---SAEAVSLALPLSGITLYSGLYINELLSRVLEYETRFSELFFDYLNC 116

Query: 118 LNCHK-IPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVG 176
           +               + EL LL ++G+G++ T C  +G   D              +  
Sbjct: 117 IQALAGTTGSPEPALRRFELALLGHLGYGVNFTHCAGSGERVDDTMTYRYREEKGFFASV 176

Query: 177 LPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLN 214
           +              +  +  D D+L++A + T   L 
Sbjct: 177 VIDNNTFTGRHLKALEAREFPDVDTLRAAKRFTRMALK 214


>gi|123441365|ref|YP_001005352.1| DNA repair protein RecO [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|166221916|sp|A1JKK5|RECO_YERE8 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|122088326|emb|CAL11117.1| DNA repair protein [Yersinia enterocolitica subsp. enterocolitica
           8081]
          Length = 241

 Score =  115 bits (288), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 48/243 (19%), Positives = 81/243 (33%), Gaps = 14/243 (5%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVN 57
           M  WQ  A +L  R Y E +++L++ T   GR     +  +  R   +  LQ    + V 
Sbjct: 1   MEGWQ-RAFVLHGRPYSETSLMLDLFTEGEGRMRVLAKGARGRRSNLKGCLQPFTPLLVR 59

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
           W  R                 A  L+ S+   GL     L R L  +     L+      
Sbjct: 60  WTGRGEVKTLRSAEP---VSLALPLTGSMLYSGLYVNELLSRVLEHQTNYSALFFDYLHC 116

Query: 118 LNCHKIPS-VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVG 176
           L               Q EL +L ++G+G+D   C  +G                  +  
Sbjct: 117 LQSLAGSDGSPEYALRQFELAILAHLGYGVDFLHCAGSGQPVSDTMTYRYREEKGFIASL 176

Query: 177 LPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENFLGK 235
           +                 +  DAD+L++A + T     + AL+  +       RE F   
Sbjct: 177 VVDHYSFTGRQLLALANREFPDADTLRAAKRFT-----RIALKPYLGGKPLKSRELFRQF 231

Query: 236 LLE 238
           +++
Sbjct: 232 VIK 234


>gi|134095251|ref|YP_001100326.1| DNA repair protein RecO [Herminiimonas arsenicoxydans]
 gi|133739154|emb|CAL62203.1| DNA repair protein recO (Recombination protein O) [Herminiimonas
           arsenicoxydans]
          Length = 284

 Score =  115 bits (288), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 38/235 (16%), Positives = 70/235 (29%), Gaps = 12/235 (5%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQS--HRMQPILQAGNLVRVNWRSRLA 63
              +L    Y E ++I++V TR +GR     +  +    +++ +LQ    + V+W  +  
Sbjct: 56  PGFVLHSYPYKETSLIVDVFTRDHGRIALVAKGAKRPHSKLRGVLQTFQPLSVSWSGKAE 115

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKI 123
                             L  S  L G      L + L   +    L++     LN    
Sbjct: 116 VRT---LTSAEWVGGLLPLEKSALLCGFYLNELLVKLLARDDSHPALFNHYVSALNQLAH 172

Query: 124 PSVIGKIFVQIELMLLKNIGFGLDLTKC-VVTGVTQDLLWVSPKSGGAVCRSVGLPYAEK 182
                 +  + E  LLK  G   D   C          +            +        
Sbjct: 173 DEPAAIVLRKFERALLKESGVSGDWKICTATRNPLLGGINYVVDPERGPRPARPADTWPH 232

Query: 183 MLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHN-IIHCHLLRENFLGKL 236
           +        ++E   DA +          FL ++ L H+        R+  +  L
Sbjct: 233 VAGKTLLDMEKEDYSDAATQMQ-----SKFLMRFLLAHHLNGAPLNTRQILIDLL 282


>gi|17545784|ref|NP_519186.1| DNA repair protein RecO [Ralstonia solanacearum GMI1000]
 gi|20139464|sp|Q8Y0H9|RECO_RALSO RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|17428078|emb|CAD14767.1| probable dna repair protein reco (recombination protein o)
           [Ralstonia solanacearum GMI1000]
 gi|299067033|emb|CBJ38228.1| DNA repair protein recO (Recombination protein O) [Ralstonia
           solanacearum CMR15]
          Length = 272

 Score =  115 bits (288), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 42/235 (17%), Positives = 73/235 (31%), Gaps = 9/235 (3%)

Query: 4   QDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSR 61
           Q  A +L    Y E ++I++V TR +GR     +  +      + +LQ    + ++W  R
Sbjct: 41  QQPAFVLHSYPYRETSLIIDVFTRDHGRIALVAKGAKRPHSALRAVLQTFQPLSLSWSGR 100

Query: 62  LAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCH 121
                               L     L G      L +F+   +    L+      LN  
Sbjct: 101 GEVKT---LTRAEWVGGMLPLGGEGLLSGFYLNELLVKFVAREDGHPVLFSHYVETLNKL 157

Query: 122 KIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRS-VGLPYA 180
                +       E +LL+  GF   L +CV     Q            + R+    P +
Sbjct: 158 AHGEPVAFTLRAFERVLLRETGFAAQLDRCVDGEPVQPDGDYVYHPERGIRRALPSDPSS 217

Query: 181 EKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGK 235
             +L   + L  E       +  +  +    FL  Y L          R+  +  
Sbjct: 218 WPVLRGQTLLDMERDDYSRPATATQSRSLMRFLLHYHL---HGTPLSTRQILIDL 269


>gi|149910153|ref|ZP_01898799.1| DNA repair protein RecO [Moritella sp. PE36]
 gi|149806739|gb|EDM66703.1| DNA repair protein RecO [Moritella sp. PE36]
          Length = 242

 Score =  115 bits (288), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 39/236 (16%), Positives = 78/236 (33%), Gaps = 12/236 (5%)

Query: 7   AIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLAQ 64
           A +L  R + E +++++  T   G+     R G+  +     ILQ   L+ + +  +   
Sbjct: 6   AFVLHRRPFKESSLLIDFFTINDGKISLVGRAGRGRKNSQSAILQPFTLLNIAYAGKGGL 65

Query: 65  NLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIP 124
                   V  S     LS             L+R L   +   EL+      L      
Sbjct: 66  KSMRQVEAVSNSLP---LSGRHLYASFYLNELLYRLLASEQANPELFSHYQNALLALAKQ 122

Query: 125 SVIGKIFVQIELMLLKNIGFGLDLTKCVV-TGVTQDLLWVSPKSGGAVCRSVGLPYAEKM 183
             +  +  + E  L++ +G+   L+ C                    +  S+        
Sbjct: 123 QPLEPLLREFEFNLMQCLGYIGALSYCADTMDAVFPERMYKYVPHVGIVPSIYKVAVGHS 182

Query: 184 LVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENFLGKLLE 238
            +    L  E++  + D+L +A +       +  L   + +     RE F+ K L+
Sbjct: 183 FLGADLLAFEQRQFNQDNLAAAKRFC-----RQMLLPYLGNKPLKSRELFINKPLK 233


>gi|238784189|ref|ZP_04628202.1| DNA repair protein recO [Yersinia bercovieri ATCC 43970]
 gi|238714898|gb|EEQ06897.1| DNA repair protein recO [Yersinia bercovieri ATCC 43970]
          Length = 241

 Score =  115 bits (287), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 50/241 (20%), Positives = 80/241 (33%), Gaps = 15/241 (6%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRS 60
           WQ  A +L  R Y E +++L++ T   GR     +  +  R   +  LQ    + V W  
Sbjct: 4   WQ-RAFVLHGRPYSETSLMLDLFTEGEGRMRVLAKGARGRRSNLKGCLQPFTPLLVRWTG 62

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           R                 A  LS S+   GL     L R L  +     L+      L  
Sbjct: 63  RGEVKTLRSAEP---VSLALPLSGSMLYSGLYVNELLSRVLEHQTNYSALFFDYLHCLQS 119

Query: 121 HKIPS-VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                        Q EL +L ++G+G+D   C  +G                     L  
Sbjct: 120 LAGSDGTPEYALRQFELAILAHLGYGVDFLHCAGSGQPVADTMTYRYRE-EKGFIASLVI 178

Query: 180 AEKMLVLPSFL-WKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENFLGKLL 237
                     L     +  DAD+L++A + T     + AL+  +       RE F   ++
Sbjct: 179 DHYSFTGRQLLALANREFPDADTLRAAKRFT-----RIALKPYLGGKPLKSRELFRQFVI 233

Query: 238 E 238
           +
Sbjct: 234 K 234


>gi|56421021|ref|YP_148339.1| DNA repair protein RecO [Geobacillus kaustophilus HTA426]
 gi|261418496|ref|YP_003252178.1| DNA repair protein RecO [Geobacillus sp. Y412MC61]
 gi|319767543|ref|YP_004133044.1| DNA repair protein RecO [Geobacillus sp. Y412MC52]
 gi|61214670|sp|Q5KX15|RECO_GEOKA RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|56380863|dbj|BAD76771.1| DNA repair protein (recombination protein O) [Geobacillus
           kaustophilus HTA426]
 gi|261374953|gb|ACX77696.1| DNA repair protein RecO [Geobacillus sp. Y412MC61]
 gi|317112409|gb|ADU94901.1| DNA repair protein RecO [Geobacillus sp. Y412MC52]
          Length = 262

 Score =  115 bits (287), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 34/184 (18%), Positives = 71/184 (38%), Gaps = 1/184 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M+   +AI++    YGE N I+ + TR++G+     R  +    +       L   ++  
Sbjct: 1   MFETCEAIVMRTVDYGETNKIVTLFTREWGKVAAMARGAKKPSSRLSAVTQPLSYGHYVI 60

Query: 61  RLAQNLGE-FRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLN 119
           R ++ +G   + E+++S  A         Y +  +    +   E++    L+++L   L 
Sbjct: 61  RRSRGVGVLHQGELIDSMRALREDLFAAAYAVYIVELTDKSTEEQKRNPYLFELLLQTLQ 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                  +  +    E+ +L  +G    L +C   G T+     S K  G +C       
Sbjct: 121 YMSEGRDLEILTFIYEMKMLAVLGIPPVLDRCARCGATEGRFSFSVKEAGFLCHRCEASD 180

Query: 180 AEKM 183
             + 
Sbjct: 181 PHRF 184


>gi|152980172|ref|YP_001353062.1| DNA repair protein RecO [Janthinobacterium sp. Marseille]
 gi|151280249|gb|ABR88659.1| RecO DNA repair protein [Janthinobacterium sp. Marseille]
          Length = 287

 Score =  115 bits (287), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 41/234 (17%), Positives = 74/234 (31%), Gaps = 10/234 (4%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQS--HRMQPILQAGNLVRVNWRSRLA 63
              +L    Y E ++I++V +R +GR     +  +    +++ +LQ    + V W  +  
Sbjct: 59  PGFVLHSYPYKETSLIVDVFSRDHGRIALVAKGAKRPHSKLRGVLQTFQPLSVGWSGKAE 118

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKI 123
                             L  S  L G      L + L   +P   L+D     LN    
Sbjct: 119 VRT---LTAAEWVGGLLPLEKSALLCGFYLNELLVKLLARDDPHPALFDHYVSALNQLAH 175

Query: 124 PSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKM 183
                 +  + E  LLK  G   D   C  +G    L  +         R          
Sbjct: 176 DEPAPIVLRKFERALLKETGVASDWRVCTASGKAIVLEQIYVLDPERGPRPARPADVWPR 235

Query: 184 LVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHN-IIHCHLLRENFLGKL 236
           +   + L  E +       ++  +    FL ++ L H+        R+  +  L
Sbjct: 236 VSGKTLLDMENEDYTDTQTQTQSK----FLMRFLLAHHLNGAPLNTRQILIDLL 285


>gi|297529348|ref|YP_003670623.1| DNA repair protein RecO [Geobacillus sp. C56-T3]
 gi|297252600|gb|ADI26046.1| DNA repair protein RecO [Geobacillus sp. C56-T3]
          Length = 262

 Score =  115 bits (287), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 34/184 (18%), Positives = 70/184 (38%), Gaps = 1/184 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M+   +AI++    YGE N I+ + TR++G+     R  +    +       L   ++  
Sbjct: 1   MFETCEAIVMRTVDYGETNKIVTLFTREWGKVAAMARGAKKPSSRLSAVTQPLSYGHYVI 60

Query: 61  RLAQNLGE-FRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLN 119
           R ++ +G   + E+++S  A         Y +  +    +   E++    L+++L   L 
Sbjct: 61  RRSRGVGVLHQGELIDSMRALREDLFAAAYAVYIVELTDKSTEEQKRNPYLFELLLQTLQ 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                  +  +    E  +L  +G    L +C   G T+     S K  G +C       
Sbjct: 121 YMSEGRDLEILTFIYETKMLAVLGIPPVLDRCARCGATEGRFSFSVKEAGFLCHRCEASD 180

Query: 180 AEKM 183
             + 
Sbjct: 181 PHRF 184


>gi|238750384|ref|ZP_04611885.1| DNA repair protein recO [Yersinia rohdei ATCC 43380]
 gi|238711315|gb|EEQ03532.1| DNA repair protein recO [Yersinia rohdei ATCC 43380]
          Length = 241

 Score =  115 bits (287), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 49/243 (20%), Positives = 82/243 (33%), Gaps = 14/243 (5%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVN 57
           M  WQ  A +L  R Y E +++L++ T   GR     +  +  R   +  LQ    + V 
Sbjct: 1   MEGWQ-RAFVLHGRPYSETSLMLDLFTEGEGRMRVLAKGARGRRSNLKGCLQPFTPLLVR 59

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
           W  R                 A  LS S+   GL     L R L ++     L+      
Sbjct: 60  WVGRGEIKTLRSAEP---VSLALPLSGSMLYSGLYVNELLSRVLEQQTNYSALFFDYLHC 116

Query: 118 LNCHKIPS-VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVG 176
           L               Q EL +L ++G+G+D   C  +G                  +  
Sbjct: 117 LQSLAGSDGSPEYALRQFELAILAHLGYGVDFLHCAGSGQPVSDSMTYRYREEKGFIASL 176

Query: 177 LPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENFLGK 235
           +                 +  DAD+L++A + T     + AL+  +       RE F   
Sbjct: 177 VVDHYSFTGRQLLALANREFPDADTLRAAKRFT-----RIALKPYLGGKPLKSRELFRQF 231

Query: 236 LLE 238
           +++
Sbjct: 232 VIK 234


>gi|238793771|ref|ZP_04637392.1| DNA repair protein recO [Yersinia intermedia ATCC 29909]
 gi|238726835|gb|EEQ18368.1| DNA repair protein recO [Yersinia intermedia ATCC 29909]
          Length = 241

 Score =  115 bits (287), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 51/241 (21%), Positives = 87/241 (36%), Gaps = 15/241 (6%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRS 60
           WQ  A +L  R Y E +++L++ T   GR     +  +  R   +  LQ    + V W  
Sbjct: 4   WQ-RAFVLHGRPYSETSLMLDLFTEGEGRMRVLAKGARGRRSNLKGCLQPFTPLLVRWAG 62

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           R                 A  L+ S+   GL     L R L  +     L+      L  
Sbjct: 63  RGEVKTLRSAEP---VSLALPLTGSMLYSGLYVNELLSRVLEHQTNYSALFFDYLHCLQA 119

Query: 121 HKIPS-VIGKIFVQIELMLLKNIGFGLDLTKCVVTGV-TQDLLWVSPKSGGAVCRSVGLP 178
                        Q EL +L ++G+G+D   C  +G    D +    +       S+ + 
Sbjct: 120 LAGSDGSPEYALRQFELAILAHLGYGVDFLHCAGSGQPISDTMTYRYREEKGFIASLVVD 179

Query: 179 YAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENFLGKLL 237
           +        S L    +  DAD+L++A + T     + AL+  +       RE F   ++
Sbjct: 180 HYSFTGRQLSALA-NREFPDADTLRAAKRFT-----RIALKPYLGGKPLKSRELFRQFVI 233

Query: 238 E 238
           +
Sbjct: 234 K 234


>gi|317049178|ref|YP_004116826.1| DNA repair protein RecO [Pantoea sp. At-9b]
 gi|316950795|gb|ADU70270.1| DNA repair protein RecO [Pantoea sp. At-9b]
          Length = 242

 Score =  114 bits (286), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 53/238 (22%), Positives = 85/238 (35%), Gaps = 16/238 (6%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVN 57
           M  WQ  A +L  R Y E +++L++ +   GR     +  +S R   +  LQ    + V 
Sbjct: 1   MEGWQ-RAFVLHSRPYSETSLLLDLFSESEGRVRVLAKGARSRRSQLKGALQPFTPLLVR 59

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
           W  R                 A  LS      GL     L R L +  P  +L+      
Sbjct: 60  WGGRGEVKTLRNAEA---VSLALPLSGITLYCGLYVNELLSRVLEQEIPFSDLFFDYLNC 116

Query: 118 LNCH-KIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVT-GVTQDLLWVSPKSGGAVCRSV 175
           +               + EL LL ++G+G+D   C  +     D +  S +       S+
Sbjct: 117 IQALAAASGTPEPALRRFELALLGHLGYGVDFLHCAGSGEEVDDGMTYSYREEKGFIASL 176

Query: 176 GLPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENF 232
            +            LW E    DADSL++A + T     + AL+  +       +E F
Sbjct: 177 VVNQRSFTGRQLRALW-ERDFPDADSLRAAKRFT-----RMALKPYLGGKPLKSQELF 228


>gi|58617232|ref|YP_196431.1| DNA repair protein RecO [Ehrlichia ruminantium str. Gardel]
 gi|58416844|emb|CAI27957.1| Putative DNA repair protein recO [Ehrlichia ruminantium str.
           Gardel]
          Length = 244

 Score =  114 bits (286), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 63/242 (26%), Positives = 117/242 (48%), Gaps = 8/242 (3%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M WQD  I++ +R Y +  +I+ V+T+++G   G  +  +    +  LQ G+ + V W +
Sbjct: 1   MRWQDQGIVIAIRKYCDNQVIISVLTKKHGLKKGLTKYYKKTINR--LQIGDYINVTWSA 58

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFL-- 118
           RL  NLG F++E+++S     ++++L    L     +   +        +          
Sbjct: 59  RLISNLGYFKYELIKSTIYYYMTNNLQTLCLAFFTFILDQVLPENEENYVIYHYFDIFIN 118

Query: 119 NCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
           +           ++++E++LL  +GFGLDL+KC V    + L+++SPK+G A+ +++GLP
Sbjct: 119 SIQSKNINWQIKYLKLEMVLLSELGFGLDLSKCAVNQTQESLIFISPKTGKAISKNIGLP 178

Query: 179 YAEKMLVLPSFLWKEEQTIDAD----SLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLG 234
           Y +K+L LP  L+        +      K +  +  YF  K+ L    I     RE  + 
Sbjct: 179 YKKKLLPLPQLLYNIYNNYTYEFSNTEFKLSLNVLGYFFKKHFLTDKNITFLKYREEIIK 238

Query: 235 KL 236
            L
Sbjct: 239 LL 240


>gi|284006741|emb|CBA71998.1| DNA repair protein [Arsenophonus nasoniae]
          Length = 237

 Score =  114 bits (285), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 47/239 (19%), Positives = 81/239 (33%), Gaps = 13/239 (5%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRS 60
           WQ  A +L  R Y E +++L+  T   GR     +  +S R   +  LQ    + + W  
Sbjct: 4   WQ-RAFVLHTRPYSETSLLLDFFTENEGRIRLLAKGARSRRSNLKGCLQPFTPLLIRWGG 62

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           +      +          A   + ++   GL     L R L +  P   L+      L  
Sbjct: 63  KGE---MKTLRSAEPISLALPFTGTVLYSGLYVNELLARVLAQNIPYQSLFFEYLTCLQI 119

Query: 121 HK-IPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                S       + EL LL ++G+G+D   C  +G                  +  +  
Sbjct: 120 LAGSESTPEHALRRFELSLLSHLGYGVDFLHCSGSGEPVINGMTYRYREEKGFIASLVID 179

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENFLGKLL 237
                      +   +  D D+LK+A + T     + AL+  +       RE F   +L
Sbjct: 180 HLSFTGKQLKAFACREFPDVDTLKAAKRFT-----RIALKPYLGGTPLKSRELFYQLIL 233


>gi|57239220|ref|YP_180356.1| DNA repair protein RecO [Ehrlichia ruminantium str. Welgevonden]
 gi|58579178|ref|YP_197390.1| DNA repair protein RecO [Ehrlichia ruminantium str. Welgevonden]
 gi|57161299|emb|CAH58220.1| putative DNA repair protein RecO [Ehrlichia ruminantium str.
           Welgevonden]
 gi|58417804|emb|CAI27008.1| Putative DNA repair protein recO [Ehrlichia ruminantium str.
           Welgevonden]
          Length = 244

 Score =  114 bits (285), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 59/242 (24%), Positives = 110/242 (45%), Gaps = 8/242 (3%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M WQD  I++ +R Y +  +I+ V+T+++G   G  +  +    +  LQ G+ + V W +
Sbjct: 1   MRWQDQGIVIAIRKYCDNQVIISVLTKKHGLKKGLTKYYKKTINR--LQIGDYINVTWSA 58

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFL-- 118
           RL  NLG F++E+++S     ++++L    L     +   +        +          
Sbjct: 59  RLISNLGYFKYELIKSTIYYYITNNLQTLCLAFFTFILDQVLPENEENYVIYHYFDIFIN 118

Query: 119 NCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
           +           ++++E++LL  +GFGLDL+KC V    + L+++SPK+G A+  ++GLP
Sbjct: 119 SIQSKNINWQIKYLKLEMVLLSELGFGLDLSKCAVNQTQESLIFISPKTGKAISENIGLP 178

Query: 179 Y----AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLG 234
           Y         +L +              K +  +  YF  K+ L    I     RE  + 
Sbjct: 179 YKKKLLPLPQLLYNIYNDYTYEFSNTEFKLSLNVLGYFFKKHFLTDKNITFLKYREEIIK 238

Query: 235 KL 236
            L
Sbjct: 239 LL 240


>gi|310764813|gb|ADP09763.1| DNA repair protein RecO [Erwinia sp. Ejp617]
          Length = 245

 Score =  114 bits (285), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 45/230 (19%), Positives = 79/230 (34%), Gaps = 13/230 (5%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVN 57
           M  WQ  A +L  R + E +++L++ + Q+GR     +  +S R   +  LQ    + V 
Sbjct: 1   MEGWQ-RAFVLHGRPWSETSLLLDLFSEQHGRVRVLAKGARSKRSSLKGALQPFTPLLVR 59

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
           W  R                 A  LS +    GL     L R L       EL+      
Sbjct: 60  WSGRGEVKTLRAAEP---VSLALPLSGNTLYCGLYVNELLSRVLQHETAFSELFFDYLQC 116

Query: 118 LNCH-KIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVG 176
           +      P+       + EL +L ++G+G+D   C  +G                  +  
Sbjct: 117 IQTLAADPASPEPALRRFELSMLGHLGYGVDFLHCAGSGEEVADSMTYSYREEKGFIASL 176

Query: 177 LPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH 226
           +                 +  DAD+L++A + T     + AL+  +    
Sbjct: 177 VAGHRSFSGRQLRALSAREFPDADTLRAAKRFT-----RIALKPYLGGKP 221


>gi|259907679|ref|YP_002648035.1| DNA repair protein RecO [Erwinia pyrifoliae Ep1/96]
 gi|224963301|emb|CAX54786.1| DNA repair protein RecO [Erwinia pyrifoliae Ep1/96]
 gi|283477530|emb|CAY73446.1| DNA repair protein recO (Recombination protein O) [Erwinia
           pyrifoliae DSM 12163]
          Length = 245

 Score =  114 bits (285), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 45/230 (19%), Positives = 79/230 (34%), Gaps = 13/230 (5%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVN 57
           M  WQ  A +L  R + E +++L++ + Q+GR     +  +S R   +  LQ    + V 
Sbjct: 1   MEGWQ-RAFVLHGRPWSETSLLLDLFSEQHGRVRVLAKGARSKRSSLKGALQPFTPLLVR 59

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
           W  R                 A  LS +    GL     L R L       EL+      
Sbjct: 60  WSGRGEVKTLRAAEP---VSLALPLSGNTLYCGLYVNELLSRVLQHETAFSELFFDYLQC 116

Query: 118 LNCH-KIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVG 176
           +      P+       + EL +L ++G+G+D   C  +G                  +  
Sbjct: 117 IQTLAADPASPEPALRRFELSMLGHLGYGVDFLHCAGSGEEVADSMTYSYREEKGFIASL 176

Query: 177 LPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH 226
           +                 +  DAD+L++A + T     + AL+  +    
Sbjct: 177 VAGHRSFSGRQLRALSAREFPDADTLRAAKRFT-----RIALKPYLGGKP 221


>gi|300691970|ref|YP_003752965.1| DNA repair protein recO (Recombination protein O) [Ralstonia
           solanacearum PSI07]
 gi|299079030|emb|CBJ51692.1| DNA repair protein recO (Recombination protein O) [Ralstonia
           solanacearum PSI07]
          Length = 272

 Score =  114 bits (285), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 41/235 (17%), Positives = 72/235 (30%), Gaps = 9/235 (3%)

Query: 4   QDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSR 61
           Q  A +L    Y E ++I++V TR +GR     +  +      + +LQ    + ++W  R
Sbjct: 41  QQPAFVLHSYPYRETSLIIDVFTRDHGRIALVAKGAKRPHSALRAVLQTFQPLSLSWSGR 100

Query: 62  LAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCH 121
                               L     L G      L +F+   +    L+      LN  
Sbjct: 101 GEVKT---LTRAEWVGGMLPLGGEGLLSGFYLNELLVKFVAREDGHPVLFSHYVETLNKL 157

Query: 122 KIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCR-SVGLPYA 180
                +       E +LL+  GF   L +C+     Q            + R     P +
Sbjct: 158 AHGEPVAFTLRAFERVLLRETGFAAQLDRCIDGEPVQPDGDYVYHPERGIRRAQPSDPSS 217

Query: 181 EKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGK 235
             +L   + L  E       +  +  +    FL  Y L          R+  +  
Sbjct: 218 WPVLRGQTLLDMERDDYSRPATATQSRSLMRFLLHYHL---HGTPLSTRQILIDL 269


>gi|332308047|ref|YP_004435898.1| DNA repair protein RecO [Glaciecola agarilytica 4H-3-7+YE-5]
 gi|332175376|gb|AEE24630.1| DNA repair protein RecO [Glaciecola agarilytica 4H-3-7+YE-5]
          Length = 240

 Score =  114 bits (285), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 48/229 (20%), Positives = 78/229 (34%), Gaps = 11/229 (4%)

Query: 7   AIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNWRSRLAQ 64
             +L  R+Y E + ++   T + G+    V+  +  +   + +LQ    + V    R   
Sbjct: 8   GFVLHRRAYRETSFLINFFTMENGKVSAIVKGARGAKSDKKSLLQPFQPLLVAVSGRFEL 67

Query: 65  NLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIP 124
              +             LS       L     L R L +  P  E++ +    L+     
Sbjct: 68  KNLQQVEST---GAMLRLSGQALYCALYLNEVLNRVLADDIPHPEIFVLYQQSLHALVDS 124

Query: 125 SVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKML 184
           +    I    EL LL  +G+G+DLT    TG                C   G        
Sbjct: 125 THFEPILRSFELGLLDALGYGIDLTHDADTGQPLAESGYYRIQAELGCVYQGDIRLSGCH 184

Query: 185 VLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHL-LRENF 232
           +  S L    +  DA+SL+ A  +T     + AL   +    L  RE F
Sbjct: 185 LGSSLLKVAGEHWDAESLQVAKAVT-----RKALGELLGSKPLMSRELF 228


>gi|253988788|ref|YP_003040144.1| DNA repair protein RecO [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|253780238|emb|CAQ83399.1| dna repair protein reco (recombination protein o) [Photorhabdus
           asymbiotica]
          Length = 241

 Score =  114 bits (285), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 50/241 (20%), Positives = 87/241 (36%), Gaps = 15/241 (6%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRS 60
           WQ  A IL  R Y E +++L++ T   GR     +  +S R   +  LQ    + + W  
Sbjct: 4   WQ-RAFILHRRPYSETSLLLDLFTENEGRISVLAKGARSRRSNLKGCLQPFTPLLIRWSG 62

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           R    + +   +         L+ S+   GL     L R L +      L+      L  
Sbjct: 63  RG---VVKTLRDADPISLTLPLTGSVLYSGLYVNELLSRVLEQGTAYPALFFDYLQCLQV 119

Query: 121 H-KIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGV-TQDLLWVSPKSGGAVCRSVGLP 178
                        + EL LL N+G+G+D   C  +G    D +    +       S+ + 
Sbjct: 120 LAASEYTPEHALRRFELALLANLGYGVDYLHCAGSGEPVTDTMTYRYREEKGFIASLVVD 179

Query: 179 YAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHN-IIHCHLLRENFLGKLL 237
           +          L    +  D+ +LK+A + T     + AL+     +    RE F   + 
Sbjct: 180 HYSFTGHELKSLA-TREFPDSVTLKAAKRFT-----RIALKPYLGGNPLKSRELFRQFVR 233

Query: 238 E 238
           +
Sbjct: 234 K 234


>gi|323490067|ref|ZP_08095288.1| DNA repair protein RecO [Planococcus donghaensis MPA1U2]
 gi|323396363|gb|EGA89188.1| DNA repair protein RecO [Planococcus donghaensis MPA1U2]
          Length = 260

 Score =  113 bits (283), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 36/193 (18%), Positives = 65/193 (33%), Gaps = 2/193 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNW-R 59
           M  Q + I++    YGE N I+ + T++ G+     R  +    +           ++  
Sbjct: 1   MQNQVEGIVIRTMPYGETNKIVTLFTKEAGKITCMARGAKKPASRLAAITQVFTHGSFSI 60

Query: 60  SRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLN 119
            +          + LES            Y       + R   + EP   ++DML   L+
Sbjct: 61  YKGKGMGTIQAGDPLESLRHIREDIMSTAYASYVTELIDRLTEQDEPQPAIFDMLYQALH 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                     I + +E  +L+  G    L +C   G T+     S +  G +C       
Sbjct: 121 AIDDGYDPEAITLFVEWKMLQTAGLTPTLHQCANCGSTEGEFAFSFQELGFLCHRC-FHI 179

Query: 180 AEKMLVLPSFLWK 192
              ++ L   L K
Sbjct: 180 DSYIIRLSPALVK 192


>gi|238796737|ref|ZP_04640243.1| DNA repair protein recO [Yersinia mollaretii ATCC 43969]
 gi|238719468|gb|EEQ11278.1| DNA repair protein recO [Yersinia mollaretii ATCC 43969]
          Length = 241

 Score =  113 bits (283), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 50/241 (20%), Positives = 80/241 (33%), Gaps = 15/241 (6%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRS 60
           WQ  A +L  R Y E +++L++ T   GR     +  +  R   +  LQ    + V W  
Sbjct: 4   WQ-RAFVLHGRPYSETSLMLDLFTEGEGRMRVLAKGARGRRSNLKGCLQPFTPLLVRWSG 62

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           R                 A  LS S+   GL     L R L  +     L+      L  
Sbjct: 63  RGEVKTLRSAEP---VSLALPLSGSMLYSGLYVNELLSRVLEHQTNYSALFFDYLHCLQS 119

Query: 121 HKIPS-VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                        Q EL +L ++G+G+D   C  +G                     L  
Sbjct: 120 LAGSDGTPEYALRQFELAILAHLGYGVDFLHCSGSGQPVSETMTYRYRE-EKGFIASLVI 178

Query: 180 AEKMLVLPSFL-WKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENFLGKLL 237
                     L     +  DAD+L++A + T     + AL+  +       RE F   ++
Sbjct: 179 DHYSFTGRQLLALAHREFPDADTLRAAKRFT-----RIALKPYLGGKPLKSRELFRQFVI 233

Query: 238 E 238
           +
Sbjct: 234 K 234


>gi|255003183|ref|ZP_05278147.1| DNA repair protein RecO [Anaplasma marginale str. Puerto Rico]
 gi|255004314|ref|ZP_05279115.1| DNA repair protein RecO [Anaplasma marginale str. Virginia]
          Length = 233

 Score =  113 bits (282), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 73/236 (30%), Positives = 119/236 (50%), Gaps = 11/236 (4%)

Query: 7   AIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQNL 66
            +++G R YG+++++L ++TR  G   G  R  +       LQ G+L+   WR++L  NL
Sbjct: 2   GVVMGTRPYGDEHLLLSILTRNRGLRRGLTRLTKKR----PLQIGDLIDATWRAKLPTNL 57

Query: 67  GEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLNCHKIPS 125
           G F  EV+ S         + L  L SI  +    LPE EP   LYD    F    +  +
Sbjct: 58  GHFTCEVIASAFYSYFRDRIKLMCLSSITHIMSTALPENEPHPTLYDSFQDFAAAAEAEA 117

Query: 126 VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKMLV 185
                ++++EL++L  +GF LDL+KC V+    +LL++SPK+G A+  +VG  Y  K+L 
Sbjct: 118 PWYNHYLKLELLVLSQLGFALDLSKCAVSNSKDNLLFISPKTGRALSEAVGHAYRNKLLP 177

Query: 186 LPSFLWK-----EEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKL 236
           LP  L       E +   AD    + ++  +FL+++ LQ +       R+   G L
Sbjct: 178 LPKVLRSISCGVETECCSADEFALSLKILGFFLHRHLLQESH-TFQESRKILTGLL 232


>gi|329297707|ref|ZP_08255043.1| DNA repair protein RecO [Plautia stali symbiont]
          Length = 245

 Score =  113 bits (282), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 52/237 (21%), Positives = 88/237 (37%), Gaps = 15/237 (6%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVN 57
           M  WQ  A +L  R Y E +++L++ +   GR     +  +S R   +  LQ    + V 
Sbjct: 1   MEGWQ-RAFVLHSRPYSETSLLLDLFSESQGRVRVLAKGARSRRSQRKGALQPFTPLLVR 59

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
           W  R                 A  LS      GL     L R L +  P  EL+      
Sbjct: 60  WGGRGEVKTLRNAEA---VSLALPLSGITLYCGLYVNELLSRVLEQEIPFSELFFDYLSC 116

Query: 118 LNCHKIPS-VIGKIFVQIELMLLKNIGFGLDLTKCVVTGV-TQDLLWVSPKSGGAVCRSV 175
           +    + +        + EL LL ++G+G++   C  +G    D +  S +       S+
Sbjct: 117 IQTLAVANGSPEPALRRFELALLGHLGYGVNFLHCAGSGEAVDDGMTYSYREEKGFIASL 176

Query: 176 GLPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENF 232
            +            LW E +  DAD+L++A + T     + AL+  +    L  +  
Sbjct: 177 VVNQRSFTGRQLRALW-EREFPDADTLRAAKRFT-----RMALKPYLGGKPLNSQEL 227


>gi|37527214|ref|NP_930558.1| DNA repair protein RecO [Photorhabdus luminescens subsp. laumondii
           TTO1]
 gi|42559442|sp|Q7N1X7|RECO_PHOLL RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|36786648|emb|CAE15712.1| DNA repair protein recO (recombination protein O) [Photorhabdus
           luminescens subsp. laumondii TTO1]
          Length = 241

 Score =  113 bits (282), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 47/230 (20%), Positives = 81/230 (35%), Gaps = 14/230 (6%)

Query: 8   IILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLAQN 65
            +L  R Y E +++L++ T   GR     +  +  R   +  LQ    + V W  R    
Sbjct: 8   FVLHGRPYSETSLLLDLFTENEGRISVLAKGARGRRSNLKGCLQPFTPLLVRWSGRG--- 64

Query: 66  LGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCH-KIP 124
             +   +      A  L+ S+   GL     L R L +      L+      L       
Sbjct: 65  AIKTLRDADPISLALPLTGSVLYSGLYINELLSRVLEQGTAYPALFFDYLQCLQILAASE 124

Query: 125 SVIGKIFVQIELMLLKNIGFGLDLTKCVVTGV-TQDLLWVSPKSGGAVCRSVGLPYAEKM 183
                   + EL LL N+G+G+D   C  +G    D +    +       S+ + +    
Sbjct: 125 YTPEYALRRFELALLANLGYGVDYLHCAGSGEPVADTMTYRYREEKGFIASLVVDHYSFT 184

Query: 184 LVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENF 232
                 L    +  D+ +LK+A + T     + AL+  +       RE F
Sbjct: 185 GRELKSLA-TREFPDSATLKAAKRFT-----RIALKPYLGGKPLKSRELF 228


>gi|72394258|gb|AAZ68535.1| recO-related protein [Ehrlichia canis str. Jake]
          Length = 248

 Score =  113 bits (282), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 70/241 (29%), Positives = 122/241 (50%), Gaps = 8/241 (3%)

Query: 2   YWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSR 61
            WQD  I++ +R YG+  II+ + T+++G   G  R  +    +  LQ G+ V V W ++
Sbjct: 6   RWQDQGIVIAIRKYGDDQIIISIFTQKHGLKKGLARYQKKTIHR--LQIGDHVNVTWSAK 63

Query: 62  LAQNLGEFRFEVLESHCAKLLSSSLFLYGL-QSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           L  NLG F++E+++S     + ++L    +      L + LPE E    +Y+ L+IF+N 
Sbjct: 64  LISNLGYFKYEIIKSTLHHYIHNNLKTMCIAFFTSILDQVLPENEENYTIYNHLDIFMNS 123

Query: 121 H-KIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                      ++ +EL LL  +GFGLDL++C V    ++L+++SPK+G A+ ++VGLPY
Sbjct: 124 VQNKDVNWQIKYLTLELTLLSELGFGLDLSQCAVNNTNENLIFISPKTGKAISQTVGLPY 183

Query: 180 AE----KMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGK 235
            +       +L +              K +  +T YFL K+ L    I     R+  +  
Sbjct: 184 KKSLLPLPPLLYNVYNNYTYKYSKTDFKVSLNVTGYFLKKHFLTEKNITLIKYRDEIIKL 243

Query: 236 L 236
           +
Sbjct: 244 I 244


>gi|226328139|ref|ZP_03803657.1| hypothetical protein PROPEN_02030 [Proteus penneri ATCC 35198]
 gi|225203843|gb|EEG86197.1| hypothetical protein PROPEN_02030 [Proteus penneri ATCC 35198]
          Length = 245

 Score =  112 bits (281), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 44/234 (18%), Positives = 73/234 (31%), Gaps = 13/234 (5%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRS 60
           WQ  A ++  R Y E +++L+  T   GR     +  +  R   +  LQ    + + W  
Sbjct: 4   WQ-RAFVIHARPYSETSLLLDFFTENEGRVRILSKGARGRRSPLKGALQPFTPLLIRWSG 62

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           R                 A  L+ S+   GL     L R L        L+      L  
Sbjct: 63  RGEIKTLRDAEP---ISLALPLTGSVLYSGLYLNELLSRVLENGTSYSVLFFEYLSCLQI 119

Query: 121 H-KIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                +       + EL LL  +G+GLD   C  +G                  +  +  
Sbjct: 120 LAASETTPEAALRRFELALLTQLGYGLDFLHCAGSGEPVSDSMTYRYREEKGFIASLVVD 179

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENF 232
                          +    ++LK+A + T     + AL+  +       RE F
Sbjct: 180 HNSFTGFELKSLASREFPTVETLKAAKRFT-----RMALKPYLGGKPLKSRELF 228


>gi|332162689|ref|YP_004299266.1| DNA repair protein RecO [Yersinia enterocolitica subsp. palearctica
           105.5R(r)]
 gi|318606794|emb|CBY28292.1| DNA recombination and repair protein RecO [Yersinia enterocolitica
           subsp. palearctica Y11]
 gi|325666919|gb|ADZ43563.1| DNA repair protein RecO [Yersinia enterocolitica subsp. palearctica
           105.5R(r)]
          Length = 241

 Score =  112 bits (281), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 47/243 (19%), Positives = 80/243 (32%), Gaps = 14/243 (5%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVN 57
           M  WQ  A +L  R Y E +++L++ T   GR     +  +  R   +  LQ    + V 
Sbjct: 1   MEGWQ-RAFVLHGRPYSETSLMLDLFTEGEGRMRVLAKGARGRRSNLKGCLQPFTPLLVR 59

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
              R                 A  L+ S+   GL     L R L  +     L+      
Sbjct: 60  CTGRGEVKTLRSAEP---VSLALPLAGSMLYSGLYVNELLSRVLEHQTNYSALFFDYLHC 116

Query: 118 LNCHKIPS-VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVG 176
           L               Q EL +L ++G+G+D   C  +G                  +  
Sbjct: 117 LQSLAGSDGSPEYALRQFELAILAHLGYGVDFLHCAGSGQPVSDTMTYRYREEKGFIASL 176

Query: 177 LPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENFLGK 235
           +                 +  DAD+L++A + T     + AL+  +       RE F   
Sbjct: 177 VVDHYSFTGRQLLALANREFPDADTLRAAKRFT-----RIALKPYLGGKPLKSRELFRQF 231

Query: 236 LLE 238
           +++
Sbjct: 232 VIK 234


>gi|290476132|ref|YP_003469032.1| gap repair protein [Xenorhabdus bovienii SS-2004]
 gi|289175465|emb|CBJ82268.1| gap repair protein, part of RecFOR complex that targets RecA to
           ssDNA-dsDNA junction [Xenorhabdus bovienii SS-2004]
          Length = 245

 Score =  112 bits (281), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 50/241 (20%), Positives = 84/241 (34%), Gaps = 15/241 (6%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRS 60
           WQ  A +L  R Y E +++L+  T   GR     +  +  R   +  LQ    + V W  
Sbjct: 4   WQ-RAFVLHGRPYSETSLLLDFFTENEGRVRVLAKGVRRRRSHLKGCLQPFTPLLVRWSG 62

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           R    +            A  L+ S+   GL     L R L +      L+      L  
Sbjct: 63  RGEIKILRDAEP---ISLALPLTGSVLYSGLYVNELLSRVLEQGAAYPALFFDYLQCLQI 119

Query: 121 H-KIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGV-TQDLLWVSPKSGGAVCRSVGLP 178
                        + EL LL N+G+G+D   C  +G    D +    +       S+ + 
Sbjct: 120 LAASEYTPEYALRRFELALLTNMGYGVDYLHCAGSGEPVSDTMNYRYREEKGFIASLVVD 179

Query: 179 YAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENFLGKLL 237
           +          L    +  D+ +LK+A + T     + AL+  +       RE F   + 
Sbjct: 180 HFSFTGNELKALA-TGEFTDSLTLKAAKRFT-----RIALKPYLGGKPLKSRELFRQFVR 233

Query: 238 E 238
           +
Sbjct: 234 K 234


>gi|149926462|ref|ZP_01914723.1| DNA repair protein RecO [Limnobacter sp. MED105]
 gi|149824825|gb|EDM84039.1| DNA repair protein RecO [Limnobacter sp. MED105]
          Length = 244

 Score =  112 bits (281), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 36/243 (14%), Positives = 78/243 (32%), Gaps = 16/243 (6%)

Query: 4   QDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQS--HRMQPILQAGNLVRVNWRSR 61
            D A +L    Y E ++I+E+  +++GR     +  +     ++ +L +   + V +  +
Sbjct: 8   TDFAYVLHSVPYKETSLIVELFCKEHGRLPVVAKGAKRPHSGLRAVLVSFQPLSVRFTGK 67

Query: 62  LAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCH 121
                      +                       L R L   +   +L+++    L   
Sbjct: 68  SEVKTLMQAEWLGGLMSP---DGKALFAAYYLNELLMRGLSREDTHPDLFELYQNTLLGL 124

Query: 122 KIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAE 181
                +     Q E+ LL+++G+GLD  +               +       S G     
Sbjct: 125 AGGDDMNVCVRQFEVGLLQSLGYGLDWQQDRTGVAIDPERHYVWQDHEGWSPSDGGNVNN 184

Query: 182 ------KMLVLPSFLWKEEQTIDADSLKSAFQ-LTDYFLNKYALQHNIIHCHLLRENFLG 234
                 + +V   ++ + +  I + S  SA + +T   L  +    N +     R     
Sbjct: 185 STSSSVEQMVQGLWIAEIQNGIWSKSAASALKPITRKLLMTHI-APNGLM---SRVWMEH 240

Query: 235 KLL 237
            L 
Sbjct: 241 LLR 243


>gi|254995034|ref|ZP_05277224.1| DNA repair protein RecO [Anaplasma marginale str. Mississippi]
          Length = 233

 Score =  112 bits (280), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 73/236 (30%), Positives = 120/236 (50%), Gaps = 11/236 (4%)

Query: 7   AIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQNL 66
            +++G R YG+++++L ++TR  G   G  R  +       LQ G+L+   WR++L  NL
Sbjct: 2   GVVMGTRPYGDEHLLLSILTRNRGLRRGLTRLTKKR----PLQIGDLIDATWRAKLPTNL 57

Query: 67  GEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRF-LPEREPCLELYDMLNIFLNCHKIPS 125
           G F +EV+ S         + L  L SI  +    LPE EP   LYD    F    +  +
Sbjct: 58  GHFTYEVIASAFYSYFRDRIKLMCLSSITHIMSTALPENEPHPTLYDSFQDFAAAAEAEA 117

Query: 126 VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKMLV 185
                ++++EL++L  +GF LDL+KC V+    +LL++SPK+G A+  +VG  Y  K+L 
Sbjct: 118 PWYNHYLKLELLVLSQLGFALDLSKCAVSNSKDNLLFISPKTGRALSEAVGHAYRNKLLP 177

Query: 186 LPSFLWK-----EEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKL 236
           LP  L       E +   AD    + ++  +FL+++ LQ +       R+   G L
Sbjct: 178 LPKVLRSISCGVETECCSADEFALSLKILGFFLHRHLLQESH-TFQESRKILTGLL 232


>gi|300704605|ref|YP_003746208.1| DNA repair protein reco (recombination protein o) [Ralstonia
           solanacearum CFBP2957]
 gi|299072269|emb|CBJ43602.1| DNA repair protein recO (Recombination protein O) [Ralstonia
           solanacearum CFBP2957]
          Length = 272

 Score =  112 bits (280), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 31/170 (18%), Positives = 54/170 (31%), Gaps = 5/170 (2%)

Query: 4   QDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSR 61
           Q  A +L    Y E ++I++V TR +GR     +  +      + +LQ    + ++W  R
Sbjct: 41  QQPAFVLHSYPYRETSLIIDVFTRDHGRVALVAKGAKRPHSALRAVLQTFQPLSLSWSGR 100

Query: 62  LAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCH 121
                               L     L G      L +F+   +    L+      LN  
Sbjct: 101 GEVKT---LTRAEWVGGMLPLGGEGLLSGFYLNELLVKFVAREDGHPVLFSHYVDTLNKL 157

Query: 122 KIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAV 171
                +       E +LL+  GF   L +C+     Q            +
Sbjct: 158 AHGEPVAFTLRAFERVLLRETGFAARLDRCIDGEPVQPDGDYVYHPERGI 207


>gi|196248953|ref|ZP_03147653.1| DNA repair protein RecO [Geobacillus sp. G11MC16]
 gi|196211829|gb|EDY06588.1| DNA repair protein RecO [Geobacillus sp. G11MC16]
          Length = 258

 Score =  112 bits (280), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 34/188 (18%), Positives = 72/188 (38%), Gaps = 1/188 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M+ + +AI++    YGE N I+ + TR++G+     R  +    +       L   ++  
Sbjct: 1   MFQKCEAIVIRAIDYGETNKIVTLFTREWGKVAAMARGAKKPSSRLSAVTQPLAYGHYLI 60

Query: 61  RLAQNLG-EFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLN 119
           R ++ +G   + E+++S            Y    +    +   E++    L+++L   L 
Sbjct: 61  RRSRGVGLLHQGELIDSMRVLREDLFAAAYAAYIVELTDKSTEEQKRNPYLFELLLQTLQ 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                  +  +    E+ +L  +G    L +C   G T+     S K  G +C       
Sbjct: 121 YMSEGRDLEIMTFIYEMKMLSVLGIPPVLDRCARCGATEGRFSFSVKEAGFLCHRCEAAD 180

Query: 180 AEKMLVLP 187
             +  + P
Sbjct: 181 PHRFPLSP 188


>gi|138896060|ref|YP_001126513.1| DNA repair protein RecO [Geobacillus thermodenitrificans NG80-2]
 gi|166221892|sp|A4IR14|RECO_GEOTN RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|134267573|gb|ABO67768.1| DNA repair protein RecO [Geobacillus thermodenitrificans NG80-2]
          Length = 258

 Score =  112 bits (280), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 34/188 (18%), Positives = 72/188 (38%), Gaps = 1/188 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M+ + +AI++    YGE N I+ + TR++G+     R  +    +       L   ++  
Sbjct: 1   MFQKCEAIVIRAIDYGETNKIVTLFTREWGKVAAMARGAKKPSSRLSAVTQPLAYGHYLI 60

Query: 61  RLAQNLG-EFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLN 119
           R ++ +G   + E+++S            Y    +    +   E++    L+++L   L 
Sbjct: 61  RRSRGVGLLHQGELIDSMRVLREDLFAAAYAAYIVELTDKSTEEQKRNPYLFELLLQTLQ 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                  +  +    E+ +L  +G    L +C   G T+     S K  G +C       
Sbjct: 121 YMSEGRDLEIMTFIYEMKMLSVLGIPPVLDRCARCGATEGRFSFSVKEAGFLCHRCESAD 180

Query: 180 AEKMLVLP 187
             +  + P
Sbjct: 181 PHRFPLSP 188


>gi|239827757|ref|YP_002950381.1| DNA repair protein RecO [Geobacillus sp. WCH70]
 gi|259563679|sp|C5D4S3|RECO_GEOSW RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|239808050|gb|ACS25115.1| DNA repair protein RecO [Geobacillus sp. WCH70]
          Length = 263

 Score =  112 bits (279), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 31/178 (17%), Positives = 62/178 (34%), Gaps = 1/178 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNW-R 59
           M+ + +AI++    YGE N I+   TR++G+     R  +    +            +  
Sbjct: 1   MFEKCEAIVIRAIDYGETNKIVTFFTREWGKVATMARGAKKPSSRLSAVTQPFTHGYYLI 60

Query: 60  SRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLN 119
            R        + ++++S            Y    +    +   E++    L+++L   L 
Sbjct: 61  QRSRGVGVLHQGDIIDSMRTIREDIFTAAYASYIVEMTDKVTEEQQRNPYLFELLLQTLQ 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGL 177
                  +  +    E+ +L  +G    L  C V G T+     S K  G +C     
Sbjct: 121 YMNEGLDLEILACIYEMKMLSVMGIPPKLDHCAVCGRTEGKFSFSIKEAGFLCHRCEK 178


>gi|291618444|ref|YP_003521186.1| RecO [Pantoea ananatis LMG 20103]
 gi|291153474|gb|ADD78058.1| RecO [Pantoea ananatis LMG 20103]
 gi|327394840|dbj|BAK12262.1| DNA repair protein RecO [Pantoea ananatis AJ13355]
          Length = 245

 Score =  111 bits (278), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 46/237 (19%), Positives = 79/237 (33%), Gaps = 14/237 (5%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVN 57
           M  WQ  A +L  R + E +++L++ +   GR     +  +S R   +  LQ    + V 
Sbjct: 1   MEGWQ-RAFVLHSRPFSETSLLLDLFSESEGRVRVLAKGARSRRSQLKGTLQPFTPLLVR 59

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
           W  R                 A  LS      GL     L R L +  P  EL+      
Sbjct: 60  WSGRGEVKTLRNAEA---VSLALPLSGITLYCGLYVNELLSRVLEQHIPFSELFFDYLQC 116

Query: 118 LNCH-KIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVG 176
           +               + EL LL ++G+G+D   C  +G                  +  
Sbjct: 117 IQMLAAGEGSPEPALRRFELALLGHLGYGVDFLHCAGSGEPVSEAMTYSYREEKGFIASL 176

Query: 177 LPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENF 232
           +                 +  DA++L++A + T     + AL+  +       +E F
Sbjct: 177 VLNQRSFTGRELQALFTREFPDAETLRAAKRFT-----RMALKPYLGGKPLKSQELF 228


>gi|207725213|ref|YP_002255609.1| DNA repair protein RecO [Ralstonia solanacearum MolK2]
 gi|206590447|emb|CAQ37409.1| dna repair protein reco (recombination protein o) [Ralstonia
           solanacearum MolK2]
          Length = 272

 Score =  111 bits (278), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 31/170 (18%), Positives = 54/170 (31%), Gaps = 5/170 (2%)

Query: 4   QDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSR 61
           Q  A +L    Y E ++I++V TR +GR     +  +      + +LQ    + ++W  R
Sbjct: 41  QQPAFVLHSYPYRETSLIIDVFTRDHGRIALVAKGAKRPHSALRAVLQTFQPLSLSWSGR 100

Query: 62  LAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCH 121
                               L     L G      L +F+   +    L+      LN  
Sbjct: 101 GEVKT---LTRAEWVGGMLPLGGEGLLSGFYLNELLVKFVAREDGHAVLFSHYVDTLNKL 157

Query: 122 KIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAV 171
                +       E +LL+  GF   L +C+     Q            +
Sbjct: 158 AHGEPVAFTLRAFERVLLRETGFAAQLDRCIDGEPVQPDGDYVYHPERGI 207


>gi|83748441|ref|ZP_00945463.1| RecO [Ralstonia solanacearum UW551]
 gi|207743588|ref|YP_002259980.1| dna repair protein reco (recombination protein o) [Ralstonia
           solanacearum IPO1609]
 gi|83724852|gb|EAP72008.1| RecO [Ralstonia solanacearum UW551]
 gi|206594987|emb|CAQ61914.1| dna repair protein reco (recombination protein o) [Ralstonia
           solanacearum IPO1609]
          Length = 272

 Score =  111 bits (278), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 31/170 (18%), Positives = 54/170 (31%), Gaps = 5/170 (2%)

Query: 4   QDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSR 61
           Q  A +L    Y E ++I++V TR +GR     +  +      + +LQ    + ++W  R
Sbjct: 41  QQPAFVLHSYPYRETSLIIDVFTRDHGRIALVAKGAKRPHSALRAVLQTFQPLSLSWSGR 100

Query: 62  LAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCH 121
                               L     L G      L +F+   +    L+      LN  
Sbjct: 101 GEVKT---LTRAEWVGGMLPLGGEGLLSGFYLNELLVKFVAREDGHAVLFSHYVDTLNKL 157

Query: 122 KIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAV 171
                +       E +LL+  GF   L +C+     Q            +
Sbjct: 158 AHGEPVAFTLRAFERVLLRETGFAAQLDRCIDGEPVQPDGDYVYHPERGI 207


>gi|52081074|ref|YP_079865.1| DNA repair protein RecO [Bacillus licheniformis ATCC 14580]
 gi|52786454|ref|YP_092283.1| DNA repair protein RecO [Bacillus licheniformis ATCC 14580]
 gi|319644967|ref|ZP_07999200.1| DNA repair protein recO [Bacillus sp. BT1B_CT2]
 gi|81609046|sp|Q65H74|RECO_BACLD RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|52004285|gb|AAU24227.1| RecO [Bacillus licheniformis ATCC 14580]
 gi|52348956|gb|AAU41590.1| RecO [Bacillus licheniformis ATCC 14580]
 gi|317392776|gb|EFV73570.1| DNA repair protein recO [Bacillus sp. BT1B_CT2]
          Length = 256

 Score =  111 bits (278), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 35/179 (19%), Positives = 70/179 (39%), Gaps = 1/179 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M  + + I+L    YGE N I+ ++TR++G+     R  +    +    +   +  ++  
Sbjct: 1   MLTKCEGIVLRTNDYGETNKIITLLTREHGKIGVLARGAKKPNSRLSAISQPFLYASFLF 60

Query: 61  RLAQNLGE-FRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLN 119
           R +  LG   + E++ES         L  Y       + +   E++P   L+++L   + 
Sbjct: 61  RKSSGLGTLEQGEMIESMRNIREDLFLTAYAAYIAELIDKGTEEKKPNPFLFELLLQSMR 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
                +    I   IE+ +L  +G   +L +CV           S +  G +C      
Sbjct: 121 RLNDGTDPDIIANLIEVKMLSVMGLYPELDECVHCKSKDGTFHFSIRDNGFICHRCFAK 179


>gi|227356255|ref|ZP_03840644.1| recombination protein O [Proteus mirabilis ATCC 29906]
 gi|227163719|gb|EEI48635.1| recombination protein O [Proteus mirabilis ATCC 29906]
          Length = 246

 Score =  111 bits (277), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 46/237 (19%), Positives = 76/237 (32%), Gaps = 14/237 (5%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVN 57
           M  WQ  A ++  R Y E +++L+  T   GR     +  +  R   +  LQ    + + 
Sbjct: 1   MEGWQ-RAFVIHARPYSETSLLLDFFTENEGRVRILSKGARGRRSPLKGALQPFTPLLIR 59

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
           W  R                 A  L+ ++   GL     L R L        L+      
Sbjct: 60  WSGRGEIKTLRDAEP---ISLALPLTGTVLYSGLYLNELLSRVLENGTSYSALFFEYLSC 116

Query: 118 LNCH-KIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVG 176
           L       +       + EL LL  +G+GLD   C  +G                  +  
Sbjct: 117 LQILAASETTPEAALRRFELALLTQLGYGLDFLHCAGSGEPVSDTMTYRYREEKGFIASL 176

Query: 177 LPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENF 232
           +        L      + +   A +LK+A + T     + AL+  +       RE F
Sbjct: 177 VVDHYSFTGLELKSLAKREFPTAGTLKAAKRFT-----RMALKPYLGGKPLKSRELF 228


>gi|292489088|ref|YP_003531975.1| DNA repair protein RecO [Erwinia amylovora CFBP1430]
 gi|292900212|ref|YP_003539581.1| DNA repair protein [Erwinia amylovora ATCC 49946]
 gi|291200060|emb|CBJ47186.1| DNA repair protein [Erwinia amylovora ATCC 49946]
 gi|291554522|emb|CBA22090.1| DNA repair protein recO (Recombination protein O) [Erwinia
           amylovora CFBP1430]
          Length = 245

 Score =  111 bits (277), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 45/234 (19%), Positives = 77/234 (32%), Gaps = 13/234 (5%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRS 60
           WQ  A +L  R + E +++L++ + Q GR     +  +S R   +  LQ    + V W  
Sbjct: 4   WQ-RAFVLHGRPWSETSLLLDLFSEQCGRVRVLAKGARSKRSSLKGALQPFTPLLVRWSG 62

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           R                 A  LS +    GL     L R L       EL+      +  
Sbjct: 63  RGEVKTLRAAEP---VSLALPLSGTTLYCGLYVNELLSRVLQHETAFNELFFDYLQCIQT 119

Query: 121 H-KIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                        + EL +L ++G+G+D   C  +G                  +  +  
Sbjct: 120 LAADSGSPEPALRRFELSMLGHLGYGVDFLHCAGSGEEVADSMTYSYREEKGFIASLVAG 179

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENF 232
                          +  DAD+L++A + T     + AL+  +        E F
Sbjct: 180 HRSFSGRQLRALSAREFPDADTLRAAKRFT-----RIALKPYLGGKPLKSSELF 228


>gi|312110186|ref|YP_003988502.1| DNA repair protein RecO [Geobacillus sp. Y4.1MC1]
 gi|311215287|gb|ADP73891.1| DNA repair protein RecO [Geobacillus sp. Y4.1MC1]
          Length = 264

 Score =  111 bits (276), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 31/184 (16%), Positives = 63/184 (34%), Gaps = 1/184 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNW-R 59
           M+ + +AI++    YGE N I+   TR++G+     R  +    +            +  
Sbjct: 1   MFEKCEAIVIRATDYGETNKIVTFFTREWGKVAAMARGAKKPSSRLSAVTQLFTYGYYLI 60

Query: 60  SRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLN 119
            R        + ++++S  A         Y    +    +   E +    L+++L   L 
Sbjct: 61  QRSRGVGVLQQGDIIDSMRATREDIFTAAYASYIVELTDKITEEHQRNPYLFELLLQTLQ 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                  +  +    E  +L  +G    L  C + G T+     S K  G +C       
Sbjct: 121 YMNEGRDLEILASIYETKMLSVMGIPPKLDYCAICGRTEGKFSFSIKEAGFLCHRCEQYD 180

Query: 180 AEKM 183
             ++
Sbjct: 181 PHRI 184


>gi|188533140|ref|YP_001906937.1| DNA repair protein RecO [Erwinia tasmaniensis Et1/99]
 gi|238691986|sp|B2VI48|RECO_ERWT9 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|188028182|emb|CAO96040.1| DNA repair protein RecO [Erwinia tasmaniensis Et1/99]
          Length = 245

 Score =  111 bits (276), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 46/237 (19%), Positives = 80/237 (33%), Gaps = 14/237 (5%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVN 57
           M  WQ  A +L  R + E +++L++ + Q+GR     +  ++ R   +  LQ    + V 
Sbjct: 1   MEGWQ-RAFVLHGRPWSETSLLLDLFSEQHGRVRVLAKGARAKRSSLKGALQPFTPLLVR 59

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
           W  R                 A  LS +    GL     L R L       EL+      
Sbjct: 60  WSGRGEVKTLRSAEP---VSLALPLSGTTLYCGLYVNELLSRVLQHETAFSELFFDYLNC 116

Query: 118 LNCH-KIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVG 176
           +      P        + EL +L ++G+G+D   C  +G                  +  
Sbjct: 117 IQTLAADPPSPEPALRRFELSMLGHLGYGVDFLHCAGSGEEIADGMTYSYREEKGFIASL 176

Query: 177 LPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENF 232
           +                 +  DAD+L++A + T     + AL+  +        E F
Sbjct: 177 VTGHRSFTGRQLRALSTREFPDADTLRAAKRFT-----RIALKPWLGGKPLKSSELF 228


>gi|197285741|ref|YP_002151613.1| DNA repair protein [Proteus mirabilis HI4320]
 gi|238693200|sp|B4F045|RECO_PROMH RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|194683228|emb|CAR43909.1| DNA repair protein [Proteus mirabilis HI4320]
          Length = 246

 Score =  111 bits (276), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 46/237 (19%), Positives = 76/237 (32%), Gaps = 14/237 (5%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVN 57
           M  WQ  A ++  R Y E +++L+  T   GR     +  +  R   +  LQ    + + 
Sbjct: 1   MEGWQ-RAFVIHARPYSETSLLLDFFTENEGRVRILSKGARGRRSPLKGALQPFTPLLIR 59

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
           W  R                 A  L+ ++   GL     L R L        L+      
Sbjct: 60  WSGRGEIKTLRDAEP---ISLALPLTGTVLYSGLYLNELLSRVLENGTSYSTLFFEYLSC 116

Query: 118 LNCH-KIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVG 176
           L       +       + EL LL  +G+GLD   C  +G                  +  
Sbjct: 117 LQILAASETTPEAALRRFELALLTQLGYGLDFLHCAGSGEPVSDTMTYRYREEKGFIASL 176

Query: 177 LPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENF 232
           +        L      + +   A +LK+A + T     + AL+  +       RE F
Sbjct: 177 VVDHYSFTGLELKSLAKREFPTAGTLKAAKRFT-----RMALKPYLGGKPLKSRELF 228


>gi|295399212|ref|ZP_06809194.1| DNA repair protein RecO [Geobacillus thermoglucosidasius C56-YS93]
 gi|294978678|gb|EFG54274.1| DNA repair protein RecO [Geobacillus thermoglucosidasius C56-YS93]
          Length = 264

 Score =  111 bits (276), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 31/184 (16%), Positives = 64/184 (34%), Gaps = 1/184 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNW-R 59
           M+ + +AI++    YGE N I+   TR++G+     R  +    +            +  
Sbjct: 1   MFEKCEAIVIRATDYGETNKIVTFFTREWGKVAAMARGAKKPSSRLSAVTQLFTYGYYLI 60

Query: 60  SRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLN 119
            R        + ++++S  A         Y    +    +   E++    L+++L   L 
Sbjct: 61  QRSRGVGVLQQGDIIDSMRATREDIFTAAYASYIVELTDKITEEQQRNPYLFELLLQTLQ 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                  +  +    E  +L  +G    L  C + G T+     S K  G +C       
Sbjct: 121 YMNEGRDLEILASIYETKMLSVMGIPPKLDYCAICGRTEGKFSFSIKEAGFLCHRCEQYD 180

Query: 180 AEKM 183
             ++
Sbjct: 181 PHRI 184


>gi|296333315|ref|ZP_06875768.1| DNA repair protein RecO [Bacillus subtilis subsp. spizizenii ATCC
           6633]
 gi|305675180|ref|YP_003866852.1| DNA double strand break repair and homologous recombination factor
           [Bacillus subtilis subsp. spizizenii str. W23]
 gi|296149513|gb|EFG90409.1| DNA repair protein RecO [Bacillus subtilis subsp. spizizenii ATCC
           6633]
 gi|305413424|gb|ADM38543.1| DNA double strand break repair and homologous recombination factor
           [Bacillus subtilis subsp. spizizenii str. W23]
          Length = 255

 Score =  111 bits (276), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 28/179 (15%), Positives = 63/179 (35%), Gaps = 1/179 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNW-R 59
           M  + + I+L    YGE N I+ ++TR++G+     R  +    +    +   +  ++  
Sbjct: 1   MLTKCEGIVLRTNDYGETNKIVTLLTREHGKIGVMARGAKKPNSRLSAVSQPFLYGSFLM 60

Query: 60  SRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLN 119
            + +      + E++ S         L  Y       + +   E++P   L++ +     
Sbjct: 61  QKTSGLGTLQQGEMILSMRGIREDLFLTAYAAYIAELVDKGTEEKKPNPYLFEFILESFK 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
                +    I    ++ +L  +G   +L  CV           S +  G +C      
Sbjct: 121 QLDEGTDPDVITFIAQMKMLGVMGLYPELNHCVHCKSQDGTFHFSVRDNGFICHRCFEK 179


>gi|300724128|ref|YP_003713445.1| gap repair protein [Xenorhabdus nematophila ATCC 19061]
 gi|297630662|emb|CBJ91327.1| gap repair protein, part of RecFOR complex that targets RecA to
           ssDNA-dsDNA junction [Xenorhabdus nematophila ATCC
           19061]
          Length = 245

 Score =  111 bits (276), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 46/240 (19%), Positives = 77/240 (32%), Gaps = 13/240 (5%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRS 60
           WQ  A +L  R Y E +++L+  T   GR     +  +S R   +  LQ    + + W  
Sbjct: 4   WQ-RAFVLHGRPYSETSLLLDFFTENEGRVRVLAKGVRSRRSHLKGCLQPFTPLLIRWSG 62

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           R                 A  L+ S+   GL     L R L +      L+      L  
Sbjct: 63  RGEIKTLRDAEP---ISLALPLAGSVLYSGLYVNELLSRVLEQGTAYPALFFDYLQCLQA 119

Query: 121 H-KIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                        + EL LL +IG+G+D   C  +G +                +  +  
Sbjct: 120 LAASDRTPEYALRRFELALLTSIGYGVDYLHCAGSGESVTDTMTYRYREEKGFIASLIID 179

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENFLGKLLE 238
                          +  D  +LK+A +       + AL+  +       RE F   + +
Sbjct: 180 NYSFTGYELKALSLGEFPDGVTLKAAKRFI-----RIALKPYLGGKPLKSRELFRQFVRK 234


>gi|221310451|ref|ZP_03592298.1| DNA repair protein RecO [Bacillus subtilis subsp. subtilis str.
           168]
 gi|221314774|ref|ZP_03596579.1| DNA repair protein RecO [Bacillus subtilis subsp. subtilis str.
           NCIB 3610]
 gi|221319697|ref|ZP_03600991.1| DNA repair protein RecO [Bacillus subtilis subsp. subtilis str.
           JH642]
 gi|221323974|ref|ZP_03605268.1| DNA repair protein RecO [Bacillus subtilis subsp. subtilis str.
           SMY]
 gi|255767577|ref|NP_390406.2| DNA repair protein RecO [Bacillus subtilis subsp. subtilis str.
           168]
 gi|321312010|ref|YP_004204297.1| DNA repair protein RecO [Bacillus subtilis BSn5]
 gi|239938859|sp|P42095|RECO_BACSU RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|225185205|emb|CAB14457.2| DNA double strand break repair and homologous recombination factor
           [Bacillus subtilis subsp. subtilis str. 168]
 gi|320018284|gb|ADV93270.1| DNA repair protein RecO [Bacillus subtilis BSn5]
          Length = 255

 Score =  110 bits (275), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 30/179 (16%), Positives = 65/179 (36%), Gaps = 1/179 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNW-R 59
           M  + + I+L    YGE N I+ ++TR++G+     R  +    +    +   +  ++  
Sbjct: 1   MLTKCEGIVLRTNDYGETNKIVTLLTREHGKIGVMARGAKKPNSRLSAVSQPFLYGSFLM 60

Query: 60  SRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLN 119
            + +      + E++ S         L  Y       + R   E++P   L++ +   L 
Sbjct: 61  QKTSGLGTLQQGEMILSMRGIREDLFLTAYAAYVAELVDRGTEEKKPNPYLFEFILESLK 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
                +    I   +++ +L  +G   +L  CV           S +  G +C      
Sbjct: 121 QLNEGTDPDVITFIVQMKMLGVMGLYPELNHCVHCKSQDGTFHFSVRDNGFICHRCFEK 179


>gi|291484973|dbj|BAI86048.1| DNA repair protein RecO [Bacillus subtilis subsp. natto BEST195]
          Length = 255

 Score =  110 bits (274), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 30/179 (16%), Positives = 65/179 (36%), Gaps = 1/179 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNW-R 59
           M  + + I+L    YGE N I+ ++TR++G+     R  +    +    +   +  ++  
Sbjct: 1   MLTKCEGIVLRTNDYGETNKIVTLLTREHGKIGVMARGAKKPNSRLSAVSQPFLYGSFLM 60

Query: 60  SRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLN 119
            + +      + E++ S         L  Y       + R   E++P   L++ +   L 
Sbjct: 61  QKTSGLGTLQQGEMILSMRGIREDLFLTAYAAYIAELVDRGTEEKKPNPYLFEFILESLK 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
                +    I   +++ +L  +G   +L  CV           S +  G +C      
Sbjct: 121 QLNEGTDPDVITFIVQMKMLGVMGLYPELNHCVHCKSQDGTFHFSVRDNGFICHRCFEK 179


>gi|312173246|emb|CBX81501.1| DNA repair protein recO (Recombination protein O) [Erwinia
           amylovora ATCC BAA-2158]
          Length = 245

 Score =  110 bits (274), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 45/234 (19%), Positives = 77/234 (32%), Gaps = 13/234 (5%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRS 60
           WQ  A +L  R + E +++L++ + Q GR     +  +S R   +  LQ    + V W  
Sbjct: 4   WQ-RAFVLHGRPWSETSLLLDLFSEQCGRVRVLAKGARSKRSSLKGALQPFTPLLVRWSG 62

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           R                 A  LS +    GL     L R L       EL+      +  
Sbjct: 63  RGEVKTLRAAEP---VSLALPLSGTTLYCGLYVNELLSRVLQHETAFSELFFDYLQCIQT 119

Query: 121 H-KIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                        + EL +L ++G+G+D   C  +G                  +  +  
Sbjct: 120 LAADSGSPEPALRRFELSMLGHLGYGVDFLHCAGSGEEVADSMTYSYREEKGFIASLVAG 179

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENF 232
                          +  DAD+L++A + T     + AL+  +        E F
Sbjct: 180 HRSFSGRQLRALSAREFPDADTLRAAKRFT-----RIALKPYLGGKPLKSSELF 228


>gi|254239134|ref|ZP_04932457.1| DNA repair protein RecO [Pseudomonas aeruginosa C3719]
 gi|126171065|gb|EAZ56576.1| DNA repair protein RecO [Pseudomonas aeruginosa C3719]
          Length = 233

 Score =  110 bits (274), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 40/229 (17%), Positives = 74/229 (32%), Gaps = 12/229 (5%)

Query: 8   IILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQNLG 67
            +L  R Y E + +++  T   GR    +R  +  +   + +    +   WR R      
Sbjct: 10  YVLHSRPYKETSALVDFFTP-LGRLRAVLRGARG-KAGALARPFVPLEAEWRGRGELKT- 66

Query: 68  EFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPSVI 127
                +  +    LL+      GL     L R LP  +P  E++      L        I
Sbjct: 67  --VARLESAGIPNLLNGQALFSGLYLNELLIRLLPAEDPQPEIFAHYAATLPLLAAGRPI 124

Query: 128 GKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKMLVLP 187
             +    E  LL+ +G+G  L   +     +  +         +     L     +    
Sbjct: 125 EPLLRAFEWRLLEQLGYGFALDVDIDGRPIEPQVLYQLLPEAGLEPVAQLQ--PGLFQGS 182

Query: 188 SFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHL-LRENFLGK 235
             L   +    A    +A +     L + AL  ++    L  RE F+ +
Sbjct: 183 ELLSMADADWSAPGALAAAKR----LMRQALAPHLGGRPLVSRELFMNR 227


>gi|116048688|ref|YP_792512.1| DNA repair protein RecO [Pseudomonas aeruginosa UCBPP-PA14]
 gi|254245027|ref|ZP_04938349.1| DNA repair protein RecO [Pseudomonas aeruginosa 2192]
 gi|296390878|ref|ZP_06880353.1| DNA repair protein RecO [Pseudomonas aeruginosa PAb1]
 gi|313105594|ref|ZP_07791860.1| DNA repair protein RecO [Pseudomonas aeruginosa 39016]
 gi|122257794|sp|Q02HS4|RECO_PSEAB RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|115583909|gb|ABJ09924.1| DNA repair protein RecO [Pseudomonas aeruginosa UCBPP-PA14]
 gi|126198405|gb|EAZ62468.1| DNA repair protein RecO [Pseudomonas aeruginosa 2192]
 gi|310878362|gb|EFQ36956.1| DNA repair protein RecO [Pseudomonas aeruginosa 39016]
          Length = 233

 Score =  110 bits (274), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 40/229 (17%), Positives = 73/229 (31%), Gaps = 12/229 (5%)

Query: 8   IILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQNLG 67
            +L  R Y E + +++  T   GR    +R  +  +   + +    +   WR R      
Sbjct: 10  YVLHSRPYKETSALVDFFTP-LGRLRAVLRGARG-KAGALARPFVPLEAEWRGRGELKT- 66

Query: 68  EFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPSVI 127
                +  +    LL+      GL     L R LP  +P  E++      L        I
Sbjct: 67  --VARLESAGIPNLLNGQALFSGLYLNELLIRLLPAEDPQPEIFAHYAATLPLLAAGRPI 124

Query: 128 GKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKMLVLP 187
             +    E  LL+ +G+G  L   +     +            +     L     +    
Sbjct: 125 EPLLRAFEWRLLEQLGYGFALDVDIDGRPIEPQALYQLLPEAGLEPVAQLQ--PGLFQGS 182

Query: 188 SFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHL-LRENFLGK 235
             L   +    A    +A +     L + AL  ++    L  RE F+ +
Sbjct: 183 ELLSMADADWSAPGALAAAKR----LMRQALAPHLGGRPLVSRELFMNR 227


>gi|306837524|ref|ZP_07470399.1| DNA repair protein RecO [Brucella sp. NF 2653]
 gi|306407416|gb|EFM63620.1| DNA repair protein RecO [Brucella sp. NF 2653]
          Length = 182

 Score =  109 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 66/176 (37%), Positives = 96/176 (54%), Gaps = 1/176 (0%)

Query: 66  LGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPS 125
           +G F  E L    A+L+ + + LYG+Q      R LPER+P   LY+ L + +     P 
Sbjct: 1   MGTFTIEPLGFAAARLIETPVALYGIQLAAAHLRLLPERDPHRGLYETLRLIIEHFDDPL 60

Query: 126 VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKMLV 185
             G++ ++ E+M+L+ +GFGLDL +C  TG   DL++VSPKSG AVCR  G P+A+K+L 
Sbjct: 61  AAGELLLRFEVMMLEELGFGLDLKECAATGRKDDLIYVSPKSGRAVCREAGAPWADKLLA 120

Query: 186 LPSFLWKEEQTID-ADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLELI 240
           LPSF+          D L  AF +T YFL ++  +         R  FL  +   I
Sbjct: 121 LPSFVNDTALRASCYDDLDRAFTMTGYFLMRHVWEPRAQTPPDSRSGFLNAVGRAI 176


>gi|1303827|dbj|BAA12483.1| YqfI [Bacillus subtilis]
          Length = 255

 Score =  109 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 30/179 (16%), Positives = 65/179 (36%), Gaps = 1/179 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNW-R 59
           M  + + I+L    YGE N I+ ++TR++G+     R  +    +    +   +  ++  
Sbjct: 1   MLTKCEGIVLRTNDYGETNKIVTLLTREHGKIGVMARGAKKPNSRLSAVSQPFLYGSFLM 60

Query: 60  SRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLN 119
            + +      + E++ S         L  Y       + R   E++P   L++ +   L 
Sbjct: 61  QKTSGLGTLQQGEMILSMRGIREDLFLTAYAAYVAELVDRGTEEKKPNPYLFEFILESLK 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
                +    I   +++ +L  +G   +L  CV           S +  G +C      
Sbjct: 121 QMNEGTDPDVITFIVQMKMLGVMGLYPELNHCVHCKSQDGTFHFSVRDNGFICHRCFEK 179


>gi|295695441|ref|YP_003588679.1| DNA repair protein RecO [Bacillus tusciae DSM 2912]
 gi|295411043|gb|ADG05535.1| DNA repair protein RecO [Bacillus tusciae DSM 2912]
          Length = 261

 Score =  109 bits (273), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 30/157 (19%), Positives = 57/157 (36%), Gaps = 2/157 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQS--HRMQPILQAGNLVRVNW 58
           M  Q + I+L    YGE + I+ ++T + G+     R  +    R++ ++Q       + 
Sbjct: 1   MNVQVEGIVLRGVDYGETHRIVTLLTPEIGKVGAMARGAKRPQSRLRALVQPLVRGTFSL 60

Query: 59  RSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFL 118
             R        + + LE + A         Y   +   + RF+ E  P   +Y+    +L
Sbjct: 61  AYRGQGMAIIRQGQWLEGYRAIQEDLWKHAYAGYAAELVDRFVEEATPDPGVYEFFRQWL 120

Query: 119 NCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTG 155
                      +    EL + +  G    L +C   G
Sbjct: 121 EALAAGKDAEILTRLFELHVCEWAGVRPVLDRCAGCG 157


>gi|145300359|ref|YP_001143200.1| DNA repair protein RecO [Aeromonas salmonicida subsp. salmonicida
           A449]
 gi|142853131|gb|ABO91452.1| DNA repair protein RecO [Aeromonas salmonicida subsp. salmonicida
           A449]
          Length = 235

 Score =  109 bits (273), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 46/235 (19%), Positives = 77/235 (32%), Gaps = 11/235 (4%)

Query: 5   DDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRL 62
             A ++  R Y E + ++EV T+  GR     R  +  R   + +LQ  +L+ ++WR + 
Sbjct: 3   SPAFVIHSRPYRETSQLVEVFTQDSGRFTLVARGSRGPRSPLKGLLQPFSLLTISWRGKG 62

Query: 63  AQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHK 122
                        S     L      YGL     ++  L    P  E++D     L    
Sbjct: 63  DLKNLAQVECPDHS---LRLGGDRLFYGLYLNELVYYLLEAHTPFPEVFDAYARALMALA 119

Query: 123 IPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGV-TQDLLWVSPKSGGAVCRSVGLPYAE 181
                     + E +LL+ +G+ +D           Q  L    +           P   
Sbjct: 120 DGETPELPLRRFEFLLLQALGYAVDFEYAADDESAIQPELLYGFERELGFVACERAPDPR 179

Query: 182 KMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHN-IIHCHLLRENFLGK 235
            + +    L   E   D   L  A +      ++ ALQ          RE FL +
Sbjct: 180 TLFLGAHLLAFAEGRFDTPPLLQAAKR----FSRLALQPYLGRRQLKSRELFLKR 230


>gi|330828484|ref|YP_004391436.1| DNA repair protein RecO [Aeromonas veronii B565]
 gi|328803620|gb|AEB48819.1| DNA repair protein RecO [Aeromonas veronii B565]
          Length = 236

 Score =  109 bits (273), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 44/235 (18%), Positives = 75/235 (31%), Gaps = 11/235 (4%)

Query: 5   DDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRL 62
             A ++  R Y E + ++EV T+  GR     R  +  R   + +LQ   L+ + WR + 
Sbjct: 3   TPAFVIHSRPYRETSQLVEVFTQDSGRFTLVARGSRGPRSPLKGLLQPFTLLTIAWRGKG 62

Query: 63  AQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHK 122
                        S     L      YGL     ++  L    P  E++D     +    
Sbjct: 63  DLKNLTQVECPDHS---LRLGGDRLFYGLYLNELVYYLLEAHTPFPEVFDAYARAIMALA 119

Query: 123 IPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGV-TQDLLWVSPKSGGAVCRSVGLPYAE 181
                     + E +LL+ +G+ +D           +  L    +           P   
Sbjct: 120 DGETPELPLRRFEFLLLQALGYAVDFEYTADDESPIEPTLLYGFERELGFVACERAPDPR 179

Query: 182 KMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHN-IIHCHLLRENFLGK 235
            + +    L   E   D   L  A +      ++ ALQ          RE FL +
Sbjct: 180 TLFLGAHLLAFAEGRFDTPPLLQAAKR----FSRLALQPYLGKRQLKSRELFLKR 230


>gi|15595969|ref|NP_249463.1| DNA repair protein RecO [Pseudomonas aeruginosa PAO1]
 gi|107100233|ref|ZP_01364151.1| hypothetical protein PaerPA_01001256 [Pseudomonas aeruginosa PACS2]
 gi|218893285|ref|YP_002442154.1| DNA repair protein RecO [Pseudomonas aeruginosa LESB58]
 gi|12644687|sp|Q9XCX7|RECO_PSEAE RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|226737868|sp|B7UYX0|RECO_PSEA8 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|9946661|gb|AAG04161.1|AE004512_4 DNA repair protein RecO [Pseudomonas aeruginosa PAO1]
 gi|218773513|emb|CAW29325.1| DNA repair protein RecO [Pseudomonas aeruginosa LESB58]
          Length = 233

 Score =  109 bits (273), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 40/229 (17%), Positives = 73/229 (31%), Gaps = 12/229 (5%)

Query: 8   IILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQNLG 67
            +L  R Y E + +++  T   GR    +R  +  +   + +    +   WR R      
Sbjct: 10  YVLHSRPYKETSALVDFFTP-LGRLRAVLRGARG-KAGALARPFVPLEAEWRGRGELKT- 66

Query: 68  EFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPSVI 127
                +  +    LL+      GL     L R LP  +P  E++      L        I
Sbjct: 67  --VARLESAGVPNLLNGQALFSGLYLNELLIRLLPAEDPQPEIFAHYAATLPLLAAGRPI 124

Query: 128 GKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKMLVLP 187
             +    E  LL+ +G+G  L   +     +            +     L     +    
Sbjct: 125 EPLLRAFEWRLLEQLGYGFALDVDIDGRPIEPQALYQLLPEAGLEPVAQLQ--PGLFQGS 182

Query: 188 SFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHL-LRENFLGK 235
             L   +    A    +A +     L + AL  ++    L  RE F+ +
Sbjct: 183 ELLSMADADWSAPGALAAAKR----LMRQALAPHLGGRPLVSRELFMNR 227


>gi|172056863|ref|YP_001813323.1| DNA repair protein RecO [Exiguobacterium sibiricum 255-15]
 gi|229485534|sp|B1YL74|RECO_EXIS2 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|171989384|gb|ACB60306.1| DNA repair protein RecO [Exiguobacterium sibiricum 255-15]
          Length = 249

 Score =  109 bits (272), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 40/182 (21%), Positives = 73/182 (40%), Gaps = 1/182 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M  + + ++L    YGE N I+ ++TR+YG+     R  +    +    +   VR  +  
Sbjct: 1   MIDKAEGLVLRTVVYGESNKIITLLTREYGKLAVMARGAKKPGSRFNAASQPFVRAIYVY 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFL-YGLQSIVPLFRFLPEREPCLELYDMLNIFLN 119
             ++ LG+ +   + +  +K+      + Y +  +    + L ER P   LYD+    L 
Sbjct: 61  PRSRGLGQLKSADVITGYSKIRQDVFLMAYAMYLLELADKALDERVPQPALYDLFVDGLE 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                     +   +EL LL+++G    L  C V G  +     S   GG +CR      
Sbjct: 121 AMDEGLDPDVVSFIVELRLLRHLGIAPHLNGCTVCGSVEAPFAFSLNHGGLLCRRHRQED 180

Query: 180 AE 181
             
Sbjct: 181 EH 182


>gi|212638695|ref|YP_002315215.1| DNA repair protein RecO [Anoxybacillus flavithermus WK1]
 gi|212560175|gb|ACJ33230.1| Recombinational DNA repair protein (RecF pathway) [Anoxybacillus
           flavithermus WK1]
          Length = 268

 Score =  109 bits (272), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 36/191 (18%), Positives = 65/191 (34%), Gaps = 1/191 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVR-VNWR 59
           M+ + + I++    YGE N I+ + TR++G+     R  +    +           +   
Sbjct: 16  MFEKCEGIVIRTIDYGETNKIVTIFTREWGKVAAMARGAKKPSSRLSSVTQIFTYGIFLI 75

Query: 60  SRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLN 119
            +        + E+L +         L  Y    I    +   ER P   L+++L   L 
Sbjct: 76  QKSRGVGSLHQGELLSTMRHIREDIFLTAYASYIIELTDKATEERRPNPYLFELLLQTLT 135

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                     +    E+ LL   G    L  C + G  +     S   GG +C       
Sbjct: 136 YMNEGLDAEVLTYIYEMKLLPAFGLYPKLDGCAICGEKEGTFAFSIAQGGFLCHRCFEHD 195

Query: 180 AEKMLVLPSFL 190
             ++ + PS L
Sbjct: 196 PHRIPMTPSVL 206


>gi|306845265|ref|ZP_07477841.1| DNA repair protein RecO [Brucella sp. BO1]
 gi|306274424|gb|EFM56231.1| DNA repair protein RecO [Brucella sp. BO1]
          Length = 182

 Score =  109 bits (272), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 67/176 (38%), Positives = 96/176 (54%), Gaps = 1/176 (0%)

Query: 66  LGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPS 125
           +G F  E L    A+L+ + + LYG+Q      R LPER+P   LY+ L + +     P 
Sbjct: 1   MGTFTIEPLSFAAARLIETPVALYGIQLAAAHLRLLPERDPHRGLYETLRLIIEHFDDPL 60

Query: 126 VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKMLV 185
             G++ ++ E+M+L+ +GFGLDL +C  TG   DL++VSPKSG AVCR  G P+AEK+L 
Sbjct: 61  AAGELLLRFEVMMLEELGFGLDLKECAATGRKDDLIYVSPKSGRAVCREAGAPWAEKLLS 120

Query: 186 LPSFLWKEEQTID-ADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLELI 240
           LPSF+          D L  AF +T YFL ++  +         R  FL  +   I
Sbjct: 121 LPSFVNDTALRASCYDDLDRAFTMTGYFLMRHVWEPRAQTPPDSRSGFLNAVGRAI 176


>gi|241662607|ref|YP_002980967.1| DNA repair protein RecO [Ralstonia pickettii 12D]
 gi|309781189|ref|ZP_07675926.1| DNA repair protein RecO [Ralstonia sp. 5_7_47FAA]
 gi|240864634|gb|ACS62295.1| DNA repair protein RecO [Ralstonia pickettii 12D]
 gi|308920010|gb|EFP65670.1| DNA repair protein RecO [Ralstonia sp. 5_7_47FAA]
          Length = 273

 Score =  109 bits (271), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 30/168 (17%), Positives = 51/168 (30%), Gaps = 5/168 (2%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLA 63
            A +L    Y E ++I++V T  YGR     +  +      + +LQ    + ++W  R  
Sbjct: 43  PAFVLHSYPYRETSLIIDVFTPDYGRMALVAKGAKRPHSALRAVLQTFQPLSLSWSGRGD 102

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKI 123
                             L     L G      L +F+   +    L+      LN    
Sbjct: 103 VRT---LTRAEWVGGMLPLGGEGLLSGFYLNELLVKFVAREDGHPVLFAHYVETLNKLAH 159

Query: 124 PSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAV 171
                      E +LL+  GF   L +C+     Q            +
Sbjct: 160 GEPAAFTLRAFERVLLRETGFAAQLDRCIDGEPVQADAEYVYHPERGI 207


>gi|187928025|ref|YP_001898512.1| DNA repair protein RecO [Ralstonia pickettii 12J]
 gi|187724915|gb|ACD26080.1| DNA repair protein RecO [Ralstonia pickettii 12J]
          Length = 273

 Score =  109 bits (271), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 30/168 (17%), Positives = 51/168 (30%), Gaps = 5/168 (2%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLA 63
            A +L    Y E ++I++V T  YGR     +  +      + +LQ    + ++W  R  
Sbjct: 43  PAFVLHSYPYRETSLIIDVFTPDYGRMALVAKGAKRPHSALRAVLQTFQPLSLSWSGRGD 102

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKI 123
                             L     L G      L +F+   +    L+      LN    
Sbjct: 103 VRT---LTRAEWVGGMLPLGGEGLLSGFYLNELLVKFVAREDGHPVLFAHYVETLNKLAH 159

Query: 124 PSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAV 171
                      E +LL+  GF   L +C+     Q            +
Sbjct: 160 GEPAAFTLRAFERVLLRETGFAAQLDRCIDGEPVQADAEYVYHPERGI 207


>gi|53804479|ref|YP_113918.1| DNA repair protein RecO [Methylococcus capsulatus str. Bath]
 gi|67461356|sp|Q608M9|RECO_METCA RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|53758240|gb|AAU92531.1| DNA repair protein RecO [Methylococcus capsulatus str. Bath]
          Length = 242

 Score =  109 bits (271), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 46/230 (20%), Positives = 78/230 (33%), Gaps = 10/230 (4%)

Query: 5   DDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNWRSRL 62
           D A +L  R Y E +++LE+ T ++GR     +  +  R     +LQ    + V+W  R 
Sbjct: 17  DHAYLLHRRDYRETSLLLELFTLRHGRIGVIAKGARRGRQGFAAVLQPFVPLLVSWSGRG 76

Query: 63  AQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHK 122
                        +     L  +    G      L R LP  +PC EL+      L    
Sbjct: 77  ELANLNHAEA---AGIGVRLQHTALFCGFYLNELLMRLLPPHDPCPELFGTYRGGLETLA 133

Query: 123 IPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEK 182
               +       EL LL+ IG+GL L     +G       +      A         A+ 
Sbjct: 134 AGEDLETALRSFELSLLEAIGYGLQLRVEAESGEAIRPERLYSYRIDAG-PVPAGDEADA 192

Query: 183 MLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENF 232
           +  +     ++ +   + +   A +L    + +    H        RE F
Sbjct: 193 VHGMTLLALRDRRFDTSQTRTEAKRL----MRRIIAHHLNGRALKSRELF 238


>gi|239996016|ref|ZP_04716540.1| DNA repair protein RecO [Alteromonas macleodii ATCC 27126]
          Length = 237

 Score =  109 bits (271), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 37/234 (15%), Positives = 69/234 (29%), Gaps = 15/234 (6%)

Query: 7   AIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNWRSRLAQ 64
           A +L  R Y E + I++  T + GR     +  ++ +   + +LQ    +R+    +   
Sbjct: 8   AYVLHRRPYRETSYIVDFFTLEEGRVSAVAKGVKNSKSDKKSLLQPFQHLRLQLSGKSEL 67

Query: 65  NLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIP 124
                         +  L  +     +       R +P       +++     L   +  
Sbjct: 68  KNLRHVES---VSPSINLVGTALFCAMYVNELTNRVMPAGLASDGVHNAYENALLSLRDE 124

Query: 125 SVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGA----VCRSVGLPYA 180
             I     Q E  LL  +G   D T  V   +  +          A    +   +  P  
Sbjct: 125 CDIEVTLRQFEFALLDEMGLLPDFTTDVEYEMPIEETGSYNFQIDAGFVPIPEDMAGPRG 184

Query: 181 EKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENFL 233
            +     + L   +      S K A  L         L+  I       RE F+
Sbjct: 185 MRGFPGQALLSLSQGEFTPLSKKVAKVLCRD-----LLKPLIGEKPLKSRELFM 233


>gi|117618822|ref|YP_855345.1| DNA repair protein RecO [Aeromonas hydrophila subsp. hydrophila
           ATCC 7966]
 gi|117560229|gb|ABK37177.1| DNA repair protein RecO [Aeromonas hydrophila subsp. hydrophila
           ATCC 7966]
          Length = 235

 Score =  109 bits (271), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 45/235 (19%), Positives = 76/235 (32%), Gaps = 11/235 (4%)

Query: 5   DDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRL 62
             A ++  R Y E + ++EV T+  GR     R  +  R   + +LQ   L+ + WR + 
Sbjct: 3   TPAFVIHSRPYRETSQLVEVFTQDSGRFTLVARGSRGPRSPLKGLLQPFTLLTIAWRGKG 62

Query: 63  AQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHK 122
                        S     L      YGL     ++  L    P  E++D     +    
Sbjct: 63  DLKNLTQVECPDHS---LRLGGDRLFYGLYLNELVYYLLEAHTPFPEVFDAYARTIMALA 119

Query: 123 IPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGV-TQDLLWVSPKSGGAVCRSVGLPYAE 181
                     + E +LL+ +G+ +D           Q  L    +           P   
Sbjct: 120 DGETPELPLRRFEFLLLQALGYAVDFEYAADDESPIQPELLYGFERELGFVACERAPDPR 179

Query: 182 KMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHN-IIHCHLLRENFLGK 235
            + +    L   E   D+  L  A +      ++ ALQ          RE FL +
Sbjct: 180 TLFLGAHLLAFAEGHFDSPPLLQAAKR----FSRLALQPYLGRRQLKSRELFLKR 230


>gi|332140213|ref|YP_004425951.1| DNA repair protein RecO [Alteromonas macleodii str. 'Deep ecotype']
 gi|254790504|sp|B4RXN1|RECO_ALTMD RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|327550235|gb|AEA96953.1| DNA repair protein RecO [Alteromonas macleodii str. 'Deep ecotype']
          Length = 234

 Score =  109 bits (271), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 37/233 (15%), Positives = 74/233 (31%), Gaps = 12/233 (5%)

Query: 7   AIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNWRSRLAQ 64
           A +L  R Y E + I++  + + GR     +  ++ +   + +LQ    +R+    +   
Sbjct: 8   AYVLHRRPYRETSYIVDFFSLEEGRISAVAKGVKNSKSDKKSLLQPFQHLRLQLSGKSDL 67

Query: 65  NLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIP 124
                   V     +  L+ +     +       R +P+      +Y      L   +  
Sbjct: 68  KNLRHVESVA---PSISLTGTALFCAMYVNELTNRIMPQGLASDGVYSAYEAALLALRDE 124

Query: 125 SVIGKIFVQIELMLLKNIGFGLDLTKCVVTGV-TQDLLWVSPKSGGAVCRSVGLPYAEKM 183
           + I     Q+E  LL  +G   D T  V   +  ++      +      +        + 
Sbjct: 125 ADIEVTLRQLEFALLDEMGLLPDFTSDVEYEMPIEENGRYHFQLDAGFIQIPDDVVGARG 184

Query: 184 LVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENFLGK 235
           +   + L   +      S K A  L         L+  I       RE F+ K
Sbjct: 185 IPGTALLSLSQGEFTPLSKKVAKVLCRD-----LLKPLIGDKPLKSRELFMTK 232


>gi|167837345|ref|ZP_02464228.1| DNA repair protein RecO [Burkholderia thailandensis MSMB43]
          Length = 237

 Score =  108 bits (270), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 34/234 (14%), Positives = 75/234 (32%), Gaps = 11/234 (4%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLA 63
              +L    Y E +++++V+TR +GR     +  +      + +LQ    + ++W  +  
Sbjct: 8   PGFVLHSYPYRETSLVVDVLTRDHGRIALVAKGAKRPHSALRGVLQTFQPLSLSWSGKSE 67

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKI 123
                             L+    L G      L +F    +P   L+    + L     
Sbjct: 68  LRT---LTGAEWVGGMLPLAGDALLCGFYVNELLVKFCAREDPHPPLFQHYLVTLTRLAH 124

Query: 124 PSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAE-K 182
                ++    E +LL+  G+ + L + V     +            VC +     +   
Sbjct: 125 GEPPVQVLRSFERVLLRETGYAMTLKRTVARRAVEPGRLYVFDPQRGVCDAGSDVPSHWP 184

Query: 183 MLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLL-RENFLGK 235
           ++   + L  EE         +  +     L ++ L   +    L  R+  +  
Sbjct: 185 VIAGQTLLDMEEDDYHRAQTVAQSKT----LMRFLLNTYLGGTPLATRQILIDL 234


>gi|153824252|ref|ZP_01976919.1| DNA repair protein RecO [Vibrio cholerae B33]
 gi|126518226|gb|EAZ75451.1| DNA repair protein RecO [Vibrio cholerae B33]
          Length = 160

 Score =  108 bits (270), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 30/150 (20%), Positives = 52/150 (34%), Gaps = 5/150 (3%)

Query: 8   IILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLAQN 65
            +L  R Y E ++IL+V + +YGR     +  +  R   +  LQ    + + W    +  
Sbjct: 9   FVLHRRPYSESSLILDVFSEEYGRVTLMAKGARGKRSNLKGALQPFTPLLLKWSGNGS-- 66

Query: 66  LGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPS 125
             +   +         LS       +     + R L        L+      L      +
Sbjct: 67  -MKTLRQAEPISLGLPLSGVYLYSAMYINELVDRVLMPEVASPGLFHDYLFALTELAQST 125

Query: 126 VIGKIFVQIELMLLKNIGFGLDLTKCVVTG 155
                  + EL LL  +G+G+D   C  TG
Sbjct: 126 NPEPALRRFELALLAAMGYGVDFLHCAGTG 155


>gi|152985424|ref|YP_001350089.1| DNA repair protein RecO [Pseudomonas aeruginosa PA7]
 gi|166221905|sp|A6VAK4|RECO_PSEA7 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|150960582|gb|ABR82607.1| DNA repair protein RecO [Pseudomonas aeruginosa PA7]
          Length = 233

 Score =  108 bits (269), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 39/229 (17%), Positives = 72/229 (31%), Gaps = 12/229 (5%)

Query: 8   IILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQNLG 67
            +L  R Y E + +++  T   GR    +R  +  +   + +    +   WR R      
Sbjct: 10  YVLHSRPYKETSALVDFFTA-QGRLRAVLRGARG-KAGALARPFVPLEAEWRGRGELKT- 66

Query: 68  EFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPSVI 127
                +  +    LLS      GL     L R LP  +P  E++      L        +
Sbjct: 67  --VARLESAGIPNLLSGQALFSGLYLNELLIRLLPAEDPQPEIFAHYAATLPLLAAGRPL 124

Query: 128 GKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKMLVLP 187
             +    E  LL+ +G+G  L   +     +            +           +    
Sbjct: 125 EPLLRAFEWRLLEQLGYGFALDVDIHGRPIEPQALYQLLPEAGL--EPVTQLQPGLFQGV 182

Query: 188 SFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHL-LRENFLGK 235
             L   +    A    +A +     L + AL  ++    L  RE F+ +
Sbjct: 183 ELLSMADADWSAPGALAAAKR----LMRQALAPHLGGRPLVSRELFMNR 227


>gi|253576084|ref|ZP_04853416.1| DNA repair protein RecO [Paenibacillus sp. oral taxon 786 str. D14]
 gi|251844427|gb|EES72443.1| DNA repair protein RecO [Paenibacillus sp. oral taxon 786 str. D14]
          Length = 249

 Score =  108 bits (269), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 43/192 (22%), Positives = 74/192 (38%), Gaps = 2/192 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQ--PILQAGNLVRVNW 58
           M ++ + I++    YGE N I+ + T   G+    VR  +  + +   + Q        +
Sbjct: 1   MLYRVEGIVIRSMDYGEGNKIITLCTETSGKIGVLVRGAKKVKSRHGALTQPFTHGEYVF 60

Query: 59  RSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFL 118
             +        + E++ESH +      L  Y   +   L + L + E     +  L   L
Sbjct: 61  FRQNGGLGTLNQGEMIESHFSLREDLFLAAYASYACELLDKTLQDEEVGSFWFTQLKACL 120

Query: 119 NCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
           +          +    E+ +L+  G+G     CV  G   D  +VSP+ GG +CRS    
Sbjct: 121 DGLSSGKDPQIVTHLFEMKILQAAGYGPSFESCVSCGRVDDSPYVSPRLGGRLCRSCRHQ 180

Query: 179 YAEKMLVLPSFL 190
               M V P  L
Sbjct: 181 DPAAMQVTPGVL 192


>gi|327479796|gb|AEA83106.1| DNA repair protein RecO [Pseudomonas stutzeri DSM 4166]
          Length = 229

 Score =  107 bits (268), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 38/231 (16%), Positives = 71/231 (30%), Gaps = 12/231 (5%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQN 65
            A +L  R Y E + ++++ T   GR    +R  +  +   +++    + V  R +    
Sbjct: 4   PAFVLHSRPYKESSALVDLFTP-QGRLRAVMRAARG-KAGSLIRPFVSLEVELRGKSELK 61

Query: 66  LGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPS 125
                  +  +  A  L       G+     L R LP  +    L++     L       
Sbjct: 62  T---VARLESAGPAHWLDGQALFSGMYLNELLIRLLPAEDAHPALFEHYVATLPALAEHR 118

Query: 126 VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKMLV 185
            +  +    E  LL  +G+G  L   +                  +   VG         
Sbjct: 119 PLEPLLRAFEWRLLDELGYGFALDIDIAGQPIDAQRLYRLVPDAGLEPVVGFQ-PGLFNG 177

Query: 186 LPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHL-LRENFLGK 235
                  E       +L +A +     L + AL  ++    L  RE F+  
Sbjct: 178 AELLAMAEADWQVPGALAAAKR-----LMRQALAPHLGGRPLVSRELFMNL 223


>gi|146281617|ref|YP_001171770.1| DNA repair protein RecO [Pseudomonas stutzeri A1501]
 gi|172045571|sp|A4VIX7|RECO_PSEU5 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|145569822|gb|ABP78928.1| DNA repair protein RecO [Pseudomonas stutzeri A1501]
          Length = 236

 Score =  107 bits (268), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 38/231 (16%), Positives = 71/231 (30%), Gaps = 12/231 (5%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQN 65
            A +L  R Y E + ++++ T   GR    +R  +  +   +++    + V  R +    
Sbjct: 11  PAFVLHSRPYKESSALVDLFTP-QGRLRAVMRAARG-KAGSLIRPFVSLEVELRGKSELK 68

Query: 66  LGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPS 125
                  +  +  A  L       G+     L R LP  +    L++     L       
Sbjct: 69  T---VARLESAGPAHWLDGQALFSGMYLNELLIRLLPAEDAHPALFEHYVATLPALAEHR 125

Query: 126 VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKMLV 185
            +  +    E  LL  +G+G  L   +                  +   VG         
Sbjct: 126 PLEPLLRAFEWRLLDELGYGFALDIDIAGQPIDAQRLYRLVPDAGLEPVVGFQ-PGLFNG 184

Query: 186 LPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHL-LRENFLGK 235
                  E       +L +A +     L + AL  ++    L  RE F+  
Sbjct: 185 AELLAMAEADWQVPGALAAAKR-----LMRQALAPHLGGRPLVSRELFMNL 230


>gi|153839962|ref|ZP_01992629.1| DNA repair protein RecO [Vibrio parahaemolyticus AQ3810]
 gi|149746521|gb|EDM57510.1| DNA repair protein RecO [Vibrio parahaemolyticus AQ3810]
          Length = 162

 Score =  107 bits (268), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 31/150 (20%), Positives = 54/150 (36%), Gaps = 5/150 (3%)

Query: 8   IILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLAQN 65
            +L  R Y E ++IL+V + +YGR     +  +S R   +  LQ    + + W  + +  
Sbjct: 13  FVLHRRPYSESSLILDVFSEEYGRITLMAKGARSKRSNLKGALQPFTPLLLKWSGKGS-- 70

Query: 66  LGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPS 125
             +   +         L        +     + R L    P   L+      L       
Sbjct: 71  -MKTLRQAEPISLGLPLFGINLYSAMYVNELVGRVLMAEVPMPALFHDYLHALTELAQCE 129

Query: 126 VIGKIFVQIELMLLKNIGFGLDLTKCVVTG 155
                  + EL LL ++G+G+D   C  TG
Sbjct: 130 NPEPALRRFELALLSSMGYGVDFLHCAGTG 159


>gi|288941440|ref|YP_003443680.1| DNA repair protein RecO [Allochromatium vinosum DSM 180]
 gi|288896812|gb|ADC62648.1| DNA repair protein RecO [Allochromatium vinosum DSM 180]
          Length = 243

 Score =  107 bits (268), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 40/229 (17%), Positives = 73/229 (31%), Gaps = 12/229 (5%)

Query: 7   AIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLAQ 64
           A +L  R YG  +++LE++    GR     +  +  R     +LQ    + +    R   
Sbjct: 10  AFVLHRREYGNTSLLLEILGAGQGRCAAIAKGARRPRRTASALLQPFQPLWLAMTGRGEV 69

Query: 65  NLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIP 124
                   V E+     L  +  L G      L R L   +P   L+      L+     
Sbjct: 70  RT---LTVVEEAGAPLALQGASLLAGFYLNELLLRMLARHDPHDALFVFYQSTLSHLAEA 126

Query: 125 SVIGKIFVQIELMLLKNIGFGLDLTKCVVTGV-TQDLLWVSPKSGGAVCRSVGLPYAEKM 183
             +       E  LL  +G+GL L + V  G           +     C   G     ++
Sbjct: 127 DDLETPLRHFECRLLAELGYGLRLDRVVDDGAPVTADAVYVYERERGPCYPSGPARGPRV 186

Query: 184 LVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLREN 231
                     ++ +  +  + A       L ++ L+ ++       RE 
Sbjct: 187 SGATLLALAHDEPLAGEQRREART-----LLRHVLEPHLGDRPLKSREL 230


>gi|328554262|gb|AEB24754.1| DNA repair protein RecO [Bacillus amyloliquefaciens TA208]
 gi|328912659|gb|AEB64255.1| DNA double strand break repair and recombination factor [Bacillus
           amyloliquefaciens LL3]
          Length = 255

 Score =  107 bits (268), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 29/179 (16%), Positives = 64/179 (35%), Gaps = 1/179 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNW-R 59
           M  + + I+L    YGE N I+ ++TR++G+     R  +    +    +   +  ++  
Sbjct: 1   MLTKCEGIVLRTNDYGETNKIVTLLTREHGKIGVMARGARKSASRLSAVSQPFLYGSFLM 60

Query: 60  SRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLN 119
            R +      + E++ S         L  Y         +   E++P   L++++     
Sbjct: 61  QRTSGLGTLQQGEMILSMRTIREDLFLTAYAAFIAELTDKGTEEKKPNPYLFELILESFK 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
                +    I   +++ +L  +G   +L  CV           S +  G +C      
Sbjct: 121 RLNEGTDPDVITFIVQMKMLGVMGLYPELNHCVHCKSRDGTFHFSVRDNGFICHRCFGK 179


>gi|312795544|ref|YP_004028466.1| DNA repair protein recO [Burkholderia rhizoxinica HKI 454]
 gi|312167319|emb|CBW74322.1| DNA repair protein recO [Burkholderia rhizoxinica HKI 454]
          Length = 308

 Score =  107 bits (268), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 39/238 (16%), Positives = 72/238 (30%), Gaps = 15/238 (6%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLA 63
              +L    Y E ++I++V TR +GR     +  +      + +LQ    + ++W  +  
Sbjct: 75  PGFVLHTYPYRETSLIIDVFTRMHGRLALVAKGAKRPHSALRGVLQTFQPLALSWTGKSE 134

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKI 123
                           + L+    L G      L RF    +P   L+D   + L     
Sbjct: 135 ---MRTLTRAEWVGGMRPLAGDALLCGFYVNELLVRFCAREDPHTALFDHYLLTLTRLAH 191

Query: 124 PSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKM 183
                ++    E +LL+  G+ + L + V                  VC    L      
Sbjct: 192 DEPAVQVLRSFERVLLRETGYAMSLDRTVARQNVVAGRSYVFDPERGVCDVEMLEPDAHA 251

Query: 184 LVLPS-----FLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLL-RENFLGK 235
           L  P       L  E          +  +     L ++ L   +    L  R+  +  
Sbjct: 252 LRGPVIAGQTLLDMERDDYSRAQTVAQSKT----LMRFLLNTYLGGAPLATRQILIDL 305


>gi|148263002|ref|YP_001229708.1| DNA repair protein RecO [Geobacter uraniireducens Rf4]
 gi|189039657|sp|A5GBB7|RECO_GEOUR RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|146396502|gb|ABQ25135.1| DNA replication and repair protein RecO [Geobacter uraniireducens
           Rf4]
          Length = 244

 Score =  107 bits (268), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 31/156 (19%), Positives = 64/156 (41%), Gaps = 3/156 (1%)

Query: 2   YWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQ--PILQAGNLVRVNWR 59
             Q +AI+LGV  YGE + I+ + T ++G+  G  R+ +  R +    L+    +R++  
Sbjct: 3   NIQCEAIVLGVMDYGEADKIVTLFTLEHGKLKGLARSAKKSRKRFGGALEPFARLRLHLA 62

Query: 60  SRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLN 119
            ++  +      +++              +   +   + R +PE E    L+ +L  +L+
Sbjct: 63  MKVGLST-LNGADIVTIFPHIRQDLVKIGHAAYACELVERLVPEAEQNHRLFRLLAAYLD 121

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTG 155
                          E  LLK +G+   L++C    
Sbjct: 122 HLDQFQHDPSDRRFFEANLLKVVGYQPALSRCAACD 157


>gi|307823641|ref|ZP_07653870.1| DNA repair protein RecO [Methylobacter tundripaludum SV96]
 gi|307735626|gb|EFO06474.1| DNA repair protein RecO [Methylobacter tundripaludum SV96]
          Length = 249

 Score =  107 bits (267), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 40/205 (19%), Positives = 71/205 (34%), Gaps = 9/205 (4%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQ--PILQAGNLVRVNWRSRLA 63
            A IL  R Y E ++I++V+TR +GR     +  +  + +   +LQ    + V++  +  
Sbjct: 20  PAFILRHRKYRETSLIIDVLTRDFGRISLLAKGVRKAKSKTAGMLQPFIPLLVSYFGKAE 79

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKI 123
                             +       G      +  FL + +P  E++      L+C   
Sbjct: 80  LKTLTDVEM---IQPFSEIKGLALYCGFYINELVGYFLHKYDPHPEVFGHYGECLSCLSD 136

Query: 124 PSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKM 183
              +     Q EL L++  G+GL L         + L      +G      V  P++ K 
Sbjct: 137 GPNVEAALRQFELNLMECAGYGLQLEYDDNESPIESLKKYEFNAGKGAVEVVDGPFSGKT 196

Query: 184 LVLPSFLWKEEQTIDADSLKSAFQL 208
           L          +  D   L  A  L
Sbjct: 197 L----LALSSGELTDPQVLSEAKTL 217


>gi|238897757|ref|YP_002923436.1| gap repair protein, part of RecFOR complex [Candidatus Hamiltonella
           defensa 5AT (Acyrthosiphon pisum)]
 gi|259563680|sp|C4K3Z5|RECO_HAMD5 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|229465514|gb|ACQ67288.1| gap repair protein, part of RecFOR complex [Candidatus Hamiltonella
           defensa 5AT (Acyrthosiphon pisum)]
          Length = 234

 Score =  107 bits (267), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 46/229 (20%), Positives = 74/229 (32%), Gaps = 12/229 (5%)

Query: 8   IILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLAQN 65
            IL  RSY E ++IL+++T   GR     +     R   +  LQ    + + W  + A  
Sbjct: 9   FILHRRSYSETSLILDLLTENEGRISLIAKGALRPRSALKGYLQPFTPLLLRWSGKSAIK 68

Query: 66  LGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPS 125
                        A  L+      GL     L R L        L+      L       
Sbjct: 69  TLCGAEP---ISIAVPLTGIFLYSGLYVNELLSRLLLPNIDYRALFFDYLDCLEALASAQ 125

Query: 126 VI-GKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKML 184
               +   + EL LL ++G+G+D   CV TG                        +    
Sbjct: 126 DTSERALRRFELALLTHLGYGVDFLHCVETGEPVVAQMTYRYQHEIGFIRSPEDDSLGFT 185

Query: 185 VLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENF 232
                   +    D ++LK+A + T     + AL+ ++ H     R  F
Sbjct: 186 GHQLQSLAKGAFYDQETLKAAKRFT-----RIALKPHLGHRPLNSRSLF 229


>gi|76810334|ref|YP_334274.1| DNA repair protein RecO [Burkholderia pseudomallei 1710b]
 gi|161723199|ref|YP_109019.2| DNA repair protein RecO [Burkholderia pseudomallei K96243]
 gi|254191247|ref|ZP_04897751.1| DNA repair protein RecO [Burkholderia pseudomallei Pasteur 52237]
 gi|254195774|ref|ZP_04902200.1| DNA repair protein RecO [Burkholderia pseudomallei S13]
 gi|76579787|gb|ABA49262.1| DNA repair protein RecO [Burkholderia pseudomallei 1710b]
 gi|157938919|gb|EDO94589.1| DNA repair protein RecO [Burkholderia pseudomallei Pasteur 52237]
 gi|169652519|gb|EDS85212.1| DNA repair protein RecO [Burkholderia pseudomallei S13]
          Length = 286

 Score =  107 bits (267), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 34/234 (14%), Positives = 76/234 (32%), Gaps = 11/234 (4%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLA 63
            A +L    Y E +++++V+TR +GR     +  +      + +LQ    + ++W  +  
Sbjct: 57  PAFVLHSYPYRETSLVIDVLTRDHGRIALVAKGAKRPHSALRGVLQTFQPLSLSWSGKSE 116

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKI 123
                             L+    L G  +   L +F    +P   L+    + L     
Sbjct: 117 LRT---LTGAEWVGGMLPLAGDALLCGFYANELLVKFCAREDPHPPLFQHYLVTLTRLAH 173

Query: 124 PSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAE-K 182
                ++    E +LL+  G+ + L + V     +            V  +     +   
Sbjct: 174 GEPPVQVLRSFERVLLRETGYAMTLKRTVARRAVEPDKLYVFDPQRGVRDAGSDAPSHWP 233

Query: 183 MLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLL-RENFLGK 235
           ++   + L  EE         +  +     L ++ L   +    L  R+  +  
Sbjct: 234 VIAGQTLLDMEEDDYHRAQTVAQSKT----LMRFLLNTYLGGTPLATRQILIDL 283


>gi|53725349|ref|YP_102341.1| DNA repair protein RecO [Burkholderia mallei ATCC 23344]
 gi|52428772|gb|AAU49365.1| Recombination protein O [Burkholderia mallei ATCC 23344]
          Length = 286

 Score =  107 bits (267), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 34/234 (14%), Positives = 76/234 (32%), Gaps = 11/234 (4%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLA 63
            A +L    Y E +++++V+TR +GR     +  +      + +LQ    + ++W  +  
Sbjct: 57  PAFVLHSYPYRETSLVIDVLTRDHGRIALVAKGAKRPHSALRGVLQTFQPLSLSWSGKSE 116

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKI 123
                             L+    L G  +   L +F    +P   L+    + L     
Sbjct: 117 LRT---LTGAEWVGGMLPLAGDALLCGFYANELLVKFCAREDPHPPLFQHYLVTLTRLAH 173

Query: 124 PSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAE-K 182
                ++    E +LL+  G+ + L + V     +            V  +     +   
Sbjct: 174 GEPPVQVLRSFERVLLRETGYAMTLKRTVARRAVEPDKLYVFDPQRGVRDAGSDAPSHWP 233

Query: 183 MLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLL-RENFLGK 235
           ++   + L  EE         +  +     L ++ L   +    L  R+  +  
Sbjct: 234 VIAGQTLLDMEEDDYHRAQTVAQSKT----LMRFLLNTYLGGTPLATRQILIDL 283


>gi|67641138|ref|ZP_00439923.1| DNA repair protein RecO [Burkholderia mallei GB8 horse 4]
 gi|121600755|ref|YP_993768.1| DNA repair protein RecO [Burkholderia mallei SAVP1]
 gi|124384477|ref|YP_001028766.1| DNA repair protein RecO [Burkholderia mallei NCTC 10229]
 gi|126448568|ref|YP_001081326.1| DNA repair protein RecO [Burkholderia mallei NCTC 10247]
 gi|167000781|ref|ZP_02266588.1| DNA repair protein RecO [Burkholderia mallei PRL-20]
 gi|254178235|ref|ZP_04884890.1| DNA repair protein RecO [Burkholderia mallei ATCC 10399]
 gi|254199234|ref|ZP_04905600.1| DNA repair protein RecO [Burkholderia mallei FMH]
 gi|254205541|ref|ZP_04911893.1| DNA repair protein RecO [Burkholderia mallei JHU]
 gi|254357708|ref|ZP_04973981.1| DNA repair protein RecO [Burkholderia mallei 2002721280]
 gi|61214835|sp|Q62LS7|RECO_BURMA RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|121229565|gb|ABM52083.1| DNA repair protein RecO [Burkholderia mallei SAVP1]
 gi|124292497|gb|ABN01766.1| DNA repair protein RecO [Burkholderia mallei NCTC 10229]
 gi|126241438|gb|ABO04531.1| DNA repair protein RecO [Burkholderia mallei NCTC 10247]
 gi|147748830|gb|EDK55904.1| DNA repair protein RecO [Burkholderia mallei FMH]
 gi|147752984|gb|EDK60049.1| DNA repair protein RecO [Burkholderia mallei JHU]
 gi|148026835|gb|EDK84856.1| DNA repair protein RecO [Burkholderia mallei 2002721280]
 gi|160699274|gb|EDP89244.1| DNA repair protein RecO [Burkholderia mallei ATCC 10399]
 gi|238522003|gb|EEP85450.1| DNA repair protein RecO [Burkholderia mallei GB8 horse 4]
 gi|243063331|gb|EES45517.1| DNA repair protein RecO [Burkholderia mallei PRL-20]
          Length = 275

 Score =  107 bits (267), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 34/234 (14%), Positives = 76/234 (32%), Gaps = 11/234 (4%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLA 63
            A +L    Y E +++++V+TR +GR     +  +      + +LQ    + ++W  +  
Sbjct: 46  PAFVLHSYPYRETSLVIDVLTRDHGRIALVAKGAKRPHSALRGVLQTFQPLSLSWSGKSE 105

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKI 123
                             L+    L G  +   L +F    +P   L+    + L     
Sbjct: 106 LRT---LTGAEWVGGMLPLAGDALLCGFYANELLVKFCAREDPHPPLFQHYLVTLTRLAH 162

Query: 124 PSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAE-K 182
                ++    E +LL+  G+ + L + V     +            V  +     +   
Sbjct: 163 GEPPVQVLRSFERVLLRETGYAMTLKRTVARRAVEPDKLYVFDPQRGVRDAGSDAPSHWP 222

Query: 183 MLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLL-RENFLGK 235
           ++   + L  EE         +  +     L ++ L   +    L  R+  +  
Sbjct: 223 VIAGQTLLDMEEDDYHRAQTVAQSKT----LMRFLLNTYLGGTPLATRQILIDL 272


>gi|126440516|ref|YP_001059798.1| DNA repair protein RecO [Burkholderia pseudomallei 668]
 gi|126452734|ref|YP_001067085.1| DNA repair protein RecO [Burkholderia pseudomallei 1106a]
 gi|134277090|ref|ZP_01763805.1| DNA repair protein RecO [Burkholderia pseudomallei 305]
 gi|167720556|ref|ZP_02403792.1| DNA repair protein RecO [Burkholderia pseudomallei DM98]
 gi|167816750|ref|ZP_02448430.1| DNA repair protein RecO [Burkholderia pseudomallei 91]
 gi|167825157|ref|ZP_02456628.1| DNA repair protein RecO [Burkholderia pseudomallei 9]
 gi|167846654|ref|ZP_02472162.1| DNA repair protein RecO [Burkholderia pseudomallei B7210]
 gi|167895242|ref|ZP_02482644.1| DNA repair protein RecO [Burkholderia pseudomallei 7894]
 gi|167903625|ref|ZP_02490830.1| DNA repair protein RecO [Burkholderia pseudomallei NCTC 13177]
 gi|167911874|ref|ZP_02498965.1| DNA repair protein RecO [Burkholderia pseudomallei 112]
 gi|167919871|ref|ZP_02506962.1| DNA repair protein RecO [Burkholderia pseudomallei BCC215]
 gi|217421115|ref|ZP_03452620.1| DNA repair protein RecO [Burkholderia pseudomallei 576]
 gi|226199969|ref|ZP_03795519.1| DNA repair protein RecO [Burkholderia pseudomallei Pakistan 9]
 gi|237813193|ref|YP_002897644.1| DNA repair protein RecO [Burkholderia pseudomallei MSHR346]
 gi|242316189|ref|ZP_04815205.1| DNA repair protein RecO [Burkholderia pseudomallei 1106b]
 gi|254184212|ref|ZP_04890802.1| DNA repair protein RecO [Burkholderia pseudomallei 1655]
 gi|254258139|ref|ZP_04949193.1| DNA repair protein RecO [Burkholderia pseudomallei 1710a]
 gi|254296873|ref|ZP_04964326.1| DNA repair protein RecO [Burkholderia pseudomallei 406e]
 gi|61214848|sp|Q63S98|RECO_BURPS RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|119361449|sp|Q3JQ79|RECO_BURP1 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|52210447|emb|CAH36430.1| DNA repair protein RecO [Burkholderia pseudomallei K96243]
 gi|126220009|gb|ABN83515.1| DNA repair protein RecO [Burkholderia pseudomallei 668]
 gi|126226376|gb|ABN89916.1| DNA repair protein RecO [Burkholderia pseudomallei 1106a]
 gi|134250740|gb|EBA50819.1| DNA repair protein RecO [Burkholderia pseudomallei 305]
 gi|157807319|gb|EDO84489.1| DNA repair protein RecO [Burkholderia pseudomallei 406e]
 gi|184214743|gb|EDU11786.1| DNA repair protein RecO [Burkholderia pseudomallei 1655]
 gi|217396527|gb|EEC36544.1| DNA repair protein RecO [Burkholderia pseudomallei 576]
 gi|225928025|gb|EEH24062.1| DNA repair protein RecO [Burkholderia pseudomallei Pakistan 9]
 gi|237503117|gb|ACQ95435.1| DNA repair protein RecO [Burkholderia pseudomallei MSHR346]
 gi|242139428|gb|EES25830.1| DNA repair protein RecO [Burkholderia pseudomallei 1106b]
 gi|254216828|gb|EET06212.1| DNA repair protein RecO [Burkholderia pseudomallei 1710a]
          Length = 275

 Score =  107 bits (267), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 34/234 (14%), Positives = 76/234 (32%), Gaps = 11/234 (4%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLA 63
            A +L    Y E +++++V+TR +GR     +  +      + +LQ    + ++W  +  
Sbjct: 46  PAFVLHSYPYRETSLVIDVLTRDHGRIALVAKGAKRPHSALRGVLQTFQPLSLSWSGKSE 105

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKI 123
                             L+    L G  +   L +F    +P   L+    + L     
Sbjct: 106 LRT---LTGAEWVGGMLPLAGDALLCGFYANELLVKFCAREDPHPPLFQHYLVTLTRLAH 162

Query: 124 PSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAE-K 182
                ++    E +LL+  G+ + L + V     +            V  +     +   
Sbjct: 163 GEPPVQVLRSFERVLLRETGYAMTLKRTVARRAVEPDKLYVFDPQRGVRDAGSDAPSHWP 222

Query: 183 MLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLL-RENFLGK 235
           ++   + L  EE         +  +     L ++ L   +    L  R+  +  
Sbjct: 223 VIAGQTLLDMEEDDYHRAQTVAQSKT----LMRFLLNTYLGGTPLATRQILIDL 272


>gi|186475608|ref|YP_001857078.1| DNA repair protein RecO [Burkholderia phymatum STM815]
 gi|184192067|gb|ACC70032.1| DNA repair protein RecO [Burkholderia phymatum STM815]
          Length = 336

 Score =  107 bits (267), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 35/234 (14%), Positives = 76/234 (32%), Gaps = 11/234 (4%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLA 63
            A +L    Y E ++I++V++R +GR     +  +      + +LQ    + +NW  +  
Sbjct: 107 PAFVLHSYPYRETSLIIDVLSRDHGRIALVAKGAKRPHSALRGVLQTFQPLSLNWSGKSE 166

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKI 123
                             L+    L G      L +FL   +P  +L+    + L     
Sbjct: 167 ---MRTLTGAEWVGGMLPLTGDALLCGFYVNELLVKFLAREDPHPQLFHHYVVTLTRLAH 223

Query: 124 PSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAE-K 182
                ++    E +LL+  G+ + L + V                  V  +     +   
Sbjct: 224 DEPPVQVLRSFERVLLRETGYAMSLNRTVARKAVVPDGRYVFDPERGVREASDEYPSNWP 283

Query: 183 MLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLL-RENFLGK 235
           ++   + L  E+         +  +     L ++ L   +    L  R+  +  
Sbjct: 284 VISGQTLLDMEQDDYHRAQTIAQSKT----LMRFLLNIYLGGTPLATRQILIDL 333


>gi|311069128|ref|YP_003974051.1| DNA repair protein RecO [Bacillus atrophaeus 1942]
 gi|310869645|gb|ADP33120.1| DNA repair protein RecO [Bacillus atrophaeus 1942]
          Length = 255

 Score =  107 bits (267), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 32/188 (17%), Positives = 69/188 (36%), Gaps = 1/188 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNW-R 59
           M  + + I+L    YGE N I+ ++TR++G+     R  +    +    +   +  ++  
Sbjct: 1   MLTKCEGIVLRTNDYGETNKIVTLLTREHGKIGVMARGAKKTNSRLSAVSQPFLYGSFLM 60

Query: 60  SRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLN 119
            + +      + E++ S         L  Y       + +   E++P   L++++   L 
Sbjct: 61  QKTSGLGTLQQGEMILSMRGIREDLFLTAYAAFIAELVDKGTEEKKPNPYLFELILESLK 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                     I   +++ +L  IG   +L  CV           S +  G +C       
Sbjct: 121 RLNEGIDPDVITFIVQMKMLGVIGLYPELNHCVHCQSQDGTFHFSVRDNGFICHRCFGKD 180

Query: 180 AEKMLVLP 187
             K+ + P
Sbjct: 181 PYKVPITP 188


>gi|332994406|gb|AEF04461.1| DNA repair protein RecO [Alteromonas sp. SN2]
          Length = 236

 Score =  107 bits (266), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 35/235 (14%), Positives = 72/235 (30%), Gaps = 15/235 (6%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNWRSRLA 63
            A +L  R+Y E + I++  T + G+     +  ++ +   + +LQ    +++    +  
Sbjct: 7   TAFVLHRRAYRETSYIVDFFTLEQGKVSAVAKGVRNSKSDKKSLLQPFQALKLQLAGKSD 66

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKI 123
                          +  L  +     +       R +P       +++     L     
Sbjct: 67  LKNLRHVESTA---PSINLVGTPLFCAMYLNELTNRIMPAGLASDAVFEAYGQALTALFS 123

Query: 124 PSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGV-TQDLLWVSPKSGGAVC---RSVGLPY 179
              I     + EL LL  +G   D T+ V   +  +       +     C     V   +
Sbjct: 124 DDDIEITLRKFELSLLDEMGLLPDFTEDVEYEMPIEAEKHYVLQPEFGFCALPDDVSNSH 183

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENFL 233
             K L   + L   +      S     +     L +  L+  I       RE F+
Sbjct: 184 TRKGLPGSALLALAQGEFTPMS-----KRVAKVLCRDLLKPLIGDKPLKSRELFV 233


>gi|325523760|gb|EGD02014.1| DNA repair protein RecO [Burkholderia sp. TJI49]
          Length = 279

 Score =  106 bits (265), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 34/234 (14%), Positives = 76/234 (32%), Gaps = 11/234 (4%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLA 63
            A +L    Y E ++I++V+TR +GR     +  +      + +LQ    + ++W  +  
Sbjct: 50  PAFVLHSYPYRETSLIIDVLTRDHGRLALVAKGAKRPHSALRGVLQTFQPLLLSWSGKSE 109

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKI 123
                             L     L G  +   L +F    +P   L++   + L     
Sbjct: 110 VRT---LTGAEWVGGMLPLGGDALLCGFYANELLVKFCAREDPQPPLFNHYVLTLTRLAH 166

Query: 124 PSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAE-K 182
                ++    E +LL+  G+ + L + V     +            V  +     +   
Sbjct: 167 GEPAVQVLRSFERVLLRETGYAMALNRTVARRAVEPERRYVFDPERGVRNADDDVPSHWP 226

Query: 183 MLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLL-RENFLGK 235
           ++   + L  E+         +  +     L ++ L   +    L  R+  +  
Sbjct: 227 VISGQTLLDMEQDDYHRAQTVAQSKT----LMRFLLNTYLGGTPLATRQILIDL 276


>gi|206559400|ref|YP_002230161.1| DNA repair protein RecO [Burkholderia cenocepacia J2315]
 gi|206561198|ref|YP_002231963.1| DNA repair protein RecO [Burkholderia cenocepacia J2315]
 gi|198035438|emb|CAR51314.1| DNA repair protein RecO 2 [Burkholderia cenocepacia J2315]
 gi|198037240|emb|CAR53162.1| DNA repair protein RecO 1 [Burkholderia cenocepacia J2315]
          Length = 278

 Score =  106 bits (265), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 34/234 (14%), Positives = 76/234 (32%), Gaps = 11/234 (4%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLA 63
            A +L    Y E ++I++V+TR +GR     +  +      + +LQ    + ++W  +  
Sbjct: 49  PAFVLHSYPYRETSLIVDVLTRDHGRLALVAKGAKRPHSALRGVLQTFQPLLLSWSGKSE 108

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKI 123
                             L     L G  +   L +F    +P   L++   + L     
Sbjct: 109 VRT---LTGAEWVGGMLPLGGDGLLCGFYANELLVKFCAREDPQPPLFNHYVLTLTRLAH 165

Query: 124 PSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAE-K 182
                ++    E +LL+  G+ + L + V     +            V  +     +   
Sbjct: 166 GEPAVQVLRSFERVLLRETGYAMALNRTVARRAVEPERRYVFDPERGVRNADDDVPSHWP 225

Query: 183 MLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLL-RENFLGK 235
           ++   + L  E+         +  +     L ++ L   +    L  R+  +  
Sbjct: 226 VITGQTLLDMEQDDYHRAQTVAQSKT----LMRFLLNTYLGGTPLATRQILIDL 275


>gi|107022212|ref|YP_620539.1| DNA repair protein RecO [Burkholderia cenocepacia AU 1054]
 gi|116689158|ref|YP_834781.1| DNA repair protein RecO [Burkholderia cenocepacia HI2424]
 gi|170732446|ref|YP_001764393.1| DNA repair protein RecO [Burkholderia cenocepacia MC0-3]
 gi|254245909|ref|ZP_04939230.1| Recombination protein O, RecO [Burkholderia cenocepacia PC184]
 gi|119361448|sp|Q1BXT9|RECO_BURCA RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|105892401|gb|ABF75566.1| DNA replication and repair protein RecO [Burkholderia cenocepacia
           AU 1054]
 gi|116647247|gb|ABK07888.1| DNA replication and repair protein RecO [Burkholderia cenocepacia
           HI2424]
 gi|124870685|gb|EAY62401.1| Recombination protein O, RecO [Burkholderia cenocepacia PC184]
 gi|169815688|gb|ACA90271.1| DNA repair protein RecO [Burkholderia cenocepacia MC0-3]
          Length = 278

 Score =  106 bits (265), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 34/234 (14%), Positives = 76/234 (32%), Gaps = 11/234 (4%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLA 63
            A +L    Y E ++I++V+TR +GR     +  +      + +LQ    + ++W  +  
Sbjct: 49  PAFVLHSYPYRETSLIVDVLTRDHGRLALVAKGAKRPHSALRGVLQTFQPLLLSWSGKSE 108

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKI 123
                             L     L G  +   L +F    +P   L++   + L     
Sbjct: 109 VRT---LTGAEWVGGMLPLGGDGLLCGFYANELLVKFCAREDPQPPLFNHYVLTLTRLAH 165

Query: 124 PSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAE-K 182
                ++    E +LL+  G+ + L + V     +            V  +     +   
Sbjct: 166 GEPAVQVLRSFERVLLRETGYAMALNRTVARRAVEPERRYVFDPERGVRNADDDVPSHWP 225

Query: 183 MLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLL-RENFLGK 235
           ++   + L  E+         +  +     L ++ L   +    L  R+  +  
Sbjct: 226 VITGQTLLDMEQDDYHRAQTVAQSKT----LMRFLLNTYLGGTPLATRQILIDL 275


>gi|260752832|ref|YP_003225725.1| DNA repair protein RecO [Zymomonas mobilis subsp. mobilis NCIMB
           11163]
 gi|283856306|ref|YP_162408.2| DNA repair protein RecO [Zymomonas mobilis subsp. mobilis ZM4]
 gi|258552195|gb|ACV75141.1| DNA repair protein RecO [Zymomonas mobilis subsp. mobilis NCIMB
           11163]
 gi|283775302|gb|AAV89297.2| DNA repair protein RecO [Zymomonas mobilis subsp. mobilis ZM4]
          Length = 254

 Score =  106 bits (265), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 65/243 (26%), Positives = 110/243 (45%), Gaps = 11/243 (4%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRL 62
             + A++L  R + E   I+ ++T + G   G+++   S   +P+L  GN V+ +WR ++
Sbjct: 4   ISEPALLLTSRFHSENGAIIRLLT-EQGLLTGYIQGAHSRYRRPLLFVGNYVQASWRDKV 62

Query: 63  AQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPL-FRFLPEREPCLELYDMLNIFLNCH 121
            ++L     E L      ++   L    L  I P     LPE +P   L+  L   L   
Sbjct: 63  GRSLPSINIE-LRHSRGLIMEHPLAALFLSWICPFTASVLPEGQPEPYLFQNLKRLLAII 121

Query: 122 ---KIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
                P +     V+ EL+LL  +G+GL L++C++TG    L WVSPK   AV R     
Sbjct: 122 EKTDEPVLWMTELVRFELLLLSELGYGLHLSRCIITGQEACLDWVSPKHHAAVSRQAAQG 181

Query: 179 YAEKMLVLPSFL-----WKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFL 233
           + +K+LVLP FL            D ++L+   +L+ +FL  +           +R+  +
Sbjct: 182 HEKKLLVLPDFLKAPFSVSCLDLPDQEALQQGLKLSGFFLRFHFEAAYYHRFFGVRQRLI 241

Query: 234 GKL 236
              
Sbjct: 242 KNF 244


>gi|82702880|ref|YP_412446.1| DNA repair protein RecO [Nitrosospira multiformis ATCC 25196]
 gi|119361469|sp|Q2Y867|RECO_NITMU RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|82410945|gb|ABB75054.1| DNA replication and repair protein RecO [Nitrosospira multiformis
           ATCC 25196]
          Length = 242

 Score =  106 bits (265), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 43/240 (17%), Positives = 78/240 (32%), Gaps = 15/240 (6%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLA 63
            A +L    Y E ++I+EV T+  GR     +  +      + +L+A   + ++W  +  
Sbjct: 12  PAFVLHSYPYLETSLIVEVFTQNSGRIAVVAKGAKRPTSPLRGLLRAFQPLLLSWGGKSE 71

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKI 123
                   +         L  +  + G      L R L   +P   L+      L+    
Sbjct: 72  LRTLH---KAEWQGGQLPLQGTALICGFYLNELLIRLLHRNDPHERLFACYQEALSDLST 128

Query: 124 PSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKM 183
            S    I  + E  LL+ +G+ L L   V +G           +          P A   
Sbjct: 129 ASDYIPILRRFEQRLLQEMGYALTLDHDVSSGKP------IKPTQMYCYEIERGPIASSN 182

Query: 184 LVLPSFLWKEEQTI---DADSLKSAF-QLTDYFLNKYALQHNIIHCHLLRENFLGKLLEL 239
              P  L    +T+         +   +L    L ++ L H +    L     L +  +L
Sbjct: 183 GSCPFNLELSGKTLLDMYQGDYLAPLTRLQSRILMRHLLSHYLGDKPLHTRQLLKEFQQL 242


>gi|56459916|ref|YP_155197.1| recombinational DNA repair protein RecO, RecF pathway [Idiomarina
           loihiensis L2TR]
 gi|61214745|sp|Q5R108|RECO_IDILO RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|56178926|gb|AAV81648.1| Recombinational DNA repair protein RecO, RecF pathway [Idiomarina
           loihiensis L2TR]
          Length = 234

 Score =  106 bits (265), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 38/231 (16%), Positives = 71/231 (30%), Gaps = 10/231 (4%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLA 63
            A++L    Y E ++IL++ T   GR     +  +  +   + + Q    +   ++ R  
Sbjct: 4   RALVLHRWDYQETSLILDLFTEDKGRVRVVAKGAKRPKSPWRGLAQPFMPLLAEFQGRSD 63

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKI 123
                      ++    LL       G      + R +P      EL++     L     
Sbjct: 64  LKTLTLLEPQ-QTTQKLLLQGDKLYSGFYLNELIQRLVPTEAEAPELFESYLSALQNMTN 122

Query: 124 PSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVT-QDLLWVSPKSGGAVCRSVGLPYAEK 182
              +     Q E  LL+++G   D      TG    D  W                   +
Sbjct: 123 SERVEPALRQFEWQLLQHLGAAFDWHYDADTGNVLSDSKWCYFIPDHGFVTQAR---DNQ 179

Query: 183 MLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENF 232
                    ++    D D  ++  +L  Y + + AL   +       RE F
Sbjct: 180 QRAYSVADIQKLAAWDVDD-ENRLRLLKYIM-RDALAVYLGDKPLRSRELF 228


>gi|237748851|ref|ZP_04579331.1| DNA repair protein recO [Oxalobacter formigenes OXCC13]
 gi|229380213|gb|EEO30304.1| DNA repair protein recO [Oxalobacter formigenes OXCC13]
          Length = 265

 Score =  106 bits (264), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 46/237 (19%), Positives = 75/237 (31%), Gaps = 10/237 (4%)

Query: 2   YWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQS--HRMQPILQAGNLVRVNWR 59
             +    +L    Y E +++++V TR YGR     +  +    R++ +LQ    + + W 
Sbjct: 33  IVEQPGFVLHSYVYKESSLVVDVFTRDYGRVALVAKGAKRPTSRLRGVLQTFQPLSIGWT 92

Query: 60  SRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLN 119
            +                    L +S  LYG      L +     +P   L+D     LN
Sbjct: 93  GKSELRT---LTTAEWIGGMIPLENSALLYGFYLNELLLKLTAREDPHHLLFDHYVKALN 149

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                     +    EL LLK  G   DL+    T    D   V         R   +  
Sbjct: 150 RLATSESAQTVLRIFELALLKETGVAADLSIDTTTRQKVDPEEVYVVDPENGPRPARMGD 209

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLL-RENFLGK 235
               +   + L    +           QL    L +Y L H++    L  R+  L  
Sbjct: 210 EAPRMAGKTLLDMVCEDYSDQQ----TQLQSKLLMRYLLAHHLNGVPLQTRKILLDL 262


>gi|114567078|ref|YP_754232.1| DNA repair protein [Syntrophomonas wolfei subsp. wolfei str.
           Goettingen]
 gi|119361496|sp|Q0AWP3|RECO_SYNWW RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|114338013|gb|ABI68861.1| DNA replication and repair protein RecO [Syntrophomonas wolfei
           subsp. wolfei str. Goettingen]
          Length = 250

 Score =  106 bits (264), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 46/227 (20%), Positives = 80/227 (35%), Gaps = 11/227 (4%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNW 58
           MY +  AI++    Y E + ++ +     G+     R  +  R   +  +Q      + +
Sbjct: 1   MYLRSRAIVIKNMDYRESDKLVTIFCEHEGKMKAVARGIKKPRSSLRACVQPFCHSSL-F 59

Query: 59  RSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFL 118
            SR        + ++L+ +          LY L  +  L + L E      LY      L
Sbjct: 60  FSRGKGMNLITQGKLLDFYGNTREDFERSLYALYLMELLDKSLMEGVAIPRLYTSTLEVL 119

Query: 119 NCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
           +          +    E+ LL N+G+   L  CV+ G   DL   S   GG +CR     
Sbjct: 120 SHLNHSGYNPMLIRYFEMNLLVNLGYSPLLDHCVLCGKKDDLKVFSLPDGGMLCRDCSYQ 179

Query: 179 YAE-----KMLVLPSFLWKEEQTIDADSL---KSAFQLTDYFLNKYA 217
            +      K  +    L    +    + +     A +  +YFL KY 
Sbjct: 180 ASGAVSLSKETLALISLLGRSRLATVERVRVSNKAQKELEYFLEKYL 226


>gi|167581153|ref|ZP_02374027.1| DNA repair protein RecO [Burkholderia thailandensis TXDOH]
          Length = 275

 Score =  106 bits (264), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 34/234 (14%), Positives = 75/234 (32%), Gaps = 11/234 (4%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLA 63
              +L    Y E +++++V+TR +GR     +  +      + +LQ    + ++W  +  
Sbjct: 46  PGFVLHSYPYRETSLVIDVLTRDHGRIALVAKGAKRPHSALRGVLQTFQPLSLSWSGKSE 105

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKI 123
                             L+    L G  +   L +F    +P   L+    + L     
Sbjct: 106 LRT---LTGAEWVGGMLPLAGDALLCGFYANELLVKFCAREDPHPPLFQHYLVTLTRLAH 162

Query: 124 PSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGL--PYAE 181
                ++    E +LL+  G+ + L + V     +            V  +     P+  
Sbjct: 163 GEPPVQVLRSFERVLLRETGYAMTLKRTVARRAVEPGKLYVFDPERGVRDADSDVPPHWP 222

Query: 182 KMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGK 235
            +        +E+    A ++  +  L  + LN Y            R+  +  
Sbjct: 223 VIAGQTLLDMEEDDYHRAQTVAQSKTLMRFLLNTYL----GGTPLATRQILIDL 272


>gi|167619238|ref|ZP_02387869.1| DNA repair protein RecO [Burkholderia thailandensis Bt4]
 gi|257138460|ref|ZP_05586722.1| DNA repair protein RecO [Burkholderia thailandensis E264]
 gi|119361451|sp|Q2SXT2|RECO_BURTA RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
          Length = 275

 Score =  106 bits (264), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 34/234 (14%), Positives = 75/234 (32%), Gaps = 11/234 (4%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLA 63
              +L    Y E +++++V+TR +GR     +  +      + +LQ    + ++W  +  
Sbjct: 46  PGFVLHSYPYRETSLVIDVLTRDHGRIALVAKGAKRPHSALRGVLQTFQPLSLSWSGKSE 105

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKI 123
                             L+    L G  +   L +F    +P   L+    + L     
Sbjct: 106 LRT---LTGAEWVGGMLPLAGDALLCGFYANELLVKFCAREDPHPPLFQHYLVTLTRLAH 162

Query: 124 PSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGL--PYAE 181
                ++    E +LL+  G+ + L + V     +            V  +     P+  
Sbjct: 163 GEPPVQVLRSFERVLLRETGYAMTLKRTVARRAVEPGKLYVFDPERGVRDADSDVPPHWP 222

Query: 182 KMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGK 235
            +        +E+    A ++  +  L  + LN Y            R+  +  
Sbjct: 223 VIAGQTLLDMEEDDYHRAQTVAQSKTLMRFLLNTYL----GGTPLATRQILIDL 272


>gi|83720218|ref|YP_442267.1| DNA repair protein RecO [Burkholderia thailandensis E264]
 gi|83654043|gb|ABC38106.1| DNA repair protein RecO [Burkholderia thailandensis E264]
          Length = 286

 Score =  106 bits (264), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 34/234 (14%), Positives = 75/234 (32%), Gaps = 11/234 (4%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLA 63
              +L    Y E +++++V+TR +GR     +  +      + +LQ    + ++W  +  
Sbjct: 57  PGFVLHSYPYRETSLVIDVLTRDHGRIALVAKGAKRPHSALRGVLQTFQPLSLSWSGKSE 116

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKI 123
                             L+    L G  +   L +F    +P   L+    + L     
Sbjct: 117 LRT---LTGAEWVGGMLPLAGDALLCGFYANELLVKFCAREDPHPPLFQHYLVTLTRLAH 173

Query: 124 PSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGL--PYAE 181
                ++    E +LL+  G+ + L + V     +            V  +     P+  
Sbjct: 174 GEPPVQVLRSFERVLLRETGYAMTLKRTVARRAVEPGKLYVFDPERGVRDADSDVPPHWP 233

Query: 182 KMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGK 235
            +        +E+    A ++  +  L  + LN Y            R+  +  
Sbjct: 234 VIAGQTLLDMEEDDYHRAQTVAQSKTLMRFLLNTYL----GGTPLATRQILIDL 283


>gi|119476419|ref|ZP_01616770.1| DNA repair protein RecO [marine gamma proteobacterium HTCC2143]
 gi|119450283|gb|EAW31518.1| DNA repair protein RecO [marine gamma proteobacterium HTCC2143]
          Length = 239

 Score =  106 bits (264), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 41/246 (16%), Positives = 80/246 (32%), Gaps = 22/246 (8%)

Query: 1   MYWQDD-AIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQ-----SHRMQPILQAGNLV 54
           M  +   A IL  R++ + ++I++ ++  YGR  G V+  +     + + + + Q    +
Sbjct: 1   MRIESQPAYILHTRNFRDSSLIVDFLSADYGRVSGVVKGVRATSKSAKQRRGLSQPFVPL 60

Query: 55  RVNWRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDML 114
            ++W  +                    L       GL     L R L + +    +Y + 
Sbjct: 61  LISWSGKSDLKTIIQMEPR---GAPLQLQGKRLFSGLYVNELLSRLLQQDDQHTAIYTLY 117

Query: 115 NIFLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCR- 173
                C    S I  +  Q EL L++ +G+GLD T+   T              G     
Sbjct: 118 EWIAKCLVGDSEIDIVLRQFELQLMEYLGYGLDFTQEAETDNPIIPDRYYVYRAGEGLFA 177

Query: 174 ------SVGLPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH- 226
                 +       +       L         ++   A  +      + AL+ ++     
Sbjct: 178 VPDAELASRGHLVNRTFQGEDLLAIASGAFTDNARHVAKLIC-----RQALRLHLGEKPL 232

Query: 227 LLRENF 232
             RE F
Sbjct: 233 KSRELF 238


>gi|169829165|ref|YP_001699323.1| DNA repair protein RecO [Lysinibacillus sphaericus C3-41]
 gi|168993653|gb|ACA41193.1| DNA repair protein recO (Recombination protein O) [Lysinibacillus
           sphaericus C3-41]
          Length = 272

 Score =  106 bits (264), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 48/246 (19%), Positives = 83/246 (33%), Gaps = 9/246 (3%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M  + + I+L VR+YGE N I+ ++TR+ G+     R  +    +            +  
Sbjct: 11  MLHKWEGIVLKVRAYGESNKIVTLLTREAGKVATMARGAKKPSSRLASVTQPFTYGMFMV 70

Query: 61  RLAQNLGE-FRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLN 119
           +    +G   + E L S            Y    +  + R + E +P    +D+L   L 
Sbjct: 71  QHHTGMGTLQQGEHLNSMRHIREDIMATAYASYIMELVERVVEEGKPEPFAFDVLLQALQ 130

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGL-- 177
             +       I +  E  +L   G    L  C   G        S   GG +C       
Sbjct: 131 AIEDGYDPESITLFAEWKMLPYTGVQPILHACAACGAVDGEFAFSFAQGGFLCHRCYQHD 190

Query: 178 PYAEKMLVLPSFLWKEEQTIDADSLKSA--FQLTDYFLNK---YALQHNIIHCHLLRENF 232
           PY  ++      L +   T+  D +      + T YF+ K      +         R  F
Sbjct: 191 PYIIRLTPTQLKLIRMFYTVPIDQIGKIELKKETKYFIKKIITTIYEEQTGIRFKTR-KF 249

Query: 233 LGKLLE 238
           + +L  
Sbjct: 250 IEQLER 255


>gi|126652273|ref|ZP_01724452.1| DNA repair protein RecO [Bacillus sp. B14905]
 gi|126591005|gb|EAZ85117.1| DNA repair protein RecO [Bacillus sp. B14905]
          Length = 262

 Score =  106 bits (264), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 48/246 (19%), Positives = 83/246 (33%), Gaps = 9/246 (3%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M  + + I+L VR+YGE N I+ ++TR+ G+     R  +    +            +  
Sbjct: 1   MLHKWEGIVLKVRAYGESNKIVTLLTREAGKVATMARGAKKPSSRLASVTQPFTYGMFMV 60

Query: 61  RLAQNLGE-FRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLN 119
           +    +G   + E L S            Y    +  + R + E +P    +D+L   L 
Sbjct: 61  QHHTGMGTLQQGEHLNSMRHIREDIMATAYASYIMELVERVVEEGKPEPFAFDVLLQALQ 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGL-- 177
             +       I +  E  +L   G    L  C   G        S   GG +C       
Sbjct: 121 AIEDGYDPESITLFAEWKMLPYTGVQPILHACAACGAVDGEFAFSFAQGGFLCHRCYQHD 180

Query: 178 PYAEKMLVLPSFLWKEEQTIDADSLKSA--FQLTDYFLNK---YALQHNIIHCHLLRENF 232
           PY  ++      L +   T+  D +      + T YF+ K      +         R  F
Sbjct: 181 PYIIRLTPTQLKLIRMFYTVPIDQIGKIELKKETKYFIKKIITTIYEEQTGIRFKTR-KF 239

Query: 233 LGKLLE 238
           + +L  
Sbjct: 240 IEQLER 245


>gi|241761300|ref|ZP_04759388.1| DNA repair protein RecO [Zymomonas mobilis subsp. mobilis ATCC
           10988]
 gi|241374207|gb|EER63704.1| DNA repair protein RecO [Zymomonas mobilis subsp. mobilis ATCC
           10988]
          Length = 254

 Score =  106 bits (263), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 66/243 (27%), Positives = 110/243 (45%), Gaps = 11/243 (4%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRL 62
             + A++L  R + E   I+ ++T + G   G+++   S   +P+L  GN V+ +WR ++
Sbjct: 4   ISEPALLLTSRFHSENGAIIRLLT-EQGLLTGYIQGAHSRYRRPLLFVGNYVQASWRDKV 62

Query: 63  AQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPL-FRFLPEREPCLELYDMLNIFLNCH 121
            ++L     E L      ++   L    L  I P     LPE +P   L+  L   L   
Sbjct: 63  GRSLPSINIE-LRHSRGLIMEHPLAALFLSWICPFTASVLPEGQPEPYLFQNLKRLLAII 121

Query: 122 ---KIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
                P +     V+ EL+LL  +G+GL L++C++TG    L WVSPK   AV R     
Sbjct: 122 EKTDEPVLWMTELVRFELLLLSELGYGLHLSRCIITGQEACLDWVSPKHHAAVSRQAAQG 181

Query: 179 YAEKMLVLPSFL-----WKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFL 233
           + +K+LVLP FL            D +SL+   +L+ +FL  +           +R+  +
Sbjct: 182 HEKKLLVLPDFLKAPFSVSCLDLPDQESLQQGLKLSGFFLRFHFEAAYYHRFFWVRQRLI 241

Query: 234 GKL 236
              
Sbjct: 242 KNF 244


>gi|158320288|ref|YP_001512795.1| DNA repair protein RecO [Alkaliphilus oremlandii OhILAs]
 gi|172048003|sp|A8MG71|RECO_ALKOO RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|158140487|gb|ABW18799.1| DNA repair protein RecO [Alkaliphilus oremlandii OhILAs]
          Length = 246

 Score =  106 bits (263), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 37/239 (15%), Positives = 73/239 (30%), Gaps = 21/239 (8%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWR- 59
           M    +  IL  R +GE + IL + TR+ G+     +  +  +   +          +  
Sbjct: 1   MLITTEGFILKNRKFGETDSILTIFTRKAGKITAIAKGARRPKSNLLAGIQPFCYSEFVL 60

Query: 60  SRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLN 119
            +        + E  E             Y    +  +     E +    L+++    L 
Sbjct: 61  YKGKNMYTVSQCEAKEIFYPLREDLKRLSYASYLVELVEAVTTEGQTNHRLFNLFGKTLF 120

Query: 120 CHKIPSV-IGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSP-------KSGGAV 171
             K   + I  I    E+ L+  +G+   L  CV     +   W           S    
Sbjct: 121 LLKKSDIEINPIVRAFEIKLMNYLGYKPQLMSCVNCDSKETTAWKFSATEGGLLCSSCYS 180

Query: 172 CRSVGLPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDY-------FLNKYALQHNII 223
                +  +   + L  FL  +    D   ++   +++D+        L +Y L H   
Sbjct: 181 ADLFAMKISNTAVKLAIFLLMK----DITEVQK-LKISDHLNEELKKILKQYILTHTNK 234


>gi|78224139|ref|YP_385886.1| recombination protein O, RecO [Geobacter metallireducens GS-15]
 gi|119361460|sp|Q39RG3|RECO_GEOMG RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|78195394|gb|ABB33161.1| DNA replication and repair protein RecO [Geobacter metallireducens
           GS-15]
          Length = 244

 Score =  106 bits (263), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 30/155 (19%), Positives = 58/155 (37%), Gaps = 3/155 (1%)

Query: 4   QDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQS--HRMQPILQAGNLVRVNWRSR 61
           + +AI+L    Y E + I+ + T QYG+  G  +  +    R  P L+    + V    R
Sbjct: 5   RTEAIVLAAMDYRESDRIVTLFTLQYGKVRGVAKGAKRSARRFGPALEPFARIGVELVVR 64

Query: 62  LAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCH 121
                     +++  +               ++  + R+LP+  P   L+ +L+ +L   
Sbjct: 65  -EGLSSLRGADIVTLYPGIRRDLRAIGLAGYAVELVDRYLPDGAPSPRLFRLLSSYLERL 123

Query: 122 KIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGV 156
                +       E   L  +G+ + L  C   GV
Sbjct: 124 DQGEPLPSDRRFFEANFLNILGYRISLDHCASCGV 158


>gi|254490789|ref|ZP_05103972.1| DNA repair protein RecO [Methylophaga thiooxidans DMS010]
 gi|224463961|gb|EEF80227.1| DNA repair protein RecO [Methylophaga thiooxydans DMS010]
          Length = 234

 Score =  106 bits (263), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 43/236 (18%), Positives = 76/236 (32%), Gaps = 13/236 (5%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQ--PILQAGNLVRVNW 58
           M     A +L  R + E +++++ +TR +GR     R  +  + +   +LQ    + ++W
Sbjct: 1   MELTS-AFVLHHRPFRETSLLVDALTRDHGRVSLVARGMRQQKKRQSHVLQLFQPLWISW 59

Query: 59  RSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFL 118
                 +             A  L     L GL     L R LP +E    +YD     L
Sbjct: 60  YGYSELHTLGQAEASE---SAFRLIGKASLCGLYLNELLVRLLPIQESEPVIYDAYYQAL 116

Query: 119 NCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVT-GVTQDLLWVSPKSGGAVCRSVGL 177
              +       +    E  LL  +G+GL L     +    +D             R +  
Sbjct: 117 QSLQQNENEQVVLRLFEKRLLAELGYGLVLRHEAGSLTPIEDNGLYRYLPDSGPQRQLNA 176

Query: 178 PYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENF 232
                +         EE   D  SLK         + +  + + +       R+ F
Sbjct: 177 GKEPSVSGRSLRQLDEEDGFDETSLKEIK-----IMMRTVINYYLGGKPLHSRQLF 227


>gi|330722062|gb|EGG99980.1| DNA recombination and repair protein RecO [gamma proteobacterium
           IMCC2047]
          Length = 234

 Score =  106 bits (263), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 34/225 (15%), Positives = 71/225 (31%), Gaps = 10/225 (4%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLA 63
            A +L  R Y E ++I++ +    GR    VR  +  +   + +LQ    + ++W  +  
Sbjct: 9   QAYVLHTRHYRETSLIVDFLVPDVGRISAVVRGARRPKSPQRSLLQPFGRLLISWYGKGE 68

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKI 123
               +      +      L       G+     L R +   EPC  L+      L   + 
Sbjct: 69  LKTLKVLESDNQLVG---LRGRALFSGMYLNELLVRLIKAEEPCETLFVNYQQALFELRE 125

Query: 124 PSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKM 183
              +  +  + E  LL+ +G+ +       T       + +      V  +       + 
Sbjct: 126 AESVEPVLRRFERQLLQTLGYWMGFPD-SDTEQVNCFYFDTDSQWLPVAETPTQAQQARC 184

Query: 184 LVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLL 228
            +        +    A+    A +     L + AL   +    L 
Sbjct: 185 FLTADLAAIAQDDYSAEQTLRAAKR----LMRLALAPLLGDKPLS 225


>gi|154686788|ref|YP_001421949.1| DNA repair protein RecO [Bacillus amyloliquefaciens FZB42]
 gi|166221883|sp|A7Z6U2|RECO_BACA2 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|154352639|gb|ABS74718.1| RecO [Bacillus amyloliquefaciens FZB42]
          Length = 255

 Score =  106 bits (263), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 30/188 (15%), Positives = 69/188 (36%), Gaps = 1/188 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNW-R 59
           M  + + I+L    YGE N I+ ++TR++G+     R  +    +    +   +  ++  
Sbjct: 1   MLTKCEGIVLRTNDYGETNKIVTLLTREHGKIGVMARGARKSASRLSAVSQPFLYGSFLM 60

Query: 60  SRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLN 119
            R +      + E++ S         L  Y         +   E++P   L++++     
Sbjct: 61  QRTSGLGTLQQGEMILSMRTIREDLFLTAYAAFIAELTDKGTEEKKPNPYLFELILESFK 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                +    I   +++ +L  +G   +L  CV     +     S +  G +C       
Sbjct: 121 RLNDGTDPDVITFIVQMKMLGVMGLYPELNHCVHCKSGEGTFHFSIRDNGFICHRCFEKD 180

Query: 180 AEKMLVLP 187
             ++ + P
Sbjct: 181 PYRVPMSP 188


>gi|89094544|ref|ZP_01167482.1| DNA repair protein RecO [Oceanospirillum sp. MED92]
 gi|89081143|gb|EAR60377.1| DNA repair protein RecO [Oceanospirillum sp. MED92]
          Length = 229

 Score =  105 bits (262), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 40/237 (16%), Positives = 76/237 (32%), Gaps = 16/237 (6%)

Query: 1   MYWQDD--AIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQS--HRMQPILQAGNLVRV 56
           M   D     +L  R Y + +++++  T ++G+    V+  +    +++  +Q    V++
Sbjct: 1   MAVTDQQAGYVLHGRPYRDTSLLVDFFTLEHGKVSAVVQGARRPNSKLRASVQPFVPVQL 60

Query: 57  NWRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNI 116
           +WR R              +     L     L GL     L R L   +P  +LY     
Sbjct: 61  SWRGRNDLKTVTQAEP---AAAMLFLKGDALLCGLYLNELLERLLLPFDPHPKLYVYYQY 117

Query: 117 FLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVG 176
            LN       +       E  LL  +G   +LT          +  +    G ++   + 
Sbjct: 118 ALNELVAGDDVEGALRTFEHRLLDELGHLPELTG----KDQNRIYRIDMDEGFSIIEQIN 173

Query: 177 LPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENF 232
                +                   +K A +     L +  + H + H     RE F
Sbjct: 174 EADKRRYFYGWQLSAIAADDYTDVQVKRAAKR----LMRLLIDHILGHKPLRSRELF 226


>gi|167570685|ref|ZP_02363559.1| DNA repair protein RecO [Burkholderia oklahomensis C6786]
          Length = 248

 Score =  105 bits (262), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 34/234 (14%), Positives = 75/234 (32%), Gaps = 11/234 (4%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLA 63
            A +L    Y E +++++V+TR +GR     +  +      + +LQ    + ++W  +  
Sbjct: 19  PAFVLHSHPYRETSLVIDVLTRDHGRIALVAKGAKRPHSALRGVLQTFQPLSLSWSGKSE 78

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKI 123
                             L+    L G      L +F    +P   L+    + L     
Sbjct: 79  LRT---LTGAEWVGGMLPLAGDALLCGFYVNELLVKFCAREDPHPPLFTHYLVTLTRLAH 135

Query: 124 PSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAE-K 182
                ++    E +LL+  G+ + L + V     +            V  +     +   
Sbjct: 136 GEPPVQVLRSFERVLLRETGYAMSLKRTVARRSVEPDRLYVFDPERGVRDADDDIPSHWP 195

Query: 183 MLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLL-RENFLGK 235
           ++   + L  EE         +  +     L ++ L   +    L  R+  +  
Sbjct: 196 VIAGQTLLDMEEDDYHRAQTVAQSKT----LMRFLLNTYLGGTPLATRQILIDL 245


>gi|167563524|ref|ZP_02356440.1| DNA repair protein RecO [Burkholderia oklahomensis EO147]
          Length = 251

 Score =  105 bits (262), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 34/234 (14%), Positives = 75/234 (32%), Gaps = 11/234 (4%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLA 63
            A +L    Y E +++++V+TR +GR     +  +      + +LQ    + ++W  +  
Sbjct: 22  PAFVLHSHPYRETSLVIDVLTRDHGRIALVAKGAKRPHSALRGVLQTFQPLSLSWSGKSE 81

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKI 123
                             L+    L G      L +F    +P   L+    + L     
Sbjct: 82  LRT---LTGAEWVGGMLPLAGDALLCGFYVNELLVKFCAREDPHPPLFTHYLVTLTRLAH 138

Query: 124 PSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAE-K 182
                ++    E +LL+  G+ + L + V     +            V  +     +   
Sbjct: 139 GEPPVQVLRSFERVLLRETGYAMSLKRTVARRSVEPDRLYVFDPERGVRDADDDIPSHWP 198

Query: 183 MLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLL-RENFLGK 235
           ++   + L  EE         +  +     L ++ L   +    L  R+  +  
Sbjct: 199 VIAGQTLLDMEEDDYHRAQTVAQSKT----LMRFLLNTYLGGTPLATRQILIDL 248


>gi|284044557|ref|YP_003394897.1| DNA repair protein RecO [Conexibacter woesei DSM 14684]
 gi|283948778|gb|ADB51522.1| DNA repair protein RecO [Conexibacter woesei DSM 14684]
          Length = 248

 Score =  105 bits (262), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 36/193 (18%), Positives = 65/193 (33%), Gaps = 4/193 (2%)

Query: 4   QDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQ--PILQAGNLVRVNWRSR 61
           + +AI+L    +GE + IL + T  +GR     +  +  R +    L+    +RVN    
Sbjct: 7   RTEAIVLRSIRFGEADRILHLYTPDHGRVGAIAKGARKTRSRFGARLEPFFHLRVNLHLS 66

Query: 62  LAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCH 121
                     + ++ H      +       ++   + R     +P   ++ +L   L   
Sbjct: 67  RGDLHTVTSADTIDPHGPLRERACSLDAASRACDAVTRLFETDDPSPAVFHLLANELRLL 126

Query: 122 KIPSVI--GKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                       +   L LL   GF   L  C   G +  L   S  +GG VC +     
Sbjct: 127 DGDERHSGQAAQLAFRLKLLVAGGFTPQLASCASCGESDHLSGFSGSAGGVVCSACEASA 186

Query: 180 AEKMLVLPSFLWK 192
                   +FL +
Sbjct: 187 FPLSEEAYTFLVE 199


>gi|78065720|ref|YP_368489.1| DNA repair protein RecO [Burkholderia sp. 383]
 gi|119361450|sp|Q39I71|RECO_BURS3 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|77966465|gb|ABB07845.1| DNA replication and repair protein RecO [Burkholderia sp. 383]
          Length = 278

 Score =  105 bits (262), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 34/234 (14%), Positives = 76/234 (32%), Gaps = 11/234 (4%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLA 63
            A +L    Y E ++I++V+TR +GR     +  +      + +LQ    + ++W  +  
Sbjct: 49  PAYVLHSYPYRETSLIIDVLTRDHGRLALVAKGAKRPHSALRGVLQTFQPLLLSWSGKSE 108

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKI 123
                             L     L G  +   L +F    +P   L++   + L     
Sbjct: 109 VRT---LTGAEWVGGMLPLGGDGLLCGFYANELLVKFCAREDPQPPLFNHYVLTLTRLAH 165

Query: 124 PSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAE-K 182
                ++    E +LL+  G+ + L + V     +            V  +     +   
Sbjct: 166 GEPAVQVLRSFERVLLRETGYAMALNRTVARRAVEPDRRYVFDPERGVRNADDEVPSHWP 225

Query: 183 MLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLL-RENFLGK 235
           ++   + L  E+         +  +     L ++ L   +    L  R+  +  
Sbjct: 226 VISGQTLLDMEQDDYHRAQTVAQSKT----LMRFLLNTYLGGTPLATRQILIDL 275


>gi|171322521|ref|ZP_02911314.1| DNA repair protein RecO [Burkholderia ambifaria MEX-5]
 gi|171092148|gb|EDT37556.1| DNA repair protein RecO [Burkholderia ambifaria MEX-5]
          Length = 279

 Score =  105 bits (262), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 34/234 (14%), Positives = 76/234 (32%), Gaps = 11/234 (4%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLA 63
            A +L    Y E ++I++V+TR +GR     +  +      + +LQ    + ++W  +  
Sbjct: 50  PAFVLHSYPYRETSLIIDVLTRDHGRLALVAKGAKRPHSALRGVLQTFQPLLLSWSGKSE 109

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKI 123
                             L     L G  +   L +F    +P   L++   + L     
Sbjct: 110 VRT---LTGAEWVGGMLPLGGDGLLCGFYANELLVKFCAREDPQPPLFNHYVLTLTRLAH 166

Query: 124 PSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAE-K 182
                ++    E +LL+  G+ + L + V     +            V  +     +   
Sbjct: 167 GEPAVQVLRSFERVLLRETGYAMALNRTVARRAVEPDRRYVFDPERGVRNADDDVPSHWP 226

Query: 183 MLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLL-RENFLGK 235
           ++   + L  E+         +  +     L ++ L   +    L  R+  +  
Sbjct: 227 VITGQTLLDMEQDDYHRAQTVAQSKT----LMRFLLNTYLGGTPLATRQILIDL 276


>gi|134295166|ref|YP_001118901.1| DNA repair protein RecO [Burkholderia vietnamiensis G4]
 gi|134138323|gb|ABO54066.1| DNA replication and repair protein RecO [Burkholderia vietnamiensis
           G4]
          Length = 279

 Score =  105 bits (262), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 34/234 (14%), Positives = 75/234 (32%), Gaps = 11/234 (4%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLA 63
            A +L    Y E ++I++V+TR +GR     +  +      + +LQ    + ++W  +  
Sbjct: 50  PAFVLHSYPYRETSLIIDVLTRDHGRLALVAKGAKRPHSALRGVLQTFQPLLLSWSGKSE 109

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKI 123
                             L     L G      L +F    +P   L++   + L     
Sbjct: 110 VRT---LTGAEWVGGMLPLGGDGLLCGFYVNELLVKFCAREDPQPPLFNHYVLTLTRLAH 166

Query: 124 PSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAE-K 182
                ++    E +LL+  G+ + L + V     +            V  +     +   
Sbjct: 167 GEPAVQVLRSFERVLLRETGYAMALNRTVARRAVEPERRYVFDPERGVRNADDDVPSHWP 226

Query: 183 MLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLL-RENFLGK 235
           ++   + L  E+         +  +     L ++ L   +    L  R+  +  
Sbjct: 227 VVTGQTLLDMEQDDYHRAQTVAQSKT----LMRFLLNTYLGGTPLATRQILIDL 276


>gi|300114890|ref|YP_003761465.1| DNA repair protein RecO [Nitrosococcus watsonii C-113]
 gi|299540827|gb|ADJ29144.1| DNA repair protein RecO [Nitrosococcus watsonii C-113]
          Length = 258

 Score =  105 bits (262), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 45/235 (19%), Positives = 76/235 (32%), Gaps = 13/235 (5%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPI--LQAGNLVRVNWRSRLA 63
            A IL  R Y E ++++E  T +YGR     +  +  R   +  LQ    + ++W  R  
Sbjct: 7   PAYILHSRPYRETSVLVEAFTPEYGRVGLVAKGVKRRRSHGVSPLQPFCPLLLSWTGRGD 66

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKI 123
                       +  A  L+    +        L R LP R+P  +L+      L   + 
Sbjct: 67  LVT---LTGAEATGPAFTLTGEGLICAFYLNELLLRLLPRRDPLEDLFSAYAHSLPSLRH 123

Query: 124 PSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGV-TQDLLWVSPKSGGA-VCRSVGLPYAE 181
                +     E  LL  +G+GL L   V +    +   W S +     V          
Sbjct: 124 ARQRQQTLRLFERDLLACLGYGLILDHEVNSSRPIEAEQWYSYQLEKGPVRLPSNGLEGM 183

Query: 182 KMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENFLGK 235
           K+         +    D  SL  A +     L ++ L  ++       R      
Sbjct: 184 KISGHTLQALAQGALADPVSLGEAKR-----LLRWLLAVHLGDKPLKSRGLLEEL 233


>gi|253999487|ref|YP_003051550.1| DNA repair protein RecO [Methylovorus sp. SIP3-4]
 gi|253986166|gb|ACT51023.1| DNA repair protein RecO [Methylovorus sp. SIP3-4]
          Length = 241

 Score =  105 bits (262), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 35/234 (14%), Positives = 76/234 (32%), Gaps = 14/234 (5%)

Query: 8   IILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLAQN 65
            +L    + E ++++E+ +R +GR     +  +  R   + +LQ+   +   W  +    
Sbjct: 13  YVLHTYPFKETSLVVELFSRDFGRVAAVAKGARRPRSAMRGMLQSFQPLLATWSGKAELK 72

Query: 66  LGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPS 125
                  +       LL     + G      L R LP  +    L+      L      +
Sbjct: 73  TLH---SLEWGSGLLLLQGDALMCGFYMNELLLRLLPREDSHDALFAYYGDTLRTLSQSA 129

Query: 126 VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSV-GLPYAEKML 184
                  + EL +L+ +G+ + L         +        +    C     LP A ++ 
Sbjct: 130 EHATSLRRFELRMLQEMGYAVPLLNDERDQPVEAERIYEYVAERGACTGATALPAANRVQ 189

Query: 185 VLPSFLWK--EEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENFLGK 235
           +    L     +   D+ + + + Q     L +  L H +       R+  +  
Sbjct: 190 LRGKTLLDMARDDYADSQTQQQSKQ-----LMRMLLAHYLGDKPLHTRQLLIDL 238


>gi|117924217|ref|YP_864834.1| DNA replication and repair protein RecO [Magnetococcus sp. MC-1]
 gi|117607973|gb|ABK43428.1| DNA replication and repair protein RecO [Magnetococcus sp. MC-1]
          Length = 242

 Score =  105 bits (262), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 45/233 (19%), Positives = 82/233 (35%), Gaps = 12/233 (5%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM---QPILQAGNLVRVNWRSR- 61
            AIIL    + + ++++ + T+ +G      R  +       +  L   + + V    R 
Sbjct: 8   PAIILRRIPFRDSSLVVSLFTQDHGVRAVMARGARKGSKTLPRGDLAGYHTLGVQLGGRE 67

Query: 62  LAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCH 121
               L     E+L+     L            +  ++R LP  +   +L+  L   L+  
Sbjct: 68  GQNMLTLRSAEILQPRHGLLHQRVGSSAAQLMLEQVYRLLPVEDANPKLFGALQEALDRL 127

Query: 122 KIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAE 181
           +      ++    +  LL N+GFG  +  C   G   DL + S K    VC   G P+  
Sbjct: 128 EAGEAALEVVGLWQGFLLHNLGFGWQVAHCAGCGGETDLRFFSTKRNQTVCAPCGTPHRH 187

Query: 182 KMLVLPSFLW-----KEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLR 229
           ++L LP  +      +     D   L     LT   L ++  +         R
Sbjct: 188 RLLPLPEGVLAVMRGQPGGAADQAELVM---LTTALLAQHGEKVLHAQQPFFR 237


>gi|288555747|ref|YP_003427682.1| DNA repair protein RecO [Bacillus pseudofirmus OF4]
 gi|288546907|gb|ADC50790.1| DNA repair protein RecO [Bacillus pseudofirmus OF4]
          Length = 251

 Score =  105 bits (261), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 32/188 (17%), Positives = 69/188 (36%), Gaps = 2/188 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNW-R 59
           M  + +AI++    YGE N I+ + TR+ G+     R  +  + +    +   +   +  
Sbjct: 1   MQ-KVEAIVIRTNDYGESNKIVTLFTRESGKVGVMARGAKKPKSRLAAISQLFIHGLYLF 59

Query: 60  SRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLN 119
            +        + E++ S+        L  Y    +  + +   E++P   L+ +L   L 
Sbjct: 60  QKSNGLGTLNQAEMIHSYKEVRNDLFLASYATYVVELIDKLTEEKQPNEPLFHLLQQTLL 119

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                     +    E+ +++  G   +L +C   G T+     S K  G +C+      
Sbjct: 120 YLDEGIDPEVLLRIFEMKMMQVAGITPELDQCTNCGSTEVPSGFSIKEAGFLCKKCIHKD 179

Query: 180 AEKMLVLP 187
                + P
Sbjct: 180 EHAFKITP 187


>gi|161525338|ref|YP_001580350.1| DNA repair protein RecO [Burkholderia multivorans ATCC 17616]
 gi|189349925|ref|YP_001945553.1| DNA repair protein RecO [Burkholderia multivorans ATCC 17616]
 gi|221201353|ref|ZP_03574392.1| DNA repair protein RecO [Burkholderia multivorans CGD2M]
 gi|221208833|ref|ZP_03581831.1| DNA repair protein RecO [Burkholderia multivorans CGD2]
 gi|160342767|gb|ABX15853.1| DNA repair protein RecO [Burkholderia multivorans ATCC 17616]
 gi|189333947|dbj|BAG43017.1| DNA repair protein [Burkholderia multivorans ATCC 17616]
 gi|221171289|gb|EEE03738.1| DNA repair protein RecO [Burkholderia multivorans CGD2]
 gi|221178621|gb|EEE11029.1| DNA repair protein RecO [Burkholderia multivorans CGD2M]
          Length = 278

 Score =  105 bits (261), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 33/234 (14%), Positives = 75/234 (32%), Gaps = 11/234 (4%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLA 63
            A +L    Y E ++I++V+TR +GR     +  +      + +LQ    + ++W  +  
Sbjct: 49  PAFVLHSYPYRETSLIVDVLTRDHGRLALVAKGAKRPHSALRGVLQTFQPLLLSWSGKSE 108

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKI 123
                             L+    L G  +   L +F    +P   L++   + L     
Sbjct: 109 VRT---LTGAEWVGGMLPLAGDALLCGFYANELLVKFCAREDPQPPLFNHYVLTLTRLAH 165

Query: 124 PSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAE-- 181
                ++    E +LL+  G+ + L + V     +            V  +     +   
Sbjct: 166 GEPAVQVLRSFERVLLRETGYAMALNRTVARRAVEPDQRYVFDPERGVRPAGDDVPSHWP 225

Query: 182 KMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGK 235
            +        +++      ++  +  L  + LN Y            R+  +  
Sbjct: 226 VVSGQTLLDMEQDDYHRPQTVTQSKTLMRFLLNTYL----GGTPLATRQILIDL 275


>gi|221214086|ref|ZP_03587059.1| DNA repair protein RecO [Burkholderia multivorans CGD1]
 gi|221166263|gb|EED98736.1| DNA repair protein RecO [Burkholderia multivorans CGD1]
          Length = 275

 Score =  105 bits (261), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 33/234 (14%), Positives = 75/234 (32%), Gaps = 11/234 (4%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLA 63
            A +L    Y E ++I++V+TR +GR     +  +      + +LQ    + ++W  +  
Sbjct: 46  PAFVLHSYPYRETSLIVDVLTRDHGRLALVAKGAKRPHSALRGVLQTFQPLLLSWSGKSE 105

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKI 123
                             L+    L G  +   L +F    +P   L++   + L     
Sbjct: 106 VRT---LTGAEWVGGMLPLAGDALLCGFYANELLVKFCAREDPQPPLFNHYVLTLTRLAH 162

Query: 124 PSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAE-- 181
                ++    E +LL+  G+ + L + V     +            V  +     +   
Sbjct: 163 GEPAVQVLRSFERVLLRETGYAMALNRTVARRAVEPDQRYVFDPERGVRPADDDVPSHWP 222

Query: 182 KMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGK 235
            +        +++      ++  +  L  + LN Y            R+  +  
Sbjct: 223 IVSGQTLLDMEQDDYHRPQTVTQSKTLMRFLLNTYL----GGTPLATRQILIDL 272


>gi|170699585|ref|ZP_02890625.1| DNA repair protein RecO [Burkholderia ambifaria IOP40-10]
 gi|170135536|gb|EDT03824.1| DNA repair protein RecO [Burkholderia ambifaria IOP40-10]
          Length = 279

 Score =  105 bits (261), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 34/234 (14%), Positives = 75/234 (32%), Gaps = 11/234 (4%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLA 63
            A +L    Y E ++I++V+TR +GR     +  +      + +LQ    + ++W  +  
Sbjct: 50  PAFVLHSYPYRETSLIIDVLTRDHGRLALVAKGAKRPHSALRGVLQTFQPLLLSWSGKSE 109

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKI 123
                             L     L G      L +F    +P   L++   + L     
Sbjct: 110 VRT---LTGAEWVGGMLPLGGDGLLCGFYVNELLVKFCAREDPQPPLFNHYVLTLTRLAH 166

Query: 124 PSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAE-K 182
                ++    E +LL+  G+ + L + V     +            V  +     +   
Sbjct: 167 GEPAVQVLRSFERVLLRETGYAMALNRTVARRAVEPDRRYVFDPERGVRNADDDVPSHWP 226

Query: 183 MLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLL-RENFLGK 235
           ++   + L  E+         +  +     L ++ L   +    L  R+  +  
Sbjct: 227 VITGQTLLDMEQDDYHRAQTVAQSKT----LMRFLLNTYLGGTPLATRQILIDL 276


>gi|115351066|ref|YP_772905.1| DNA repair protein RecO [Burkholderia ambifaria AMMD]
 gi|172060071|ref|YP_001807723.1| DNA repair protein RecO [Burkholderia ambifaria MC40-6]
 gi|115281054|gb|ABI86571.1| DNA replication and repair protein RecO [Burkholderia ambifaria
           AMMD]
 gi|171992588|gb|ACB63507.1| DNA repair protein RecO [Burkholderia ambifaria MC40-6]
          Length = 279

 Score =  105 bits (261), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 34/234 (14%), Positives = 75/234 (32%), Gaps = 11/234 (4%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLA 63
            A +L    Y E ++I++V+TR +GR     +  +      + +LQ    + ++W  +  
Sbjct: 50  PAFVLHSYPYRETSLIIDVLTRDHGRLALVAKGAKRPHSALRGVLQTFQPLLLSWSGKSE 109

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKI 123
                             L     L G      L +F    +P   L++   + L     
Sbjct: 110 VRT---LTGAEWVGGMLPLGGDGLLCGFYVNELLVKFCAREDPQPPLFNHYVLTLTRLAH 166

Query: 124 PSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAE-K 182
                ++    E +LL+  G+ + L + V     +            V  +     +   
Sbjct: 167 GEPAVQVLRSFERVLLRETGYAMALNRTVARRAVEPDRRYVFDPERGVRNADDDVPSHWP 226

Query: 183 MLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLL-RENFLGK 235
           ++   + L  E+         +  +     L ++ L   +    L  R+  +  
Sbjct: 227 VITGQTLLDMEQDDYHRAQTVAQSKT----LMRFLLNTYLGGTPLATRQILIDL 276


>gi|170695424|ref|ZP_02886569.1| DNA repair protein RecO [Burkholderia graminis C4D1M]
 gi|170139615|gb|EDT07798.1| DNA repair protein RecO [Burkholderia graminis C4D1M]
          Length = 307

 Score =  105 bits (261), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 33/234 (14%), Positives = 76/234 (32%), Gaps = 11/234 (4%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLA 63
            A +L    Y E ++I++V++R +GR     +  +      + +LQ    + ++W  +  
Sbjct: 78  PAFVLHSYPYRETSLIIDVLSRDHGRLALVAKGAKRPHSALRGVLQTFQPLALSWSGKSE 137

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKI 123
                             L+    L G      L +F    +P  +L+    + +     
Sbjct: 138 VRT---LTGAEWVGGMLPLTGDALLCGFYVNELLVKFCAREDPHPQLFHHYVVTMTRLAH 194

Query: 124 PSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAE-K 182
                ++    E +LL+  G+ + L + V                  V  +     A+  
Sbjct: 195 DEPPVQVLRSFERVLLRETGYAMSLDRTVTRKAVDAGKRYVFDPERGVREASDDLPAQWP 254

Query: 183 MLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLL-RENFLGK 235
           ++   + L  E+         +  +     L ++ L   +    L  R+  +  
Sbjct: 255 VVAGQTLLDMEQDDYHRAQTVAQSKT----LMRFLLNTYLGGTPLATRQILIDL 304


>gi|307730525|ref|YP_003907749.1| DNA repair protein RecO [Burkholderia sp. CCGE1003]
 gi|307585060|gb|ADN58458.1| DNA repair protein RecO [Burkholderia sp. CCGE1003]
          Length = 306

 Score =  104 bits (260), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 33/234 (14%), Positives = 76/234 (32%), Gaps = 11/234 (4%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLA 63
            A +L    Y E ++I++V++R +GR     +  +      + +LQ    + ++W  +  
Sbjct: 77  PAFVLHSYPYRETSLIIDVLSRDHGRLALVAKGAKRPHSALRGVLQTFQPLALSWSGKSE 136

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKI 123
                             L+    L G      L +F    +P  +L+    + +     
Sbjct: 137 VRT---LTGAEWVGGMLPLTGDALLCGFYVNELLVKFCAREDPHPQLFHHYVVTMTRLAH 193

Query: 124 PSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAE-- 181
                ++    E +LL+  G+ + L + V     +            V  +     A+  
Sbjct: 194 DEPPVQVLRSFERVLLRETGYAMSLDRTVTRKAVEAGSRYVFDPERGVREASDDLPAQWP 253

Query: 182 KMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGK 235
            +        +++    A ++  +  L  + LN Y            R+  +  
Sbjct: 254 VVAGQTLLDMEKDDYHRAQTVAQSKTLMRFLLNTYL----GGTPLATRQILIDL 303


>gi|330860317|emb|CBX70631.1| DNA repair protein recO [Yersinia enterocolitica W22703]
          Length = 231

 Score =  104 bits (260), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 43/218 (19%), Positives = 70/218 (32%), Gaps = 8/218 (3%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVN 57
           M  WQ  A +L  R Y E +++L++ T   GR     +  +  R   +  LQ    + V 
Sbjct: 1   MEGWQ-RAFVLHGRPYSETSLMLDLFTEGEGRMRVLAKGARGRRSNLKGCLQPFTPLLVR 59

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
              R                 A  L+ S+   GL     L R L  +     L+      
Sbjct: 60  CTGRGEVKTLRSAEP---VSLALPLAGSMLYSGLYVNELLSRVLEHQTNYSALFFDYLHC 116

Query: 118 LNCHKIPS-VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVG 176
           L               Q EL +L ++G+G+D   C  +G                  +  
Sbjct: 117 LQSLAGSDGSPEYALRQFELAILAHLGYGVDFLHCAGSGQPVSDTMTYRYREEKGFIASL 176

Query: 177 LPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLN 214
           +                 +  DAD+L++A + T   L 
Sbjct: 177 VVDHYSFTGRQLLALANREFPDADTLRAAKRFTRIALK 214


>gi|323526857|ref|YP_004229010.1| DNA repair protein RecO [Burkholderia sp. CCGE1001]
 gi|323383859|gb|ADX55950.1| DNA repair protein RecO [Burkholderia sp. CCGE1001]
          Length = 306

 Score =  104 bits (260), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 34/234 (14%), Positives = 77/234 (32%), Gaps = 11/234 (4%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLA 63
            A +L    Y E ++I++V++R +GR     +  +      + +LQ    + ++W  +  
Sbjct: 77  PAFVLHSYPYRETSLIIDVLSRDHGRLALVAKGAKRPHSALRGVLQTFQPLALSWSGKSE 136

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKI 123
                             L+    L G      L +F    +P  +L+    + +     
Sbjct: 137 VRT---LTGAEWVGGMLPLTGDALLCGFYVNELLVKFCAREDPHPQLFHHYVVTMTRLAH 193

Query: 124 PSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAE-- 181
                ++    E +LL+  G+ + L + V     +            V  + G   A+  
Sbjct: 194 DEPPVQVLRSFERVLLRETGYAMSLDRTVARRAVEAGGRYVFDPERGVREASGDLPAQWP 253

Query: 182 KMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGK 235
            +        +++    A ++  +  L  + LN Y            R+  +  
Sbjct: 254 VVAGQTLLDMEKDDYHRAQTVAQSKTLMRFLLNTYL----GGTPLATRQILIDL 303


>gi|113868515|ref|YP_727004.1| DNA repair protein RecO [Ralstonia eutropha H16]
 gi|113527291|emb|CAJ93636.1| combinational DNA repair protein (RecF pathway) [Ralstonia eutropha
           H16]
          Length = 297

 Score =  104 bits (260), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 30/148 (20%), Positives = 49/148 (33%), Gaps = 5/148 (3%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLA 63
              +L    Y E ++IL++ TR YGR     +  +      + +LQ  + V V+W  R  
Sbjct: 67  PGFVLHAWPYRETSLILDLFTRDYGRISMVAKGAKRPHSALRAVLQHFHPVSVSWSGRGE 126

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKI 123
                     +             L        L RF P  +    L+      L     
Sbjct: 127 VKTLTKAE-WVGGMPPLAGD--ALLSAFYLNELLMRFCPREDAHPALFRHYLTTLTRLAH 183

Query: 124 PSVIGKIFVQIELMLLKNIGFGLDLTKC 151
               G +    E +LL+  GF +   +C
Sbjct: 184 GEQAGLVLRSFERVLLQETGFAVAFDQC 211


>gi|229916326|ref|YP_002884972.1| DNA repair protein RecO [Exiguobacterium sp. AT1b]
 gi|259563678|sp|C4L405|RECO_EXISA RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|229467755|gb|ACQ69527.1| DNA repair protein RecO [Exiguobacterium sp. AT1b]
          Length = 249

 Score =  104 bits (260), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 33/173 (19%), Positives = 68/173 (39%), Gaps = 1/173 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M  +   I++   +YGE N ++ + T + G+     R  +    +    +   V   +  
Sbjct: 1   MLQKVTGIVVRTVNYGESNKVVTLFTEELGKVAIMARGAKKPGSRFHASSQPFVEGVYIF 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFL-YGLQSIVPLFRFLPEREPCLELYDMLNIFLN 119
             ++ L + +   + +   ++      + Y +  +  + R + +R     L+ +L   L 
Sbjct: 61  PSSRGLAQLKSSDVMTSYPEIRKDVERMAYAMYWLELVDRSVEDRVQNRPLFRILQDALQ 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVC 172
                     I   +EL +L  +G    LT CV  G   D ++ S  SGG +C
Sbjct: 121 ALNAGMDADVITHYVELRILHLLGVAPVLTGCVRCGDVTDPMYFSVASGGFLC 173


>gi|292492474|ref|YP_003527913.1| DNA repair protein RecO [Nitrosococcus halophilus Nc4]
 gi|291581069|gb|ADE15526.1| DNA repair protein RecO [Nitrosococcus halophilus Nc4]
          Length = 249

 Score =  104 bits (260), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 45/235 (19%), Positives = 74/235 (31%), Gaps = 13/235 (5%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQ--PILQAGNLVRVNWRSRLA 63
            A +L +R Y E + ++E+ T+ YGR     +  +  R +   +LQ    + ++W  R  
Sbjct: 7   PAYVLHLRPYRETSALVEIFTQDYGRVGLVAKGVRQRRSKAIGLLQPFCPLLLSWVGRSD 66

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKI 123
                       +     L+    +        L R LP R+P   L+ +    L     
Sbjct: 67  LVT---LTGAEAAGRGPALTGEGLVCAFYLNELLLRLLPRRDPFEALFSVYAHSLPPLAN 123

Query: 124 PSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGV-TQDLLWVSPKSGGAVCRSVGLPYAE- 181
                +     E  LL  +G+GL LT    T        W S +      R         
Sbjct: 124 SQQRQQALRLFERDLLTYLGYGLTLTHEADTHRPIDAEQWYSYQLEKGPQRFQSEDLGGM 183

Query: 182 KMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENFLGK 235
           K+           +  D  SL  A Q     L ++ L   +       R      
Sbjct: 184 KVRGRTLQALARGELADPVSLHEAKQ-----LLRWLLAFQLGDKPLKSRALLEEL 233


>gi|167586635|ref|ZP_02379023.1| DNA repair protein RecO [Burkholderia ubonensis Bu]
          Length = 255

 Score =  104 bits (260), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 34/234 (14%), Positives = 77/234 (32%), Gaps = 11/234 (4%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLA 63
            A +L    Y E ++I++V+TR +GR     +  +      + +LQ    + ++W  +  
Sbjct: 26  PAFVLHSYPYRETSLIIDVLTRDHGRLALVAKGAKRPHSALRGVLQTFQPLLLSWSGKSE 85

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKI 123
                             L+    L G  +   L +F    +P   L++   + L     
Sbjct: 86  ---MRTLTGAEWVGGMLPLAGDALLCGFYANELLVKFCAREDPQPPLFNHYVVTLTRLAH 142

Query: 124 PSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAE-K 182
                ++    E +LL+  G+ + L + V     +            V  +     +   
Sbjct: 143 GEPAVQVLRSFERVLLRETGYAMALNRTVARRAVEADRLYVFDPERGVRGADDDVPSHWP 202

Query: 183 MLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLL-RENFLGK 235
           ++   + L  E+         +  +     L ++ L   +    L  R+  +  
Sbjct: 203 VVSGQTLLDMEQDDYHRAQTVAQSKT----LMRFLLNTYLGGTPLATRQILIDL 252


>gi|313201512|ref|YP_004040170.1| DNA repair protein reco [Methylovorus sp. MP688]
 gi|312440828|gb|ADQ84934.1| DNA repair protein RecO [Methylovorus sp. MP688]
          Length = 230

 Score =  104 bits (259), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 35/234 (14%), Positives = 76/234 (32%), Gaps = 14/234 (5%)

Query: 8   IILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLAQN 65
            +L    + E ++++E+ +R +GR     +  +  R   + +LQ+   +   W  +    
Sbjct: 2   YVLHTYPFKETSLVVELFSRDFGRVAAVAKGARRPRSAMRGMLQSFQPLLATWSGKAELK 61

Query: 66  LGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPS 125
                  +       LL     + G      L R LP  +    L+      L      +
Sbjct: 62  TLH---SLEWGSGLLLLQGDALMCGFYMNELLLRLLPREDSHDALFAYYGDTLRTLSQSA 118

Query: 126 VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVG-LPYAEKML 184
                  + EL +L+ +G+ + L         +        +    C     LP A ++ 
Sbjct: 119 EHATSLRRFELRMLQEMGYAVPLLNDERDQPIEAERVYEYVAERGACTGATPLPAANRVQ 178

Query: 185 VLPSFLWK--EEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENFLGK 235
           +    L     +   D+ + + + Q     L +  L H +       R+  +  
Sbjct: 179 LRGKTLLDMARDDYADSQTQQQSKQ-----LMRMLLAHYLGDKPLHTRQLLIDL 227


>gi|119774019|ref|YP_926759.1| DNA repair protein RecO [Shewanella amazonensis SB2B]
 gi|119766519|gb|ABL99089.1| DNA repair protein RecO [Shewanella amazonensis SB2B]
          Length = 224

 Score =  104 bits (259), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 36/233 (15%), Positives = 68/233 (29%), Gaps = 15/233 (6%)

Query: 5   DDAIILGVRSYGEKNIILEVMTRQYGRHLGFVR-NGQSHRMQPILQAGNLVRVNWRSRLA 63
           +   +L  R Y E + I+ ++    GR     R        + +LQ    +  +   +  
Sbjct: 2   ERGYLLHSRPYRENSAIVNLLVDGAGRVDAIARLGSGKRSSRALLQPFQPLLFSLSGKGE 61

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKI 123
                          A  L        +     L R L        L+   +  L     
Sbjct: 62  LRTLIQPEAYA---PAIPLQGDALYAAMYLNELLMRCLSHSHAGEGLFFSYHQTLMSMAK 118

Query: 124 PSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKM 183
                ++    EL LL+ +G    L+   +           P   G +         EK 
Sbjct: 119 GFCQSQLR-YFELSLLEELGACPSLSDDTLGTAISAECAYRPCPEGGL----APSTLEKA 173

Query: 184 LVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHL-LRENFLGK 235
           +   + L   E+ +      +A Q     L ++ L   + +  L  R+ F  +
Sbjct: 174 ISGRAILALAEKNLSEADFAAARQ-----LLRFLLAPFVGNKPLVSRQLFANR 221


>gi|73541937|ref|YP_296457.1| DNA repair protein RecO [Ralstonia eutropha JMP134]
 gi|119361473|sp|Q46Z20|RECO_RALEJ RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|72119350|gb|AAZ61613.1| DNA replication and repair protein RecO [Ralstonia eutropha JMP134]
          Length = 291

 Score =  104 bits (259), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 29/148 (19%), Positives = 50/148 (33%), Gaps = 5/148 (3%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLA 63
              +L    Y E ++IL+V TR +GR     +  +      +P+LQ  + + ++W  R  
Sbjct: 61  PGFVLHAWPYRETSLILDVFTRDHGRLSMVAKGAKRPHSALRPVLQHFHPISLSWSGRGE 120

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKI 123
                     +             L        L RF P  +    L+      L     
Sbjct: 121 VKTLTRAE-WVGGMPPLAGD--ALLSAFYLNELLMRFCPREDGHPALFRHYMATLTRLAH 177

Query: 124 PSVIGKIFVQIELMLLKNIGFGLDLTKC 151
               G +    E +LL+  GF +   +C
Sbjct: 178 GEAAGLVLRSFERVLLQETGFAVAFDQC 205


>gi|332975859|gb|EGK12737.1| recombination protein O [Desmospora sp. 8437]
          Length = 250

 Score =  104 bits (259), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 42/252 (16%), Positives = 84/252 (33%), Gaps = 21/252 (8%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNW-R 59
           M  + + +++  R YGE + ++ + T+ +G++    R  +  + +            +  
Sbjct: 1   MLEKLEGVVIRTRDYGESHKVVILFTKAHGKYAVMARGAKKPKSRLAAVTQPFTSGEYLC 60

Query: 60  SRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLN 119
              +      + ++LES            Y       L +   E+EP L +Y  L   LN
Sbjct: 61  FTGSGMATLSQGDILESRHLLRSDLVRASYAAYWTELLDKLKEEKEPDLPVYIWLETVLN 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
             +       +    EL +L++ G+   L  CV  G     +  S + GG +C       
Sbjct: 121 LLEEGVDPEILSRIFELKVLESAGYRPRLQGCVQCGGADTPVKFSIRQGGFLCSGC---- 176

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAF---QL--------TDYFLNKYA--LQHNIIHCH 226
                  P  L+          + +     +L        T   L +         I   
Sbjct: 177 ---SHRDPEALFLSPAAARILGILAGISPQRLGQIRVKEETRRQLERILRSFIDEYIDLP 233

Query: 227 LLRENFLGKLLE 238
           L   +FL ++ +
Sbjct: 234 LRSRDFLDRMKK 245


>gi|297516304|ref|ZP_06934690.1| DNA repair protein RecO [Escherichia coli OP50]
          Length = 161

 Score =  104 bits (258), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 37/163 (22%), Positives = 60/163 (36%), Gaps = 8/163 (4%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVN 57
           M  WQ  A +L  R + E +++L+V T + GR     +  +S R   +  LQ    + + 
Sbjct: 1   MEGWQ-RAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKRSTLKGALQPFTPLLLR 59

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
           +  R                 A  LS      GL     L R L       EL+      
Sbjct: 60  FGGRGEVKTLR---SAEAVSLALPLSGITLYSGLYINELLSRVLEYETRFSELFFDYLHC 116

Query: 118 LNCHK-IPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQD 159
           +     +         + EL LL ++G+G++ T C  +G   D
Sbjct: 117 IQSLAGVTGTPEPALRRFELALLGHLGYGVNFTHCAGSGEPVD 159


>gi|116872891|ref|YP_849672.1| DNA repair protein RecO [Listeria welshimeri serovar 6b str.
           SLCC5334]
 gi|123461072|sp|A0AIR1|RECO_LISW6 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|116741769|emb|CAK20893.1| recombination protein O [Listeria welshimeri serovar 6b str.
           SLCC5334]
          Length = 255

 Score =  104 bits (258), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 42/250 (16%), Positives = 81/250 (32%), Gaps = 20/250 (8%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQN 65
           + I++   SY E + I+ + TR++G+     R  +  + +            +       
Sbjct: 5   EGIVIRQTSYRESDKIVRMYTREFGKIGVVARGAKKTKSRLAAVTQLFTNGYFTFFGGNG 64

Query: 66  LGE-FRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIP 124
           LG   + EV+E+  +      +  Y       L +   ER+P   LY++    L      
Sbjct: 65  LGTLQQGEVIENFSSIQQDIFMTAYATYVCELLDKATEERQPNPYLYELTFQILRDIDEG 124

Query: 125 SVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKML 184
                +    E+ +L  +G    + KC + G T      S +S G +C         +M 
Sbjct: 125 YDPQILTQIYEMKMLPVLGLYPTMDKCAICGETTGHFDFSTRSNGIICHRCFEKDRYRMH 184

Query: 185 VLPS-------FLWKEEQTIDADSLKSAFQLTDYFLNKYA---LQHNIIHCHLLRENF-- 232
           +  +       F   +   +    +K     T  +L K        N       R+    
Sbjct: 185 LPENVVKLLRLFFIFQLDRLGNIDVKQE---TKDWLQKAIDTYYDENSGLYLKSRKFLRD 241

Query: 233 ----LGKLLE 238
                  L +
Sbjct: 242 MDKWENMLKK 251


>gi|89100472|ref|ZP_01173334.1| DNA repair protein RecO [Bacillus sp. NRRL B-14911]
 gi|89084815|gb|EAR63954.1| DNA repair protein RecO [Bacillus sp. NRRL B-14911]
          Length = 253

 Score =  104 bits (258), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 37/191 (19%), Positives = 73/191 (38%), Gaps = 1/191 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNW-R 59
           M+ + + I+L   +YGE N I+ + TR++G+     R  +    +            +  
Sbjct: 1   MFEKCEGIVLRTVNYGESNKIVTLYTREWGKVGVMARGAKKPNSRLSAVTQPFTYGYFLV 60

Query: 60  SRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLN 119
            R +      + E++ S  +      L  Y    +    + + E++P    +++L+  LN
Sbjct: 61  QRSSGLGLMQQGEMVSSMRSIREDIFLTAYASYIVDLTDKTVEEKKPNPFHFELLHQTLN 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                     +    E+ +L ++G    L KC V G T      S + GG +C       
Sbjct: 121 YMNEGYDPEIMVNIYEMKMLNSLGLYPVLDKCSVCGSTDGHFSFSIREGGLICHRCLEKD 180

Query: 180 AEKMLVLPSFL 190
                + P+ L
Sbjct: 181 PYHYKISPAAL 191


>gi|330815988|ref|YP_004359693.1| DNA repair protein RecO [Burkholderia gladioli BSR3]
 gi|327368381|gb|AEA59737.1| DNA repair protein RecO [Burkholderia gladioli BSR3]
          Length = 295

 Score =  104 bits (258), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 35/234 (14%), Positives = 70/234 (29%), Gaps = 11/234 (4%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLA 63
              +L    Y E ++I++V+TR +GR     +  +      + +LQ    + ++W  +  
Sbjct: 66  PGFVLHSYPYRETSLIIDVLTRDHGRVALVAKGAKRPHSALRGVLQTFQPLSLSWSGKSE 125

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKI 123
                             L     L G      L +F    +P   L+    + L     
Sbjct: 126 ---MRTLTGAEWVGGMLPLGGDALLCGFYVNELLVKFCAREDPFPPLFQHYLVTLARLAH 182

Query: 124 PSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAE-- 181
                ++    E +LL+  G+   L +       Q            V  +     A   
Sbjct: 183 DEPAVQVLRSFERVLLRETGYARALNRTTARRSVQPEGRYVFDPERGVREASDELPAHWP 242

Query: 182 KMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGK 235
            +        +E+    A ++  +  L  + LN Y            R+  +  
Sbjct: 243 VVAGQTLLDMEEDDYHRAQTVAQSKTLMRFLLNTYL----GGTPLATRQILIDL 292


>gi|313633230|gb|EFS00100.1| DNA repair protein RecO [Listeria seeligeri FSL N1-067]
          Length = 255

 Score =  104 bits (258), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 34/186 (18%), Positives = 68/186 (36%), Gaps = 1/186 (0%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQN 65
           + I++   SY E + I+ + TR++G+     R  +  + +            +       
Sbjct: 5   EGIVIRQTSYRESDKIVRMYTREFGKIGVVARGAKKTKSRLAAVTQLFTSGYFTFFGGNG 64

Query: 66  LGE-FRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIP 124
           LG   + EV+E+  +      +  Y       L +   ER+P   LY++    L      
Sbjct: 65  LGTLQQGEVIENFPSIQQDIFMTAYATYVCELLDKATEERQPNPYLYELTFQILRDIDEG 124

Query: 125 SVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKML 184
                +    E+ +L  +G    + KC + G T      S +S G +C         +M 
Sbjct: 125 YDPQILTQIFEMKMLPVLGHYPTMDKCAICGETTGHFDFSTRSNGIICHRCFDKDRYRMH 184

Query: 185 VLPSFL 190
           +  + +
Sbjct: 185 LPENVV 190


>gi|308174316|ref|YP_003921021.1| DNA double strand break repair and homologous recombination factor
           [Bacillus amyloliquefaciens DSM 7]
 gi|307607180|emb|CBI43551.1| DNA double strand break repair and homologous recombination factor
           [Bacillus amyloliquefaciens DSM 7]
          Length = 255

 Score =  104 bits (258), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 29/179 (16%), Positives = 64/179 (35%), Gaps = 1/179 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNW-R 59
           M  + + I+L    YGE N I+ ++TR++G+     R  +    +    +   +  ++  
Sbjct: 1   MLTKCEGIVLRTNDYGEMNKIVTLLTREHGKIGVMARGARKSASRLSAVSQPFLYGSFLM 60

Query: 60  SRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLN 119
            R +      + E++ S         L  Y         +   E++P   L++++     
Sbjct: 61  QRTSGLGTLQQGEMILSMRTIREDLFLTAYAAFIAELTDKGTEEKKPNPYLFELILESFK 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
                +    I   +++ +L  +G   +L  CV           S +  G +C      
Sbjct: 121 RLNEGTDPDVITFIVQMKMLGVMGLYPELNHCVHCKSRDGTFHFSVRDNGFICHRCFGK 179


>gi|209517220|ref|ZP_03266065.1| DNA repair protein RecO [Burkholderia sp. H160]
 gi|209502356|gb|EEA02367.1| DNA repair protein RecO [Burkholderia sp. H160]
          Length = 301

 Score =  104 bits (258), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 34/236 (14%), Positives = 75/236 (31%), Gaps = 15/236 (6%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLA 63
            A +L    Y E ++I++V++R +GR     +  +      + +LQ    + + W  +  
Sbjct: 72  PAFVLHSYPYRETSLIIDVLSRDHGRLALVAKGAKRPHSALRGVLQTFQPLSLAWSGKSE 131

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKI 123
                             L+    L G      L RF    +P  +L+    + L     
Sbjct: 132 ---MRTLTGAEWVGGMLPLTGDALLCGFYVNELLVRFCAREDPHPQLFHHYVVTLTRLAH 188

Query: 124 PSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEK- 182
                ++    E +LL+  G+ + L + V                  V R     +  + 
Sbjct: 189 DEPPVQVLRSFERVLLRETGYAMALDRTVARKAVLADGRYVFDPERGV-REASDEWPAQW 247

Query: 183 --MLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLL-RENFLGK 235
             +        +++    A ++  +       L ++ L   +    L  R+  +  
Sbjct: 248 PVVSGQTLLDMEKDDYHRAQTVAQSKT-----LMRFLLNTYLGGAPLATRQILIDL 298


>gi|289434742|ref|YP_003464614.1| recombination protein O [Listeria seeligeri serovar 1/2b str.
           SLCC3954]
 gi|289170986|emb|CBH27528.1| recombination protein O [Listeria seeligeri serovar 1/2b str.
           SLCC3954]
          Length = 255

 Score =  104 bits (258), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 34/186 (18%), Positives = 68/186 (36%), Gaps = 1/186 (0%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQN 65
           + I++   SY E + I+ + TR++G+     R  +  + +            +       
Sbjct: 5   EGIVIRQTSYRESDKIVRMYTREFGKIGVVARGAKKTKSRLAAVTQLFTSGYFTFFGGNG 64

Query: 66  LGE-FRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIP 124
           LG   + EV+E+  +      +  Y       L +   ER+P   LY++    L      
Sbjct: 65  LGTLQQGEVIENFSSIQQDIFMTAYATYVCELLDKATEERQPNPYLYELTFQILRDIDEG 124

Query: 125 SVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKML 184
                +    E+ +L  +G    + KC + G T      S +S G +C         +M 
Sbjct: 125 YDPQILTQIFEMKMLPVLGHYPTMDKCAICGETTGHFDFSTRSNGIICHRCFDKDRYRMH 184

Query: 185 VLPSFL 190
           +  + +
Sbjct: 185 LPENVV 190


>gi|77164312|ref|YP_342837.1| recombination protein O, RecO [Nitrosococcus oceani ATCC 19707]
 gi|254434720|ref|ZP_05048228.1| DNA repair protein RecO [Nitrosococcus oceani AFC27]
 gi|92087029|sp|Q3JCY9|RECO_NITOC RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|76882626|gb|ABA57307.1| DNA replication and repair protein RecO [Nitrosococcus oceani ATCC
           19707]
 gi|207091053|gb|EDZ68324.1| DNA repair protein RecO [Nitrosococcus oceani AFC27]
          Length = 246

 Score =  103 bits (257), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 45/235 (19%), Positives = 75/235 (31%), Gaps = 13/235 (5%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNWRSRLA 63
            A +L  R Y E + ++EV T +YGR     +  +  R     +LQ    + ++W  R  
Sbjct: 7   PAYVLHSRPYRETSALVEVFTPEYGRVGLVAKGVKRQRTHRFSLLQPFCPLLLSWTGRGD 66

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKI 123
                       +    +L+    +        L R LP R+P   L+ +    L     
Sbjct: 67  LVT---LTGAEAAGPIPVLTGEGLICAFYLNELLLRLLPRRDPLEALFSVYAHSLPSLIH 123

Query: 124 PSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGV-TQDLLWVSPKSGGAVCRSVGLPYAE- 181
                +I    E  LL  +G+GL L     T    +   W S +      R +       
Sbjct: 124 AQQRQQILRLFERDLLAYLGYGLILKYEAGTSRPIEAGQWYSYQLEKGPVRLLSEDLEGM 183

Query: 182 KMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENFLGK 235
           K+              D  SL  A +     L ++ L  ++       R      
Sbjct: 184 KVRGHTLQALARGALADPASLGEAKR-----LLRWLLAFHLGDKPLKSRGLLEEL 233


>gi|313637816|gb|EFS03157.1| DNA repair protein RecO [Listeria seeligeri FSL S4-171]
          Length = 255

 Score =  103 bits (257), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 34/186 (18%), Positives = 68/186 (36%), Gaps = 1/186 (0%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQN 65
           + I++   SY E + I+ + TR++G+     R  +  + +            +       
Sbjct: 5   EGIVIRQTSYRESDKIVRMYTREFGKIGVVARGAKKTKSRLAAVTQLFTSGYFTFFGGNG 64

Query: 66  LGE-FRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIP 124
           LG   + EV+E+  +      +  Y       L +   ER+P   LY++    L      
Sbjct: 65  LGTLQQGEVIENFSSIQQDIFMTAYATYVCELLDKATEERQPNPYLYELTFQILRDIDEG 124

Query: 125 SVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKML 184
                +    E+ +L  +G    + KC + G T      S +S G +C         +M 
Sbjct: 125 YDPQILTQIFEMKMLPVLGHYPTMDKCAICGETTGHFDFSTRSNGIICHRCFDKDRYRMH 184

Query: 185 VLPSFL 190
           +  + +
Sbjct: 185 LPENVV 190


>gi|145588595|ref|YP_001155192.1| DNA repair protein RecO [Polynucleobacter necessarius subsp.
           asymbioticus QLW-P1DMWA-1]
 gi|254764653|sp|A4SVW4|RECO_POLSQ RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|145047001|gb|ABP33628.1| DNA replication and repair protein RecO [Polynucleobacter
           necessarius subsp. asymbioticus QLW-P1DMWA-1]
          Length = 244

 Score =  103 bits (257), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 45/219 (20%), Positives = 79/219 (36%), Gaps = 12/219 (5%)

Query: 4   QDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSR 61
            + A +L    Y E ++IL+V TRQ+GR     +  +      +P+LQ    + V+W  +
Sbjct: 8   DEPAFVLHSIPYKETSLILDVFTRQHGRMALIAKGAKRPHSVLRPVLQRFQPLLVSWSGK 67

Query: 62  LAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCH 121
                   + E +    + +      L G      L +FL   +    LYD  +  +N  
Sbjct: 68  SELRT-LTKSEWVGGMPSLVGD--ALLCGFYLNELLVKFLAREDDYERLYDRYSETINAL 124

Query: 122 KIPSVI----GKIFVQIELMLLKNIGFGLDLTKCVVTGV---TQDLLWVSPKSGGAVCRS 174
                      +I    EL LL+  G+   L +CV T      + L    P+ G    + 
Sbjct: 125 SNLEFESKGLEEILRPFELSLLQETGYAAALDRCVETNDSPVFEALYVYQPERGVRPIQV 184

Query: 175 VGLPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFL 213
               +   +              D ++L  + QL  + L
Sbjct: 185 DDPGHWPVLRGKSLLAIAAGDFSDPETLSESKQLMRFLL 223


>gi|254252843|ref|ZP_04946161.1| Recombinational DNA repair protein (RecF pathway) [Burkholderia
           dolosa AUO158]
 gi|124895452|gb|EAY69332.1| Recombinational DNA repair protein (RecF pathway) [Burkholderia
           dolosa AUO158]
          Length = 278

 Score =  103 bits (257), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 32/216 (14%), Positives = 71/216 (32%), Gaps = 7/216 (3%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLA 63
            A +L    Y E ++I++V+TR +GR     +  +      + +LQ    + ++W  +  
Sbjct: 49  PAFVLHSYPYRETSLIIDVLTRDHGRLALVAKGAKRPHSALRGVLQTFQPLLLSWSGKSE 108

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKI 123
                             L     L G  +   L +F    +    L++   + L     
Sbjct: 109 VRT---LTGAEWVGGMLPLGGDALLCGFYANELLVKFCAREDSQPPLFNHYVLTLTRLAH 165

Query: 124 PSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAE-- 181
                ++    E +LL+  G+ + L + V     +            V  +     +   
Sbjct: 166 GEPAVQVLRSFERVLLRETGYAMALNRTVARRAVEPDRRYVFDPERGVRNADDDVPSHWP 225

Query: 182 KMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYA 217
            +        +++    A ++  +  L  + LN Y 
Sbjct: 226 VVSGQTLLDMEQDDYHRAQTVAQSKTLMRFLLNTYL 261


>gi|330502447|ref|YP_004379316.1| DNA repair protein RecO [Pseudomonas mendocina NK-01]
 gi|328916733|gb|AEB57564.1| DNA repair protein RecO [Pseudomonas mendocina NK-01]
          Length = 229

 Score =  103 bits (257), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 43/233 (18%), Positives = 76/233 (32%), Gaps = 13/233 (5%)

Query: 7   AIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQNL 66
           A +L  R Y E + +++  T   GR    +R  +  ++  I +    + +  R R     
Sbjct: 5   AYVLHSRPYKESSALVDFFTA-QGRIRAVLRAARG-KVGSIARPFAPLELELRGRGELKT 62

Query: 67  GEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPSV 126
                 +  +    LL+      GL     L R LP  +P   + +   + L        
Sbjct: 63  ---VGRLESAGIPLLLTGEALFSGLYLNELLIRLLPAEDPHPAMLEHYGLTLQALAAGRP 119

Query: 127 IGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKMLVL 186
           +  +    E  LL  +G+G  L +               +    +   V L      L  
Sbjct: 120 LEPLLRAFEWRLLDELGYGFALDRDQHDQAIDPAALYRWQQDIGLVPVVQLQ-PGVFLGR 178

Query: 187 PSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHL-LRENFLGKLLE 238
                 E       +L +A +     L + AL  ++    L  RE F+  L E
Sbjct: 179 ELLAMAEADWQTPGALAAAKR-----LMRQALAPHLGGRPLVSRELFM-TLKE 225


>gi|16803500|ref|NP_464985.1| DNA repair protein RecO [Listeria monocytogenes EGD-e]
 gi|217964394|ref|YP_002350072.1| DNA repair protein RecO [Listeria monocytogenes HCC23]
 gi|224499690|ref|ZP_03668039.1| DNA repair protein RecO [Listeria monocytogenes Finland 1988]
 gi|254827748|ref|ZP_05232435.1| DNA repair protein recO [Listeria monocytogenes FSL N3-165]
 gi|254829781|ref|ZP_05234436.1| DNA repair protein RecO [Listeria monocytogenes 10403S]
 gi|255030078|ref|ZP_05302029.1| DNA repair protein RecO [Listeria monocytogenes LO28]
 gi|290894222|ref|ZP_06557191.1| DNA repair protein recO [Listeria monocytogenes FSL J2-071]
 gi|20139471|sp|Q8Y752|RECO_LISMO RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|254764641|sp|B8DE51|RECO_LISMH RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|16410889|emb|CAC99538.1| lmo1460 [Listeria monocytogenes EGD-e]
 gi|217333664|gb|ACK39458.1| DNA repair protein RecO [Listeria monocytogenes HCC23]
 gi|258600127|gb|EEW13452.1| DNA repair protein recO [Listeria monocytogenes FSL N3-165]
 gi|290556219|gb|EFD89764.1| DNA repair protein recO [Listeria monocytogenes FSL J2-071]
 gi|307571041|emb|CAR84220.1| DNA repair protein O [Listeria monocytogenes L99]
 gi|313608757|gb|EFR84575.1| DNA repair protein RecO [Listeria monocytogenes FSL F2-208]
          Length = 255

 Score =  103 bits (257), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 34/186 (18%), Positives = 67/186 (36%), Gaps = 1/186 (0%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQN 65
           + I++   SY E + I+ + TR++G+     R  +  + +            +       
Sbjct: 5   EGIVIRQTSYRESDKIVRMYTREFGKIGVVARGAKKTKSRLAAVTQLFTNGYFTFFGGNG 64

Query: 66  LGE-FRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIP 124
           LG   + EV+E+  +      +  Y       L +   ER+P   LY++    L      
Sbjct: 65  LGTLQQGEVIETFSSIQQDIFMTAYATYVCELLDKATEERQPNPYLYELTFQILRDIDEG 124

Query: 125 SVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKML 184
                +    E+ +L  +G    + KC + G T      S  S G +C         +M 
Sbjct: 125 YDPQILTQIYEMKMLPVLGLYPTMDKCAICGETTGHFDFSTSSNGIICHRCFEKDRYRMH 184

Query: 185 VLPSFL 190
           +  + +
Sbjct: 185 LPENVV 190


>gi|295677174|ref|YP_003605698.1| DNA repair protein RecO [Burkholderia sp. CCGE1002]
 gi|295437017|gb|ADG16187.1| DNA repair protein RecO [Burkholderia sp. CCGE1002]
          Length = 301

 Score =  103 bits (257), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 34/236 (14%), Positives = 75/236 (31%), Gaps = 15/236 (6%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLA 63
            A +L    Y E ++I++V++R +GR     +  +      + +LQ    + + W  +  
Sbjct: 72  PAFVLHSYPYRETSLIIDVLSRDHGRLALVAKGAKRPHSALRGVLQTFQPLSLAWSGKSE 131

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKI 123
                             L+    L G      L RF    +P  +L+    + L     
Sbjct: 132 ---MRTLTGAEWVGGMLPLTGDALLCGFYVNELLVRFCAREDPHPQLFHHYVVTLTRLAH 188

Query: 124 PSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEK- 182
                ++    E +LL+  G+ + L + V                  V R     +  + 
Sbjct: 189 DEPPVQVLRSFERVLLRETGYAMALDRTVARKAVLADGRYVFDPERGV-REASDEWPAQW 247

Query: 183 --MLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLL-RENFLGK 235
             +        +++    A ++  +       L ++ L   +    L  R+  +  
Sbjct: 248 PVVAGQTLLDMEKDDYHRAQTVAQSKT-----LMRFLLNTYLGGAPLATRQILIDL 298


>gi|329912352|ref|ZP_08275733.1| DNA recombination and repair protein RecO [Oxalobacteraceae
           bacterium IMCC9480]
 gi|327545639|gb|EGF30797.1| DNA recombination and repair protein RecO [Oxalobacteraceae
           bacterium IMCC9480]
          Length = 264

 Score =  103 bits (257), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 37/234 (15%), Positives = 71/234 (30%), Gaps = 12/234 (5%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLA 63
              +L    + E ++I++V TR++GR     +  +      + +LQ    + ++W  +  
Sbjct: 36  PGFVLHSYPHKETSLIIDVFTREHGRIALVAKGAKRPHSALRGVLQTFQPLSLSWTGKSE 95

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKI 123
                             L  S  L G      L + +   +P   L+D     LN    
Sbjct: 96  ---IRTLTAAEWVGGLLPLEKSALLCGFYLNELLVKLIARDDPHPGLFDHYVSALNQLAH 152

Query: 124 PSVIGKIFVQIELMLLKNIGFGLDLTKCV-VTGVTQDLLWVSPKSGGAVCRSVGLPYAEK 182
                 +  + EL L+K  G   DL+ C                    V  +       +
Sbjct: 153 GEAATIVLRKFELSLMKQTGVAADLSLCSGTREPVVPTSSYVVDPERGVRLARPSDIWPR 212

Query: 183 MLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLL-RENFLGK 235
           +        + E      +          FL ++ L H +    L  R+  +  
Sbjct: 213 VSGQTLLDMEREDYAGTTTQSQ-----SKFLMRFLLAHQLGGVPLNTRQILIDL 261


>gi|284801847|ref|YP_003413712.1| DNA repair protein RecO [Listeria monocytogenes 08-5578]
 gi|284994989|ref|YP_003416757.1| DNA repair protein RecO [Listeria monocytogenes 08-5923]
 gi|284057409|gb|ADB68350.1| DNA repair protein RecO [Listeria monocytogenes 08-5578]
 gi|284060456|gb|ADB71395.1| DNA repair protein RecO [Listeria monocytogenes 08-5923]
          Length = 255

 Score =  103 bits (257), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 34/186 (18%), Positives = 68/186 (36%), Gaps = 1/186 (0%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQN 65
           + I++   SY E + I+ + TR++G+     R  +  + +            +    +  
Sbjct: 5   EGIVIRQTSYRESDKIVRMYTREFGKIGVVARGAKKTKSRLAAVTQLFTNGYFTFFGSNG 64

Query: 66  LGE-FRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIP 124
           LG   + EV+E+  +      +  Y       L +   ER+P   LY++    L      
Sbjct: 65  LGTLQQGEVIENFSSIQQDIFMTAYATYVCELLDKATEERQPNPYLYELTFQILRDIDEG 124

Query: 125 SVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKML 184
                +    E+ +L  +G    + KC + G T      S  S G +C         +M 
Sbjct: 125 YDPQILTQIYEMKMLPVLGLYPTMDKCAICGETTGHFDFSTSSNGIICHRCFEKDRYRMH 184

Query: 185 VLPSFL 190
           +  + +
Sbjct: 185 LPENVV 190


>gi|296158232|ref|ZP_06841064.1| DNA repair protein RecO [Burkholderia sp. Ch1-1]
 gi|295891568|gb|EFG71354.1| DNA repair protein RecO [Burkholderia sp. Ch1-1]
          Length = 306

 Score =  103 bits (256), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 33/234 (14%), Positives = 76/234 (32%), Gaps = 11/234 (4%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLA 63
            A +L    Y E ++I++V++R +GR     +  +      + +LQ    + ++W  +  
Sbjct: 77  PAFVLHSYPYRETSLIIDVLSRDHGRLALVAKGAKRPHSALRGVLQTFQPLALSWSGKSE 136

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKI 123
                             L+    L G      L +F    +P  +L+    + +     
Sbjct: 137 VRT---LTAAEWVGGMLPLAGDALLCGFYVNELLVKFCAREDPHPQLFHHYVVTMTRLAH 193

Query: 124 PSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAE-K 182
                ++    E +LL+  G+ + L + V                  V  +     A+  
Sbjct: 194 DEPPVQVLRSFERVLLRETGYAMALDRTVARKAVLAEGRYVFDPERGVREASDDLPAQWP 253

Query: 183 MLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLL-RENFLGK 235
           ++   + L  E+         +  +     L ++ L   +    L  R+  +  
Sbjct: 254 VIAGQTLLDMEQDDYHRAQTVAQSKT----LMRFLLNTYLGGTPLATRQILIDL 303


>gi|329894311|ref|ZP_08270181.1| DNA recombination and repair protein RecO [gamma proteobacterium
           IMCC3088]
 gi|328923107|gb|EGG30430.1| DNA recombination and repair protein RecO [gamma proteobacterium
           IMCC3088]
          Length = 237

 Score =  103 bits (256), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 34/169 (20%), Positives = 58/169 (34%), Gaps = 7/169 (4%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQP----ILQAGNLVRV 56
           M  Q  A +L  R + E + I+++ T + GR    V+  +  R+       LQ    + V
Sbjct: 3   MGIQQPAFLLRKRPFQESSEIVDLFTPERGRVSCVVKGAKRKRLGGSLSQRLQLFRPLVV 62

Query: 57  NWRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNI 116
            ++ R          E+ E +    L    F     +   L R L + E   EL+     
Sbjct: 63  RFQGRGDLKTLLDAEELHEPYT---LFGEGFYAAHYANELLLRVLQQEESYAELFADYAS 119

Query: 117 FLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSP 165
            L   +  S       + E  +L+ +G   DL+            W   
Sbjct: 120 LLEVLEADSSPRAPIRRFEWSILQTLGAEPDLSTDANGEPIDPDKWYHF 168


>gi|47095411|ref|ZP_00233021.1| recombination protein O [Listeria monocytogenes str. 1/2a F6854]
 gi|254898374|ref|ZP_05258298.1| DNA repair protein RecO [Listeria monocytogenes J0161]
 gi|254912134|ref|ZP_05262146.1| recombination protein O [Listeria monocytogenes J2818]
 gi|254936462|ref|ZP_05268159.1| recombination protein O [Listeria monocytogenes F6900]
 gi|47016232|gb|EAL07155.1| recombination protein O [Listeria monocytogenes str. 1/2a F6854]
 gi|258609055|gb|EEW21663.1| recombination protein O [Listeria monocytogenes F6900]
 gi|293590106|gb|EFF98440.1| recombination protein O [Listeria monocytogenes J2818]
          Length = 255

 Score =  103 bits (256), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 34/186 (18%), Positives = 67/186 (36%), Gaps = 1/186 (0%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQN 65
           + I++   SY E + I+ + TR++G+     R  +  + +            +       
Sbjct: 5   EGIVIRQTSYRESDKIVRMYTREFGKIGVVARGAKKTKSRLAAVTQLFTNGYFTFFGGNG 64

Query: 66  LGE-FRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIP 124
           LG   + EV+E+  +      +  Y       L +   ER+P   LY++    L      
Sbjct: 65  LGTLQQGEVIETFSSIQQDIFMTAYATYVCELLDKATEERQPNPYLYELTFQILRDIDEG 124

Query: 125 SVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKML 184
                +    E+ +L  +G    + KC + G T      S  S G +C         +M 
Sbjct: 125 YDPQILTQIYEMKMLPMLGLYPTMDKCAICGETTGHFDFSTSSNGIICHRCFEKDRYRMH 184

Query: 185 VLPSFL 190
           +  + +
Sbjct: 185 LPENVV 190


>gi|299822894|ref|ZP_07054780.1| recombination protein O [Listeria grayi DSM 20601]
 gi|299816423|gb|EFI83661.1| recombination protein O [Listeria grayi DSM 20601]
          Length = 255

 Score =  103 bits (256), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 29/175 (16%), Positives = 63/175 (36%), Gaps = 3/175 (1%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQ--PILQAGNLVRVNWRSRLA 63
           + I++    Y E + I+ + TR++G+     R  +  + +   + Q        + +  +
Sbjct: 5   EGIVIRQTDYRESDKIVVLYTREFGKIGVVARGAKKTKSRLAAVTQPFVNGYFTFFA-SS 63

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKI 123
                 + E++++  +      L  Y       L +   E+     LY+++   L     
Sbjct: 64  GLGTLQQGELIQNFSSIQQDIFLTAYAAYICELLDKATDEKRANPSLYELVFQILRDIDE 123

Query: 124 PSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
                 +    E+ +L  +GF   + KC + G T      S  S G +C      
Sbjct: 124 GYDPEILVQLFEMKMLPVMGFYPVMDKCAICGETTGHFDFSTHSDGIICHRCFEK 178


>gi|71907659|ref|YP_285246.1| DNA repair protein RecO [Dechloromonas aromatica RCB]
 gi|92087026|sp|Q47EF5|RECO_DECAR RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|71847280|gb|AAZ46776.1| DNA replication and repair protein RecO [Dechloromonas aromatica
           RCB]
          Length = 242

 Score =  103 bits (256), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 34/209 (16%), Positives = 67/209 (32%), Gaps = 13/209 (6%)

Query: 1   MYWQDD-----AIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNL 53
           M  +       A +L    + E ++I+EV +R +GR     R  +  R   + +L A   
Sbjct: 1   MNLRSKVDSQPAYVLHSYPFRETSLIVEVFSRDFGRMALLARGARRPRSAIRGLLMAFQP 60

Query: 54  VRVNWRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDM 113
           + + W  +          +        LL+      G      L   LP  +   +L+  
Sbjct: 61  LEIAWAGKGEVLTLM---KAEWQGGLPLLAGEALFCGYYLNELLMHLLPREDAHEQLFAS 117

Query: 114 LNIFLNCHKIPS---VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGA 170
               L          V        E  LL+ +G+GL L       + +   + + +    
Sbjct: 118 YAKMLALLAADPSGKVREADLRCFEKALLQELGYGLTLNHDSDANLIEPDTFYTYRIEQG 177

Query: 171 VCRSVGLPYAEKMLVLPSFLWKEEQTIDA 199
             R      A +++   + L  + +    
Sbjct: 178 PVRIDHGEGATQVVRGKTLLDLDAEDFSD 206


>gi|16800565|ref|NP_470833.1| DNA repair protein RecO [Listeria innocua Clip11262]
 gi|20139533|sp|Q92BQ0|RECO_LISIN RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|16413970|emb|CAC96728.1| lin1497 [Listeria innocua Clip11262]
          Length = 255

 Score =  103 bits (256), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 34/186 (18%), Positives = 68/186 (36%), Gaps = 1/186 (0%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQN 65
           + I++   SY E + I+ + TR++G+     R  +  + +            +       
Sbjct: 5   EGIVIRQTSYRESDKIVRMYTREFGKIGVVARGAKKTKSRLAAVTQLFTNGYFTFFGGNG 64

Query: 66  LGE-FRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIP 124
           LG   + EV+E+  +      +  Y       L +   ER+P   LY++    L      
Sbjct: 65  LGTLQQGEVIENFSSIQQDIFMTAYATYVCELLDKATEERQPNPYLYELTFQILRDIDEG 124

Query: 125 SVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKML 184
                +    E+ +L  +G    + KC + G T      S +S G +C         +M 
Sbjct: 125 YDPQILTQIYEMKMLPVLGLYPTMDKCAICGETTGHFDFSTRSNGIICHRCFDKDRYRMH 184

Query: 185 VLPSFL 190
           +  + +
Sbjct: 185 LPENVV 190


>gi|313618902|gb|EFR90766.1| DNA repair protein RecO [Listeria innocua FSL S4-378]
          Length = 255

 Score =  103 bits (256), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 34/186 (18%), Positives = 68/186 (36%), Gaps = 1/186 (0%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQN 65
           + I++   SY E + I+ + TR++G+     R  +  + +            +       
Sbjct: 5   EGIVIRQTSYRESDKIVRMYTREFGKIGVVARGAKKTKSRLAAVTQLFTNGYFTFFGGNG 64

Query: 66  LGE-FRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIP 124
           LG   + EV+E+  +      +  Y       L +   ER+P   LY++    L      
Sbjct: 65  LGTLQQGEVIENFSSIQQDIFMTAYATYVCELLDKATEERQPNPYLYELTFQILRDIDEG 124

Query: 125 SVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKML 184
                +    E+ +L  +G    + KC + G T      S +S G +C         +M 
Sbjct: 125 YDPQILTQIYEMKMLPVLGLYPTMDKCAICGETTGHFDFSTRSNGIICHRCFDKDRYRMH 184

Query: 185 VLPSFL 190
           +  + +
Sbjct: 185 LPENVV 190


>gi|119361452|sp|Q13VN0|RECO_BURXL RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
          Length = 299

 Score =  103 bits (256), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 33/234 (14%), Positives = 76/234 (32%), Gaps = 11/234 (4%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLA 63
            A +L    Y E ++I++V++R +GR     +  +      + +LQ    + ++W  +  
Sbjct: 70  PAFVLHSYPYRETSLIIDVLSRDHGRLALVAKGAKRPHSALRGVLQTFQPLALSWSGKSE 129

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKI 123
                             L+    L G      L +F    +P  +L+    + +     
Sbjct: 130 VRT---LTGAEWVGGMLPLTGGALLCGFYVNELLVKFCAREDPHPQLFHHYVVTMTRLAH 186

Query: 124 PSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAE-K 182
                ++    E +LL+  G+ + L + V                  V  +     A+  
Sbjct: 187 DEPPVQVLRSFERVLLRETGYAMALDRTVARKAVLAEGRYVFDPERGVREAADDLPAQWP 246

Query: 183 MLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLL-RENFLGK 235
           ++   + L  E+         +  +     L ++ L   +    L  R+  +  
Sbjct: 247 VIAGQTLLDMEQDDYHRAQTVAQSKT----LMRFLLNTYLGGTPLATRQILIDL 296


>gi|91784705|ref|YP_559911.1| DNA repair protein RecO [Burkholderia xenovorans LB400]
 gi|91688659|gb|ABE31859.1| DNA replication and repair protein RecO [Burkholderia xenovorans
           LB400]
          Length = 306

 Score =  103 bits (256), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 33/234 (14%), Positives = 76/234 (32%), Gaps = 11/234 (4%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLA 63
            A +L    Y E ++I++V++R +GR     +  +      + +LQ    + ++W  +  
Sbjct: 77  PAFVLHSYPYRETSLIIDVLSRDHGRLALVAKGAKRPHSALRGVLQTFQPLALSWSGKSE 136

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKI 123
                             L+    L G      L +F    +P  +L+    + +     
Sbjct: 137 VRT---LTGAEWVGGMLPLTGGALLCGFYVNELLVKFCAREDPHPQLFHHYVVTMTRLAH 193

Query: 124 PSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAE-K 182
                ++    E +LL+  G+ + L + V                  V  +     A+  
Sbjct: 194 DEPPVQVLRSFERVLLRETGYAMALDRTVARKAVLAEGRYVFDPERGVREAADDLPAQWP 253

Query: 183 MLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLL-RENFLGK 235
           ++   + L  E+         +  +     L ++ L   +    L  R+  +  
Sbjct: 254 VIAGQTLLDMEQDDYHRAQTVAQSKT----LMRFLLNTYLGGTPLATRQILIDL 303


>gi|238026619|ref|YP_002910850.1| DNA repair protein RecO [Burkholderia glumae BGR1]
 gi|237875813|gb|ACR28146.1| DNA repair protein RecO [Burkholderia glumae BGR1]
          Length = 281

 Score =  103 bits (256), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 34/234 (14%), Positives = 70/234 (29%), Gaps = 11/234 (4%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLA 63
              +L    Y E ++I++V+TR +GR     +  +      + +LQ    + ++W  +  
Sbjct: 52  PGFVLHSHPYRETSLIIDVLTRDHGRVALVAKGAKRPHSALRGVLQTFQPLALSWSGKSE 111

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKI 123
                             L     L G      L +F    +P   L+    + L     
Sbjct: 112 ---MRTLTGAEWVGGMLPLGGDALLCGFYVNELLVKFCAREDPFPALFQHYLVTLARLAH 168

Query: 124 PSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAE-- 181
                ++    E +LL+  G+   L + V                  V  +     +   
Sbjct: 169 DEPAVQVLRSFERVLLRETGYARALNRTVARRAVTADGRYVFDPERGVREAGDDTPSHWP 228

Query: 182 KMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGK 235
            +        +E+    A ++  +  L  + LN Y            R+  +  
Sbjct: 229 IVSGQTLLDMEEDDYHRAQTVAQSKTLMRFLLNTYL----GGTPLATRQILIDL 278


>gi|194290150|ref|YP_002006057.1| DNA repair protein reco [Cupriavidus taiwanensis LMG 19424]
 gi|193223985|emb|CAQ69994.1| DNA repair protein [Cupriavidus taiwanensis LMG 19424]
          Length = 295

 Score =  103 bits (256), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 31/148 (20%), Positives = 49/148 (33%), Gaps = 5/148 (3%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLA 63
              +L    Y E ++IL+V TR YGR     +  +      + +LQ  + V V+W  R  
Sbjct: 65  PGFVLHAWPYRETSLILDVFTRDYGRLSMVAKGAKRPHSALRAVLQHFHPVSVSWSGRGE 124

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKI 123
                     +             L        L RF P  +    L+      L     
Sbjct: 125 VKTLTKAE-WVGGMPPLAGD--ALLSAFYLNELLMRFCPREDAHPVLFRHYLSTLTRLAH 181

Query: 124 PSVIGKIFVQIELMLLKNIGFGLDLTKC 151
               G +    E +LL+  GF +   +C
Sbjct: 182 GEPAGLVLRSFERVLLQETGFAVAFDQC 209


>gi|39995684|ref|NP_951635.1| DNA repair protein RecO [Geobacter sulfurreducens PCA]
 gi|61215122|sp|Q74FM9|RECO_GEOSL RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|39982447|gb|AAR33908.1| DNA repair protein RecO [Geobacter sulfurreducens PCA]
 gi|298504695|gb|ADI83418.1| DNA repair protein RecO [Geobacter sulfurreducens KN400]
          Length = 243

 Score =  102 bits (255), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 29/156 (18%), Positives = 56/156 (35%), Gaps = 3/156 (1%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQS--HRMQPILQAGNLVRVNWRS 60
            + +A++L    Y E + I+ + T  +G+  G  R  +    R    L+    + V    
Sbjct: 4   IRCEAVVLATMDYRESDRIVTLFTLCHGKVRGLARGARKSMRRFGGALEPFARLSVELVV 63

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           R          +++  +       +   +G  ++  + R LP+      L+ +L  +L  
Sbjct: 64  R-EGLSSLRGVDIVTVYPRIRQDLAAIGHGGYAVELVDRLLPDGASVPRLFRLLVSYLEH 122

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGV 156
                         E  LL  +G+ L L  C   GV
Sbjct: 123 LDQGGASPSDRRFFEANLLNILGYRLSLDACAACGV 158


>gi|46907688|ref|YP_014077.1| DNA repair protein RecO [Listeria monocytogenes serotype 4b str.
           F2365]
 gi|47093467|ref|ZP_00231230.1| recombination protein O [Listeria monocytogenes str. 4b H7858]
 gi|226224061|ref|YP_002758168.1| RecO protein [Listeria monocytogenes Clip81459]
 gi|254824481|ref|ZP_05229482.1| recombination protein O [Listeria monocytogenes FSL J1-194]
 gi|254852085|ref|ZP_05241433.1| recombination protein O [Listeria monocytogenes FSL R2-503]
 gi|254932645|ref|ZP_05266004.1| recombination protein O [Listeria monocytogenes HPB2262]
 gi|255521275|ref|ZP_05388512.1| DNA repair protein RecO [Listeria monocytogenes FSL J1-175]
 gi|300765603|ref|ZP_07075582.1| recombination protein O [Listeria monocytogenes FSL N1-017]
 gi|61215088|sp|Q71ZL0|RECO_LISMF RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|259563681|sp|C1KVA7|RECO_LISMC RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|46880957|gb|AAT04254.1| recombination protein O [Listeria monocytogenes serotype 4b str.
           F2365]
 gi|47018143|gb|EAL08913.1| recombination protein O [Listeria monocytogenes str. 4b H7858]
 gi|225876523|emb|CAS05232.1| Putative RecO protein [Listeria monocytogenes serotype 4b str. CLIP
           80459]
 gi|258605384|gb|EEW17992.1| recombination protein O [Listeria monocytogenes FSL R2-503]
 gi|293584204|gb|EFF96236.1| recombination protein O [Listeria monocytogenes HPB2262]
 gi|293593719|gb|EFG01480.1| recombination protein O [Listeria monocytogenes FSL J1-194]
 gi|300513704|gb|EFK40772.1| recombination protein O [Listeria monocytogenes FSL N1-017]
 gi|328465503|gb|EGF36732.1| DNA repair protein RecO [Listeria monocytogenes 1816]
 gi|332311901|gb|EGJ24996.1| DNA repair protein RecO [Listeria monocytogenes str. Scott A]
          Length = 255

 Score =  102 bits (255), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 34/186 (18%), Positives = 68/186 (36%), Gaps = 1/186 (0%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQN 65
           + I++   SY E + I+ + TR++G+     R  +  + +            +    +  
Sbjct: 5   EGIVIRQTSYRESDKIVRMYTREFGKIGVVARGAKKTKSRLAAVTQLFTNGYFTFFGSNG 64

Query: 66  LGE-FRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIP 124
           LG   + EV+E+  +      +  Y       L +   ER+P   LY++    L      
Sbjct: 65  LGTLQQGEVIENFSSIQQDIFMTAYATYVCELLDKATEERQPNPYLYELTFQILRDINEG 124

Query: 125 SVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKML 184
                +    E+ +L  +G    + KC + G T      S  S G +C         +M 
Sbjct: 125 YDPQILTQIFEMKMLPVLGLYPTMDKCAICGETTGHFDFSTSSNGIICHRCFEKDRYRMH 184

Query: 185 VLPSFL 190
           +  + +
Sbjct: 185 LPENVV 190


>gi|224825226|ref|ZP_03698332.1| DNA repair protein RecO [Lutiella nitroferrum 2002]
 gi|224602897|gb|EEG09074.1| DNA repair protein RecO [Lutiella nitroferrum 2002]
          Length = 242

 Score =  102 bits (255), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 35/215 (16%), Positives = 73/215 (33%), Gaps = 8/215 (3%)

Query: 4   QDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSR 61
           +  A +L  + Y E +++L+V+TR++GR     R  +  R   + +L     + + W  +
Sbjct: 8   RQPAYVLHAQPYRETSLLLDVLTREHGRIALVARGARRPRSDLRGVLLPFQPLLLAWFGK 67

Query: 62  LAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCH 121
                               LS    + G      L +     +P  E + +    +   
Sbjct: 68  SEVRTLH---TADWQGGVPQLSGLPLVCGFYLNELLIKLTARDDPHPETFGVYAEAVRGL 124

Query: 122 KIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAE 181
               ++  +  + EL L++ +G+             +  +        A+ R  G P   
Sbjct: 125 ASGGLLSSVLRRFELGLVRTLGYAPAFDVDSNGREVEPDVPYLCGPEQALQRWQGGPVPA 184

Query: 182 KMLVLPSFLWKEEQTIDADSL---KSAFQLTDYFL 213
           +  V+   +       D   L   + A +L   FL
Sbjct: 185 QQQVIEGRILLAMAGGDFSELATRREARRLMRLFL 219


>gi|94311352|ref|YP_584562.1| DNA repair protein RecO [Cupriavidus metallidurans CH34]
 gi|119361474|sp|Q1LKN3|RECO_RALME RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|93355204|gb|ABF09293.1| DNA repair protein recO (Recombination protein O) [Cupriavidus
           metallidurans CH34]
          Length = 298

 Score =  102 bits (255), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 43/233 (18%), Positives = 75/233 (32%), Gaps = 10/233 (4%)

Query: 7   AIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLAQ 64
             +L    Y E +++L+V TR +GR     +  +      + +LQ  + + ++W  R   
Sbjct: 69  GFVLHAHPYRETSLVLDVFTRDHGRVAMVAKGAKRPHSALRAVLQHFHPIALSWTGRGEV 128

Query: 65  NLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIP 124
                            LS    L G      L RF P  +    L+      L      
Sbjct: 129 KTLTKAEY---VGGMLPLSGDALLSGFYLNELLLRFCPREDAHPTLFRHYMATLTRLSHG 185

Query: 125 SVIGKIFVQIELMLLKNIGFGLDLTKCVVTG--VTQDLLWVSPKSGGAVCRSVGLPYAEK 182
                +    E +LL+  GF +   +C+ +G  V   L +V     G        P +  
Sbjct: 186 EPASFVLRSFERVLLQETGFAVAFDQCLRSGERVQPGLDYVYQPERGVRRTHASDPSSWP 245

Query: 183 MLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGK 235
           ++   + L   +         S  +    FL  Y LQ         R+  +  
Sbjct: 246 VVSGQTLLDMAQDDYSRAQTVSQSRALMRFLLHYYLQ---GAPLKTRQILIDL 295


>gi|15613932|ref|NP_242235.1| DNA repair protein RecO [Bacillus halodurans C-125]
 gi|20139774|sp|Q9KD50|RECO_BACHD RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|10173985|dbj|BAB05088.1| BH1369 [Bacillus halodurans C-125]
          Length = 254

 Score =  102 bits (255), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 30/186 (16%), Positives = 66/186 (35%), Gaps = 3/186 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQ--PILQAGNLVRVNW 58
           M+ + + I++    YGE N I+ V TR+YG+     R  +  + +   + Q      + +
Sbjct: 1   MFHKAEGIVIRTVDYGESNKIVTVFTREYGKIALMARGAKRPKSRLTAVTQLFTYGMMMF 60

Query: 59  RSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFL 118
           + + A      + E+++S            Y         +   + +    L+++L   +
Sbjct: 61  Q-KNAGLGTLTQGEIIQSFREVRNDLFRASYVSYVTDLTNKLTEDEKRNPYLFELLYQTI 119

Query: 119 NCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
           +          +    E+ +    G   +L +CV    T   +  S K  G +C+     
Sbjct: 120 HYMNEGMDPDVLTRIFEVKMFTVAGIKPELDQCVSCRSTDVPVGFSIKEAGFLCKRCIEK 179

Query: 179 YAEKML 184
                 
Sbjct: 180 DPHAYK 185


>gi|304310581|ref|YP_003810179.1| Recombinational DNA repair protein (RecF pathway) [gamma
           proteobacterium HdN1]
 gi|301796314|emb|CBL44522.1| Recombinational DNA repair protein (RecF pathway) [gamma
           proteobacterium HdN1]
          Length = 241

 Score =  102 bits (254), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 47/235 (20%), Positives = 72/235 (30%), Gaps = 12/235 (5%)

Query: 7   AIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQS--HRMQPILQAGNLVRVNWRSRLAQ 64
           A +L  + + E + + EV  R+ GR     R  +   H    +LQ    V V++  R   
Sbjct: 10  AYVLQAKPWQETSALAEVFCRESGRVSIAFRGVRRGGHSKSSLLQPFQPVWVSYGGRHEL 69

Query: 65  NLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIP 124
             G           +  LS +  + G      L R L   +    L+D     L      
Sbjct: 70  RSGRQLESRA---ASVWLSGNALISGFYLNELLVRLLQREDAHPRLFDAYEESLALL-YA 125

Query: 125 SVIGKIFVQIELMLLKNIGFGLDLTKCVVTGV-TQDLLWVSPKSGGAVCRSVGLPYAEKM 183
             I       E  LL  IG+ +            +   +      G V RS   P AE  
Sbjct: 126 GAIEPCLRIFERKLLAEIGYEIRFDHDANGEALVEGGWYCYRHEEGFVRRSGNEPRAEPC 185

Query: 184 LVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHL-LRENFLGKLL 237
                 +    +  D   +      T   L + AL  ++    L  R  F   L 
Sbjct: 186 FSGGLLMAVGREEYDLLDVLR----TAKQLFRTALAPHLGSKPLVSRSLFRPSLK 236


>gi|156975790|ref|YP_001446697.1| recombinational DNA repair protein [Vibrio harveyi ATCC BAA-1116]
 gi|156527384|gb|ABU72470.1| hypothetical protein VIBHAR_03534 [Vibrio harveyi ATCC BAA-1116]
          Length = 219

 Score =  102 bits (254), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 39/217 (17%), Positives = 70/217 (32%), Gaps = 11/217 (5%)

Query: 20  IILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLAQNLGEFRFEVLESH 77
           +IL+V + +YGR     +  +S R   +  LQ    + + W  + +    +   +     
Sbjct: 1   MILDVFSEEYGRITLMAKGARSKRSNLKGALQPFTPLLLKWSGKGS---MKTLRQAEPIS 57

Query: 78  CAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPSVIGKIFVQIELM 137
               L        +     + R L    P   L+      L              + EL 
Sbjct: 58  LGLPLFGINLYSAMYVNELVGRVLMAEVPMPALFHDYLHALTELAQSDNPEPGLRRFELA 117

Query: 138 LLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKMLVLPSFLWKEEQTI 197
           LL ++G+G+D   C  TG   D              +         L        E + +
Sbjct: 118 LLSSMGYGVDFLHCAGTGEPVDPEMTYRYREQKGFIASVRRDNLTFLGNELIAISERRFV 177

Query: 198 DADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENFL 233
             + LK+A + T     + AL+  +       RE F+
Sbjct: 178 TKEQLKAAKRFT-----RMALKPYLGGKPLKSRELFI 209


>gi|229086867|ref|ZP_04219027.1| DNA repair protein recO [Bacillus cereus Rock3-44]
 gi|228696442|gb|EEL49267.1| DNA repair protein recO [Bacillus cereus Rock3-44]
          Length = 252

 Score =  102 bits (254), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 27/179 (15%), Positives = 66/179 (36%), Gaps = 1/179 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M+ + + II+    YGE N I+ + +R++G+     R  +  + +    +  +   ++  
Sbjct: 5   MFQKVEGIIIRTTDYGETNKIVTIFSREFGKVSAMARGAKKPKSRLASISQLMTHGHFLI 64

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSI-VPLFRFLPEREPCLELYDMLNIFLN 119
           ++   LG  +   + S   ++            I     +   +++    L++ML   L+
Sbjct: 65  QMGSGLGTLQQGEIISSMKEIREDIFLTAYASFIVELTDKATEDKKHNPYLFEMLYQTLH 124

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
                     + +  +  +L  +G       C +     D +  S + GG +C      
Sbjct: 125 YMCEGVDPEVLSLIYQTKMLPVLGMHPYFDTCAICHHEADFVAFSVREGGFLCSHHAEQ 183


>gi|254481220|ref|ZP_05094465.1| DNA repair protein RecO [marine gamma proteobacterium HTCC2148]
 gi|214038383|gb|EEB79045.1| DNA repair protein RecO [marine gamma proteobacterium HTCC2148]
          Length = 243

 Score =  102 bits (254), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 41/232 (17%), Positives = 74/232 (31%), Gaps = 15/232 (6%)

Query: 8   IILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQP----ILQAGNLVRVNWRSRLA 63
            IL  R Y + ++ILEV   ++GR     +  +          +LQ    + +++  R  
Sbjct: 9   YILHSRPYRDSSLILEVFCAEHGRLSLVSKGARRRSKGGSSVALLQPFIPLLLSFSGRSE 68

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKI 123
               +    V  +  A  L       G+     L R L   +P  +L+      L     
Sbjct: 69  ---MKTLTHVEPAGVAPQLRGERLFSGMYINELLMRLLHRHDPHPQLFANYGTALGELGD 125

Query: 124 PSVIGKIFVQIELMLLKNIGFGLDL--TKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAE 181
              +     + EL LL  +G+G  L         +++D  +      G V    G   A 
Sbjct: 126 AEEVEVCLRRFELGLLDELGYGFSLAEDGLSGEAISEDGWYHFSPDCGLVAGVKGANPAR 185

Query: 182 KMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENF 232
                   L   +     ++   A +     L +  L   +       R+ F
Sbjct: 186 PAYSGAELLLLSQGKYGGEARSVARR-----LMREVLAQYLGSEPLKSRDLF 232


>gi|299535812|ref|ZP_07049133.1| DNA repair protein RecO [Lysinibacillus fusiformis ZC1]
 gi|298729012|gb|EFI69566.1| DNA repair protein RecO [Lysinibacillus fusiformis ZC1]
          Length = 261

 Score =  102 bits (253), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 46/222 (20%), Positives = 78/222 (35%), Gaps = 5/222 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M  + + I+L VR+YGE N I+ ++TR+ G+     R  +    +            +  
Sbjct: 1   MLHKWEGIVLKVRAYGESNKIVILLTREAGKVATMARGAKKPSSRLASITQPFTYGMFMV 60

Query: 61  RLAQNLGE-FRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLN 119
           +    +G   + E L S            Y    +  + R + E +P    +D+L   L 
Sbjct: 61  QHHTGMGTLQQGEHLNSMRHIREDIMATAYASYIMELVERVVEEGKPEPFAFDVLLHALQ 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGL-- 177
             +       I + +E  +L   G    L  C   G        S   GG +C       
Sbjct: 121 AIEDGYDPEAITLFVEWKMLPYTGVQPILHACAACGAVDGEFAFSFAQGGFLCHRCYQHD 180

Query: 178 PYAEKMLVLPSFLWKEEQTIDADSLKSA--FQLTDYFLNKYA 217
           PY  ++      L +   TI  D +      + T YF+ K  
Sbjct: 181 PYIIRLTPTQLKLIRMFYTIPIDQIGKIELKKETKYFIKKII 222


>gi|327440929|dbj|BAK17294.1| recombinational DNA repair protein [Solibacillus silvestris
           StLB046]
          Length = 257

 Score =  102 bits (253), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 46/247 (18%), Positives = 83/247 (33%), Gaps = 11/247 (4%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNW-R 59
           M  + + I+L  R+YGE N I+ +MTR+ G+     R  +    +        +  ++  
Sbjct: 1   MLHKWEGIVLKARAYGESNKIVTLMTREAGKVACMARGAKKPTSRLAGVTQTFMHGSFLV 60

Query: 60  SRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLN 119
            R +      + E   S            Y    +  + R + E  P    +D+L   LN
Sbjct: 61  QRTSGMGTLQQGEHFNSMRHIQTDIVATAYASYIVEIVDRLVEEGRPEPYAFDILIQALN 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVG--L 177
             +       I + ++  +L   G    L  C   G        S   GG +C       
Sbjct: 121 AIEEGYDPEAITLFVDWKMLPFAGIQPILHACAGCGAVDGEFAFSFTQGGFICHRCFHLD 180

Query: 178 PYAEKMLVLPSFLWKEEQTIDADSLKSAFQL---TDYFLNK---YALQHNIIHCHLLREN 231
           PY  ++      L +   T+  + +    +L   T  F+ K      +         R  
Sbjct: 181 PYIIRLSPTQLKLIRMFYTVPIEQVGK-LELKPQTKQFIKKIVTTIYEEQTGIRLKSRN- 238

Query: 232 FLGKLLE 238
           F+ +L  
Sbjct: 239 FIEQLER 245


>gi|315282356|ref|ZP_07870784.1| DNA repair protein RecO [Listeria marthii FSL S4-120]
 gi|313613998|gb|EFR87714.1| DNA repair protein RecO [Listeria marthii FSL S4-120]
          Length = 255

 Score =  102 bits (253), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 34/186 (18%), Positives = 68/186 (36%), Gaps = 1/186 (0%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQN 65
           + I++   SY E + I+ + TR++G+     R  +  + +            +       
Sbjct: 5   EGIVIRQTSYRESDKIVRMYTREFGKIGVVARGAKKTKSRLAAVTQLFTNGYFTFFGGNG 64

Query: 66  LGE-FRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIP 124
           LG   + EV+E+  +      +  Y       L +   ER+P   LY++    L      
Sbjct: 65  LGTLQQGEVIENFSSIQQDIFMTAYATYVCELLDKATEERQPNPYLYELTFQILRDIDEG 124

Query: 125 SVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKML 184
                +    E+ +L  +G    + KC + G T      S +S G +C         +M 
Sbjct: 125 YDPQILTQIYEMKMLPVLGLYPTMDKCAICGETTGHFDFSTRSNGIICHRCFDRDRYRMH 184

Query: 185 VLPSFL 190
           +  + +
Sbjct: 185 LPENVV 190


>gi|229019522|ref|ZP_04176339.1| DNA repair protein recO [Bacillus cereus AH1273]
 gi|229025764|ref|ZP_04182163.1| DNA repair protein recO [Bacillus cereus AH1272]
 gi|228735472|gb|EEL86068.1| DNA repair protein recO [Bacillus cereus AH1272]
 gi|228741778|gb|EEL91961.1| DNA repair protein recO [Bacillus cereus AH1273]
          Length = 252

 Score =  102 bits (253), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 27/179 (15%), Positives = 67/179 (37%), Gaps = 1/179 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M+ + + I++    YGE N I+ + +R++G+     R  +  + +    +  +   ++  
Sbjct: 5   MFQKVEGIVIRTTDYGETNKIVTIFSREFGKVSAMARGAKKPKSRLAAVSQLMTHGHFLI 64

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFL-YGLQSIVPLFRFLPEREPCLELYDMLNIFLN 119
           ++   LG  +   + S   ++        Y    I    +   +++    L++ML   L+
Sbjct: 65  QIGSGLGTLQQGEIISSMKEIREDIFLTAYASFIIELTDKATEDKKNNPYLFEMLYQTLH 124

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
                     + +  +  +L  +G       C +     D +  S + GG +C      
Sbjct: 125 YMCEGVDPEVLSLIYQTKMLPVLGMRPYFDTCAICHQETDFVAFSVREGGFLCSRHAEQ 183


>gi|228993040|ref|ZP_04152963.1| DNA repair protein recO [Bacillus pseudomycoides DSM 12442]
 gi|228999090|ref|ZP_04158672.1| DNA repair protein recO [Bacillus mycoides Rock3-17]
 gi|229006638|ref|ZP_04164272.1| DNA repair protein recO [Bacillus mycoides Rock1-4]
 gi|228754499|gb|EEM03910.1| DNA repair protein recO [Bacillus mycoides Rock1-4]
 gi|228760707|gb|EEM09671.1| DNA repair protein recO [Bacillus mycoides Rock3-17]
 gi|228766688|gb|EEM15328.1| DNA repair protein recO [Bacillus pseudomycoides DSM 12442]
          Length = 252

 Score =  102 bits (253), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 26/179 (14%), Positives = 67/179 (37%), Gaps = 1/179 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M+ + + I++    YGE N I+ + +R+ G+     R  +  + +    +  ++  ++  
Sbjct: 5   MFQKVEGIVIRTTDYGETNKIVTIFSRELGKVSAMARGAKKPKSRLASISQLMMHGHFLI 64

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSI-VPLFRFLPEREPCLELYDMLNIFLN 119
           ++   LG  +   + S   ++            I     +   +++    L++ML+  L+
Sbjct: 65  QMGSGLGTLQQGEIISSMKEIREDIFLTAYASFIVELTDKATEDKKHNPYLFEMLHQTLH 124

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
                     + +  +  +L  +G       C +     D +  S + GG +C      
Sbjct: 125 YMCEGVDAEVLSLIYQTKMLPVLGMHPYFDTCAICHQEADFVAFSVREGGFLCSRHAQQ 183


>gi|149183347|ref|ZP_01861785.1| DNA repair protein RecO [Bacillus sp. SG-1]
 gi|148848944|gb|EDL63156.1| DNA repair protein RecO [Bacillus sp. SG-1]
          Length = 250

 Score =  101 bits (252), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 36/189 (19%), Positives = 68/189 (35%), Gaps = 3/189 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQS--HRMQPILQAGNLVRVNW 58
           M  + + I++   +YGE N I+ + +R+ G+     R  +    R+  + Q        +
Sbjct: 1   MLQKCEGIVIRTNNYGESNKIVTIYSRENGKLGVMARGAKKTNSRLSSVSQLFTYGYFLY 60

Query: 59  RSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFL 118
           + + +      + + + S            Y    +  + +   ER+P   L++ML   L
Sbjct: 61  Q-KSSGLGTLQQADTIASMRNIREDLFKTAYATYVVDLIDKGTEERKPNPFLFEMLFQTL 119

Query: 119 NCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
                      +    E+ +L  +G    L KC V G T+     S K  G +C      
Sbjct: 120 TYINEEYDPDIVTHIFEMKMLPVLGLHPSLDKCAVCGETEGEFSFSFKENGIICHRCIGN 179

Query: 179 YAEKMLVLP 187
                 V P
Sbjct: 180 DPYHYKVSP 188


>gi|187924873|ref|YP_001896515.1| DNA repair protein RecO [Burkholderia phytofirmans PsJN]
 gi|187716067|gb|ACD17291.1| DNA repair protein RecO [Burkholderia phytofirmans PsJN]
          Length = 309

 Score =  101 bits (252), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 33/234 (14%), Positives = 75/234 (32%), Gaps = 11/234 (4%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLA 63
            A +L    Y E ++I++V++R +GR     +  +      + +LQ    + ++W  +  
Sbjct: 80  PAFVLHSYPYRETSLIIDVLSRDHGRLALVAKGAKRPHSALRGVLQTFQPLALSWSGKSE 139

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKI 123
                             L+    L G      L +F    +P  +L+    + +     
Sbjct: 140 VRT---LTGAEWVGGMLPLAGDALLCGFYVNELLVKFCAREDPHPQLFHHYVVTMTRLAH 196

Query: 124 PSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAE-K 182
                ++    E +LL+  G+ + L + V                  V  +     A   
Sbjct: 197 DEPPVQVLRSFERVLLRETGYAMALDRTVARKAVLADGRYVFDPERGVREASDDLPALWP 256

Query: 183 MLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLL-RENFLGK 235
           ++   + L  E+         +  +     L ++ L   +    L  R+  +  
Sbjct: 257 VIAGQTLLDMEQDDYHRAQTVAQSKT----LMRFLLNTYLGGTPLATRQILIDL 306


>gi|198283251|ref|YP_002219572.1| DNA repair protein RecO [Acidithiobacillus ferrooxidans ATCC 53993]
 gi|218665687|ref|YP_002425834.1| DNA repair protein RecO, putative [Acidithiobacillus ferrooxidans
           ATCC 23270]
 gi|254790501|sp|B7J9K3|RECO_ACIF2 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|254790502|sp|B5EQL5|RECO_ACIF5 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|198247772|gb|ACH83365.1| DNA repair protein RecO [Acidithiobacillus ferrooxidans ATCC 53993]
 gi|218517900|gb|ACK78486.1| DNA repair protein RecO, putative [Acidithiobacillus ferrooxidans
           ATCC 23270]
          Length = 255

 Score =  101 bits (252), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 49/240 (20%), Positives = 82/240 (34%), Gaps = 12/240 (5%)

Query: 5   DDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRN-GQSHRMQPILQAGNLVRVNWRSRLA 63
           D A +L    YG+ ++I+E+ TR  GR     +   ++      ++AG  + V W  R  
Sbjct: 7   DRAWVLHHYPYGDTSLIVELFTRTQGRLGVLAKGARRARSALARIEAGRPLWVRWLGRGE 66

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKI 123
             +     +  E      L+    L        L R    R+P  +L+ +    ++    
Sbjct: 67  LPV---LAQAEELGPFLPLNPLQNLSLFYVNELLLRLTQRRDPFPDLFQVYEETIDALCS 123

Query: 124 PSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQD----LLWVSPKSGGAVCRSVGLPY 179
               G    + E  LL+N+G+  DL  C   G + D      W+   + G  CR+     
Sbjct: 124 EPGEGWYLRRFERRLLENLGWAPDLAHCAECGRSPDAASSEHWLYQAAHGVFCRAHAPDA 183

Query: 180 AEKMLVLPSF-LWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLE 238
           A  +       L    QT       S+ +     L +  L H        R      L  
Sbjct: 184 AVAIEAAALVWLRGAMQTRSMPVWNSSLRRC---LEQELLVHLGGRPLESRRLLTAYLRR 240


>gi|317128321|ref|YP_004094603.1| DNA repair protein RecO [Bacillus cellulosilyticus DSM 2522]
 gi|315473269|gb|ADU29872.1| DNA repair protein RecO [Bacillus cellulosilyticus DSM 2522]
          Length = 249

 Score =  101 bits (252), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 33/185 (17%), Positives = 66/185 (35%), Gaps = 1/185 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M  + + +++    YGE N I+ + TR+ G+     R  +  + +    A   V   +  
Sbjct: 1   MLQKVEGLVIRTNDYGETNKIVTIFTRENGKIALMARGAKRPKSRFASSAQIFVYGIFIY 60

Query: 61  RLAQNLGE-FRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLN 119
           + +  +G   + +V++S         L  +G   +  + R   +RE    L+++L     
Sbjct: 61  QSSTGIGTLSQSDVIDSFRDVRSDLKLTAHGAYIVELIDRLTEDRERNPFLFELLYQTFQ 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                     +    E  +L   G    LT+C   G   +    S K  G +C       
Sbjct: 121 FLNEGLDPEILTRIFETKMLHVAGVTPVLTQCTSCGSESEFYVFSMKQAGLLCGRCQYED 180

Query: 180 AEKML 184
              + 
Sbjct: 181 PNHIK 185


>gi|313623741|gb|EFR93883.1| DNA repair protein RecO [Listeria innocua FSL J1-023]
          Length = 255

 Score =  101 bits (252), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 34/186 (18%), Positives = 67/186 (36%), Gaps = 1/186 (0%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQN 65
           + I++   SY E + I+ + TR++G+     R  +  + +            +       
Sbjct: 5   EGIVIRQTSYRESDKIVRMYTREFGKIGVVARGAKKTKSRLAAVTQLFTNGYFTFFGGNG 64

Query: 66  LGE-FRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIP 124
           LG   + EV+E+         +  Y       L +   ER+P   LY++    L      
Sbjct: 65  LGTLQQGEVIENFSFIQQDIFMTAYATYVCELLDKATEERQPNPYLYELTFQILRDIDEG 124

Query: 125 SVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKML 184
                +    E+ +L  +G    + KC + G T      S +S G +C         +M 
Sbjct: 125 YDPQILTQIYEMKMLPVLGLYPTMDKCAICGETTGHFDFSTRSNGIICHRCFDKDRYRMH 184

Query: 185 VLPSFL 190
           +  + +
Sbjct: 185 LPENVV 190


>gi|229098769|ref|ZP_04229707.1| DNA repair protein recO [Bacillus cereus Rock3-29]
 gi|229104929|ref|ZP_04235586.1| DNA repair protein recO [Bacillus cereus Rock3-28]
 gi|229117794|ref|ZP_04247159.1| DNA repair protein recO [Bacillus cereus Rock1-3]
 gi|228665657|gb|EEL21134.1| DNA repair protein recO [Bacillus cereus Rock1-3]
 gi|228678503|gb|EEL32723.1| DNA repair protein recO [Bacillus cereus Rock3-28]
 gi|228684613|gb|EEL38553.1| DNA repair protein recO [Bacillus cereus Rock3-29]
          Length = 252

 Score =  101 bits (252), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 26/179 (14%), Positives = 67/179 (37%), Gaps = 1/179 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M+ + + I++    YGE N I+ + +R++G+     R  +  + +    +  +   ++  
Sbjct: 5   MFQKVEGIVIRTTDYGETNKIVTIFSREFGKISAMARGAKKPKSRLASVSQLMTHGHFLI 64

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFL-YGLQSIVPLFRFLPEREPCLELYDMLNIFLN 119
           ++   LG  +   + S   ++        Y    +    +   +++    L++ML   L+
Sbjct: 65  QVGSGLGTLQQGEIISTMKEIREDIFLTAYASFVVELTDKATEDKKHNPYLFEMLYQTLH 124

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
                     + +  +  +L  +G       C +     D +  S + GG +C      
Sbjct: 125 YMCEGVDPEVLSLIYQTKMLPVLGMRPYFDTCAICHQETDFVAFSVREGGFLCSRHAEQ 183


>gi|146306509|ref|YP_001186974.1| DNA repair protein RecO [Pseudomonas mendocina ymp]
 gi|145574710|gb|ABP84242.1| DNA replication and repair protein RecO [Pseudomonas mendocina ymp]
          Length = 229

 Score =  101 bits (252), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 42/233 (18%), Positives = 75/233 (32%), Gaps = 13/233 (5%)

Query: 7   AIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQNL 66
           A +L  R Y E + +++  T   GR    +R  +  ++  I +    + +  R R     
Sbjct: 5   AYVLHSRPYKESSALVDFFTV-QGRVRAVLRAARG-KVGSIARPFAPLELELRGRGELKT 62

Query: 67  GEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPSV 126
                 +  +    LLS      GL     L R LP  +P   + +   + L        
Sbjct: 63  ---VGRLESAGIPLLLSGEALFSGLYLNELLIRLLPAEDPHPVMLEHYGLTLQALAADRP 119

Query: 127 IGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKMLVL 186
           +  +    E  LL  +G+G  L +               +    +   + L         
Sbjct: 120 LEPLLRAFEWRLLDELGYGFALDRDQHDQPIDPTALYRWQHDIGLVPVIQLQ-PGVFQGR 178

Query: 187 PSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHL-LRENFLGKLLE 238
                 E       +L +A +     L + AL  ++    L  RE F+  L E
Sbjct: 179 ELLAMAEADWQTPGALAAAKR-----LMRQALAPHLGGRPLVSRELFM-TLKE 225


>gi|256821982|ref|YP_003145945.1| DNA repair protein RecO [Kangiella koreensis DSM 16069]
 gi|256795521|gb|ACV26177.1| DNA repair protein RecO [Kangiella koreensis DSM 16069]
          Length = 239

 Score =  101 bits (252), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 30/178 (16%), Positives = 65/178 (36%), Gaps = 6/178 (3%)

Query: 7   AIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM---QPILQAGNLVRVNWRSRLA 63
           A +L  R + E ++I+E+ T + GR     +  + +R    + +LQ    ++V+W  R  
Sbjct: 9   AFVLHTRPFKETSLIVELFTEESGRVNVLAKGVRGNRKNSNRALLQPFQPIKVSWFGRSE 68

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKI 123
               +          +  L+    L  L     L R   + +P  +++      L   ++
Sbjct: 69  LKTLKQVEAD---GFSHRLNGIASLSALYLNELLLRLFIQWDPHPDIFHFYQTSLQHLQL 125

Query: 124 PSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAE 181
                 I  + EL LL  +G+ +D    +     ++ +     +       +  P   
Sbjct: 126 GDKPNLILREFELELLDVLGYAIDWQHDIYGDAIEENMTYGFIAEQGFIPQLQAPSET 183


>gi|291613751|ref|YP_003523908.1| DNA repair protein RecO [Sideroxydans lithotrophicus ES-1]
 gi|291583863|gb|ADE11521.1| DNA repair protein RecO [Sideroxydans lithotrophicus ES-1]
          Length = 243

 Score =  101 bits (251), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 37/221 (16%), Positives = 70/221 (31%), Gaps = 8/221 (3%)

Query: 2   YWQDD-AIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNW 58
             QD+ A +L    + E ++ILEV +R++GR     R  +  R   + +L     ++++W
Sbjct: 9   RIQDEPAFVLHSYPFRETSLILEVFSRRHGRVALVARGARRPRSALRGLLMGFQPLQMSW 68

Query: 59  RSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFL 118
             +                    L  +  L G      L   +   +P   L+D     L
Sbjct: 69  FGKHELRTLH---SAEWQGGQPQLQGTALLCGFYLNELLLNLMARDDPHESLFDYYLQTL 125

Query: 119 NCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGV-TQDLLWVSPKSGGAVCRSVGL 177
                           E  +L+ +G+ L L     +G                    +  
Sbjct: 126 QRLAQEDDHAFTLRCFEKHMLQELGYALLLENEADSGSPIVPTRNYRYILERGAIAEMAD 185

Query: 178 PYAEKMLVLPSFLWKEEQTI-DADSLKSAFQLTDYFLNKYA 217
                 +   + L        DA+S + + QL    L+ + 
Sbjct: 186 SSQGMPVSGKTLLDMAADDYRDANSARQSKQLMRMLLDHHL 226


>gi|152976729|ref|YP_001376246.1| DNA repair protein RecO [Bacillus cereus subsp. cytotoxis NVH
           391-98]
 gi|189039649|sp|A7GSZ3|RECO_BACCN RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|152025481|gb|ABS23251.1| DNA repair protein RecO [Bacillus cytotoxicus NVH 391-98]
          Length = 248

 Score =  101 bits (251), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 28/179 (15%), Positives = 68/179 (37%), Gaps = 1/179 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M+ + + I++    YGE N I+ + +R++G+     R  +  + +    +  +   ++  
Sbjct: 1   MFQKVEGIVIRTTDYGETNKIVTIFSREFGKISVMARGAKKPKSRLASISQLMTHGHFLI 60

Query: 61  RLAQNLGE-FRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLN 119
           ++   LG   + E++ S         L  Y    +    +   +++    L++ML   L+
Sbjct: 61  QMGSGLGTLQQGEMISSMKEIREDIFLTAYASFIVELTDKATEDKKNNPYLFEMLYQTLH 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
                     + +  +  +L  +G       C +     D +  S + GG +C      
Sbjct: 121 YMCDGVDPEVLSLIYQTKMLPVLGMHPYFDTCAICHQETDFVAFSVREGGFLCFRHAEQ 179


>gi|251793348|ref|YP_003008076.1| DNA repair protein RecO [Aggregatibacter aphrophilus NJ8700]
 gi|247534743|gb|ACS97989.1| DNA repair protein RecO [Aggregatibacter aphrophilus NJ8700]
          Length = 214

 Score =  101 bits (251), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 32/217 (14%), Positives = 68/217 (31%), Gaps = 11/217 (5%)

Query: 22  LEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLAQNLGEFRFEVLESHCA 79
           +++ T  +GR     +  ++ R   + +LQ    + + W  R    +         +  A
Sbjct: 1   MDLFTEDFGRLSVLAKGVRAKRSMLKGVLQPFTPLLLRWSGRGDLKVLTKAEP---AAIA 57

Query: 80  KLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPSVIGKIFVQIELMLL 139
             L       G      + R L       +L+      L    +   +       E  LL
Sbjct: 58  LPLQHVALYSGFYLNELICRVLEPETAYPQLFQQYLHCLTRLAVNQDVEPALRTFEFQLL 117

Query: 140 KNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKMLVLPSFLWKEEQTIDA 199
           + +G+G+D T C  +G   +              +  +             +++ +  + 
Sbjct: 118 RTLGYGIDFTHCAGSGKAVEADMTYRYREEKGFIASLIKDNLTFYGRELLAFEQTRFEEP 177

Query: 200 DSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENFLGK 235
             L +A + T     + AL+  +       RE F   
Sbjct: 178 TILLAAKRFT-----RIALKPYLGDKPLKSRELFTQY 209


>gi|297584642|ref|YP_003700422.1| DNA repair protein RecO [Bacillus selenitireducens MLS10]
 gi|297143099|gb|ADH99856.1| DNA repair protein RecO [Bacillus selenitireducens MLS10]
          Length = 256

 Score =  101 bits (250), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 36/191 (18%), Positives = 71/191 (37%), Gaps = 1/191 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNW-R 59
           M  + + I++    YGE N ++ V +++ G+     R  +    +        V+  +  
Sbjct: 1   MLHRVEGIVIRANDYGENNKVVTVYSKEQGKVALMARGAKKPGSRFAASTQLFVQAVFVY 60

Query: 60  SRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLN 119
            R          +++ES  +      L  YG   I  + R + +  P  +LY+ L   L 
Sbjct: 61  HRQHGMGSLNAADLIESFISVRKDVLLTTYGACMIELIDRLVEDHIPDGQLYETLYQLLR 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                     +   +E+ +L+  G    L +C   G  +     S   GGA+C+      
Sbjct: 121 RLDEGDDPAVLLAIMEVKMLRYAGVDPVLHQCASCGSVELPFQFSMTYGGALCKRCLHKD 180

Query: 180 AEKMLVLPSFL 190
              + V P+ +
Sbjct: 181 HHVVYVNPAVM 191


>gi|229013518|ref|ZP_04170652.1| DNA repair protein recO [Bacillus mycoides DSM 2048]
 gi|229061991|ref|ZP_04199317.1| DNA repair protein recO [Bacillus cereus AH603]
 gi|229135123|ref|ZP_04263925.1| DNA repair protein recO [Bacillus cereus BDRD-ST196]
 gi|229169046|ref|ZP_04296762.1| DNA repair protein recO [Bacillus cereus AH621]
 gi|228614455|gb|EEK71564.1| DNA repair protein recO [Bacillus cereus AH621]
 gi|228648352|gb|EEL04385.1| DNA repair protein recO [Bacillus cereus BDRD-ST196]
 gi|228717300|gb|EEL68973.1| DNA repair protein recO [Bacillus cereus AH603]
 gi|228747755|gb|EEL97624.1| DNA repair protein recO [Bacillus mycoides DSM 2048]
          Length = 252

 Score =  101 bits (250), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 27/179 (15%), Positives = 67/179 (37%), Gaps = 1/179 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M+ + + I++    YGE N I+ + +R++G+     R  +  + +    +  +   ++  
Sbjct: 5   MFQKVEGIVIRTTDYGETNKIVTIYSREFGKVSAMARGAKKPKSRLAAISQLMTHGHFLI 64

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFL-YGLQSIVPLFRFLPEREPCLELYDMLNIFLN 119
           ++   LG  +   + S   ++        Y    I    +   +++    L++ML   L+
Sbjct: 65  QMGSGLGTLQQGEIISSMKEIREDIFLTAYASFIIELTDKATEDKKHNPYLFEMLYQTLH 124

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
                     + +  +  +L  +G       C +     D +  S + GG +C      
Sbjct: 125 YMCEGVDPEVLSLIYQTKMLPVLGMRPYFDTCAICHQETDFVAFSVREGGFLCSRHAEQ 183


>gi|310822251|ref|YP_003954609.1| DNA repair protein RecO [Stigmatella aurantiaca DW4/3-1]
 gi|309395323|gb|ADO72782.1| DNA repair protein RecO [Stigmatella aurantiaca DW4/3-1]
          Length = 244

 Score =  101 bits (250), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 36/178 (20%), Positives = 66/178 (37%), Gaps = 3/178 (1%)

Query: 2   YWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQ--PILQAGNLVRVNWR 59
            + D+A++L    YGE + ++ ++TRQ+G+   F    +  + +    L+    +RV+  
Sbjct: 3   RFVDEALVLSTVDYGEADRMVTLLTRQHGKLTAFAAGARKSKRRFAGALEPFMYLRVHLV 62

Query: 60  SRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLN 119
                 +     ++L  + A      L    L ++        + EP  EL+ +L  +L 
Sbjct: 63  ETRGSTVRLDSTDILAGYYAARQELPLIARALYAVEMCRELTRDHEPHPELFALLEEYLV 122

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLL-WVSPKSGGAVCRSVG 176
                       +  EL  L + G       C + G             GGAVC   G
Sbjct: 123 RLNAKEAGPTSLLAFELSALAHAGLMPRFDACALCGGEPGERPRFDQAHGGAVCEPCG 180


>gi|228910132|ref|ZP_04073952.1| DNA repair protein recO [Bacillus thuringiensis IBL 200]
 gi|228954582|ref|ZP_04116607.1| DNA repair protein recO [Bacillus thuringiensis serovar kurstaki
           str. T03a001]
 gi|229071801|ref|ZP_04205016.1| DNA repair protein recO [Bacillus cereus F65185]
 gi|229081558|ref|ZP_04214056.1| DNA repair protein recO [Bacillus cereus Rock4-2]
 gi|229180575|ref|ZP_04307917.1| DNA repair protein recO [Bacillus cereus 172560W]
 gi|229192507|ref|ZP_04319470.1| DNA repair protein recO [Bacillus cereus ATCC 10876]
 gi|228591084|gb|EEK48940.1| DNA repair protein recO [Bacillus cereus ATCC 10876]
 gi|228602999|gb|EEK60478.1| DNA repair protein recO [Bacillus cereus 172560W]
 gi|228701763|gb|EEL54251.1| DNA repair protein recO [Bacillus cereus Rock4-2]
 gi|228711396|gb|EEL63356.1| DNA repair protein recO [Bacillus cereus F65185]
 gi|228805239|gb|EEM51833.1| DNA repair protein recO [Bacillus thuringiensis serovar kurstaki
           str. T03a001]
 gi|228849649|gb|EEM94483.1| DNA repair protein recO [Bacillus thuringiensis IBL 200]
          Length = 252

 Score =  101 bits (250), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 26/179 (14%), Positives = 64/179 (35%), Gaps = 1/179 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M+ + + I++    YGE N I+ + +R+ G+     R  +  + +    +  +    +  
Sbjct: 5   MFQKVEGIVIRTTDYGETNKIVTIFSRELGKVSAMARGAKKPKSRLASVSQLMTHGQFLI 64

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSI-VPLFRFLPEREPCLELYDMLNIFLN 119
           ++   LG  +   + S   ++            I     +   +++    L++ML   L+
Sbjct: 65  QMGSGLGTLQQGEIISTMKEIREDIFLTAYASFIVELTDKATEDKKHNPYLFEMLYQTLH 124

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
                     + +  +  +L  +G       C +     D +  S + GG +C      
Sbjct: 125 YMCEGVDPEVLSLIYQTKMLPVLGMRPYFDTCAICHQETDFVAFSVREGGFLCSRHAEQ 183


>gi|163942054|ref|YP_001646938.1| DNA repair protein RecO [Bacillus weihenstephanensis KBAB4]
 gi|229470329|sp|A9VHS5|RECO_BACWK RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|163864251|gb|ABY45310.1| DNA repair protein RecO [Bacillus weihenstephanensis KBAB4]
          Length = 248

 Score =  101 bits (250), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 27/179 (15%), Positives = 67/179 (37%), Gaps = 1/179 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M+ + + I++    YGE N I+ + +R++G+     R  +  + +    +  +   ++  
Sbjct: 1   MFQKVEGIVIRTTDYGETNKIVTIYSREFGKVSAMARGAKKPKSRLAAISQLMTHGHFLI 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFL-YGLQSIVPLFRFLPEREPCLELYDMLNIFLN 119
           ++   LG  +   + S   ++        Y    I    +   +++    L++ML   L+
Sbjct: 61  QMGSGLGTLQQGEIISSMKEIREDIFLTAYASFIIELTDKATEDKKHNPYLFEMLYQTLH 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
                     + +  +  +L  +G       C +     D +  S + GG +C      
Sbjct: 121 YMCEGVDPEVLSLIYQTKMLPVLGMRPYFDTCAICHQETDFVAFSVREGGFLCSRHAEQ 179


>gi|206971346|ref|ZP_03232297.1| DNA repair protein RecO [Bacillus cereus AH1134]
 gi|206734118|gb|EDZ51289.1| DNA repair protein RecO [Bacillus cereus AH1134]
          Length = 248

 Score =  101 bits (250), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 26/179 (14%), Positives = 64/179 (35%), Gaps = 1/179 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M+ + + I++    YGE N I+ + +R+ G+     R  +  + +    +  +    +  
Sbjct: 1   MFQKVEGIVIRTTDYGETNKIVTIFSRELGKVSAMARGAKKPKSRLASVSQLMTHGQFLI 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSI-VPLFRFLPEREPCLELYDMLNIFLN 119
           ++   LG  +   + S   ++            I     +   +++    L++ML   L+
Sbjct: 61  QMGSGLGTLQQGEIISTMKEIREDIFLTAYASFIVELTDKATEDKKHNPYLFEMLYQTLH 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
                     + +  +  +L  +G       C +     D +  S + GG +C      
Sbjct: 121 YMCEGVDPEVLSLIYQTKMLPVLGMRPYFDTCAICHQETDFVAFSVREGGFLCSRHAEQ 179


>gi|228941463|ref|ZP_04104014.1| DNA repair protein recO [Bacillus thuringiensis serovar berliner
           ATCC 10792]
 gi|228960563|ref|ZP_04122212.1| DNA repair protein recO [Bacillus thuringiensis serovar pakistani
           str. T13001]
 gi|228974394|ref|ZP_04134963.1| DNA repair protein recO [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228980987|ref|ZP_04141290.1| DNA repair protein recO [Bacillus thuringiensis Bt407]
 gi|229048017|ref|ZP_04193593.1| DNA repair protein recO [Bacillus cereus AH676]
 gi|229111771|ref|ZP_04241319.1| DNA repair protein recO [Bacillus cereus Rock1-15]
 gi|229146883|ref|ZP_04275248.1| DNA repair protein recO [Bacillus cereus BDRD-ST24]
 gi|228636711|gb|EEK93176.1| DNA repair protein recO [Bacillus cereus BDRD-ST24]
 gi|228671765|gb|EEL27061.1| DNA repair protein recO [Bacillus cereus Rock1-15]
 gi|228723474|gb|EEL74843.1| DNA repair protein recO [Bacillus cereus AH676]
 gi|228778778|gb|EEM27042.1| DNA repair protein recO [Bacillus thuringiensis Bt407]
 gi|228785444|gb|EEM33454.1| DNA repair protein recO [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228799163|gb|EEM46131.1| DNA repair protein recO [Bacillus thuringiensis serovar pakistani
           str. T13001]
 gi|228818244|gb|EEM64318.1| DNA repair protein recO [Bacillus thuringiensis serovar berliner
           ATCC 10792]
          Length = 252

 Score =  100 bits (249), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 26/179 (14%), Positives = 65/179 (36%), Gaps = 1/179 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M+ + + I++    YGE N I+ + +R+ G+     R  +  + +    +  +   ++  
Sbjct: 5   MFQKVEGIVIRTTDYGETNKIVTIFSRELGKVSAMARGAKKPKSRLASVSQLMTHGHFLI 64

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSI-VPLFRFLPEREPCLELYDMLNIFLN 119
           ++   LG  +   + S   ++            I     +   +++    L++ML   L+
Sbjct: 65  QMGSGLGTLQQGEIISTMKEIREDIFLTAYASFIVELTDKATEDKKHNPYLFEMLYQTLH 124

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
                     + +  +  +L  +G       C +     D +  S + GG +C      
Sbjct: 125 YMCEGVDPEVLSLIYQTKMLPVLGMRPYFDTCAICHQETDFVAFSVREGGFLCSRHAEQ 183


>gi|296504792|ref|YP_003666492.1| DNA repair protein RecO [Bacillus thuringiensis BMB171]
 gi|296325844|gb|ADH08772.1| DNA repair protein RecO [Bacillus thuringiensis BMB171]
 gi|326942080|gb|AEA17976.1| DNA repair protein RecO [Bacillus thuringiensis serovar chinensis
           CT-43]
          Length = 248

 Score =  100 bits (249), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 26/179 (14%), Positives = 65/179 (36%), Gaps = 1/179 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M+ + + I++    YGE N I+ + +R+ G+     R  +  + +    +  +   ++  
Sbjct: 1   MFQKVEGIVIRTTDYGETNKIVTIFSRELGKVSAMARGAKKPKSRLASVSQLMTHGHFLI 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSI-VPLFRFLPEREPCLELYDMLNIFLN 119
           ++   LG  +   + S   ++            I     +   +++    L++ML   L+
Sbjct: 61  QMGSGLGTLQQGEIISTMKEIREDIFLTAYASFIVELTDKATEDKKHNPYLFEMLYQTLH 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
                     + +  +  +L  +G       C +     D +  S + GG +C      
Sbjct: 121 YMCEGVDPEVLSLIYQTKMLPVLGMRPYFDTCAICHQETDFVAFSVREGGFLCSRHAEQ 179


>gi|328474972|gb|EGF45766.1| DNA repair protein RecO [Listeria monocytogenes 220]
          Length = 254

 Score =  100 bits (249), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 32/186 (17%), Positives = 65/186 (34%), Gaps = 2/186 (1%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQ-SHRMQPILQAGNLVRVNWRSRLAQ 64
           + I++   SY E + I+ + TR++G+     R  +   R+  + Q        +      
Sbjct: 5   EGIVIRQTSYRESDKIVRMYTREFGKIGVVARGAKTKSRLAAVTQLFTNGYFTFFGSNGL 64

Query: 65  NLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIP 124
              +     +E+  +      +  Y       L +   ER+P   LY++    L      
Sbjct: 65  GTLQQGEV-IENFSSIQQDIFMTAYATYVCELLDKATEERQPNPYLYELTFQILRDINEG 123

Query: 125 SVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKML 184
                +    E+ +L  +G    + KC + G T      S  S G +C         +M 
Sbjct: 124 YDPQILTQIFEMKMLPVLGLYPTMDKCAICGETTGHFDFSTSSNGIICHRCFEKDRYRMH 183

Query: 185 VLPSFL 190
           +  + +
Sbjct: 184 LPENVV 189


>gi|65321671|ref|ZP_00394630.1| COG1381: Recombinational DNA repair protein (RecF pathway)
           [Bacillus anthracis str. A2012]
 gi|228916930|ref|ZP_04080492.1| DNA repair protein recO [Bacillus thuringiensis serovar pulsiensis
           BGSC 4CC1]
 gi|228929341|ref|ZP_04092366.1| DNA repair protein recO [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
 gi|228935618|ref|ZP_04098433.1| DNA repair protein recO [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
 gi|228948011|ref|ZP_04110297.1| DNA repair protein recO [Bacillus thuringiensis serovar monterrey
           BGSC 4AJ1]
 gi|229093367|ref|ZP_04224474.1| DNA repair protein recO [Bacillus cereus Rock3-42]
 gi|229123836|ref|ZP_04253030.1| DNA repair protein recO [Bacillus cereus 95/8201]
 gi|229141035|ref|ZP_04269578.1| DNA repair protein recO [Bacillus cereus BDRD-ST26]
 gi|229157912|ref|ZP_04285986.1| DNA repair protein recO [Bacillus cereus ATCC 4342]
 gi|229163243|ref|ZP_04291198.1| DNA repair protein recO [Bacillus cereus R309803]
 gi|229186537|ref|ZP_04313699.1| DNA repair protein recO [Bacillus cereus BGSC 6E1]
 gi|229198424|ref|ZP_04325130.1| DNA repair protein recO [Bacillus cereus m1293]
 gi|228585124|gb|EEK43236.1| DNA repair protein recO [Bacillus cereus m1293]
 gi|228596968|gb|EEK54626.1| DNA repair protein recO [Bacillus cereus BGSC 6E1]
 gi|228620306|gb|EEK77177.1| DNA repair protein recO [Bacillus cereus R309803]
 gi|228625571|gb|EEK82324.1| DNA repair protein recO [Bacillus cereus ATCC 4342]
 gi|228642468|gb|EEK98756.1| DNA repair protein recO [Bacillus cereus BDRD-ST26]
 gi|228659657|gb|EEL15303.1| DNA repair protein recO [Bacillus cereus 95/8201]
 gi|228690023|gb|EEL43824.1| DNA repair protein recO [Bacillus cereus Rock3-42]
 gi|228811701|gb|EEM58036.1| DNA repair protein recO [Bacillus thuringiensis serovar monterrey
           BGSC 4AJ1]
 gi|228824058|gb|EEM69875.1| DNA repair protein recO [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
 gi|228830355|gb|EEM75967.1| DNA repair protein recO [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
 gi|228842754|gb|EEM87840.1| DNA repair protein recO [Bacillus thuringiensis serovar pulsiensis
           BGSC 4CC1]
          Length = 252

 Score =  100 bits (249), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 26/179 (14%), Positives = 65/179 (36%), Gaps = 1/179 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M+ + + I++    YGE N I+ + +R+ G+     R  +  + +    +  +   ++  
Sbjct: 5   MFQKVEGIVIRTTDYGETNKIVTIFSRELGKVSAMARGAKKPKSRLASVSQLMTHGHFLI 64

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSI-VPLFRFLPEREPCLELYDMLNIFLN 119
           ++   LG  +   + S   ++            I     +   +++    L++ML   L+
Sbjct: 65  QMGSGLGTLQQGEIISTMKEIREDIFLTAYASFIVELTDKATEDKKHNPYLFEMLYQTLH 124

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
                     + +  +  +L  +G       C +     D +  S + GG +C      
Sbjct: 125 YMCEGVDPEVLSLIYQTKMLPVLGMRPYFDTCAICHQETDFVAFSVREGGFLCSRHAEQ 183


>gi|30264368|ref|NP_846745.1| DNA repair protein RecO [Bacillus anthracis str. Ames]
 gi|47778304|ref|YP_021168.2| DNA repair protein RecO [Bacillus anthracis str. 'Ames Ancestor']
 gi|49187194|ref|YP_030446.1| DNA repair protein RecO [Bacillus anthracis str. Sterne]
 gi|49481310|ref|YP_038354.1| DNA repair protein RecO [Bacillus thuringiensis serovar konkukian
           str. 97-27]
 gi|52141205|ref|YP_085625.1| DNA repair protein RecO [Bacillus cereus E33L]
 gi|165872031|ref|ZP_02216671.1| recombination protein O [Bacillus anthracis str. A0488]
 gi|167634555|ref|ZP_02392875.1| recombination protein O [Bacillus anthracis str. A0442]
 gi|167638589|ref|ZP_02396865.1| recombination protein O [Bacillus anthracis str. A0193]
 gi|170687502|ref|ZP_02878719.1| recombination protein O [Bacillus anthracis str. A0465]
 gi|170707433|ref|ZP_02897887.1| recombination protein O [Bacillus anthracis str. A0389]
 gi|177653249|ref|ZP_02935501.1| recombination protein O [Bacillus anthracis str. A0174]
 gi|190566916|ref|ZP_03019832.1| recombination protein O [Bacillus anthracis Tsiankovskii-I]
 gi|196039289|ref|ZP_03106595.1| recombination protein O [Bacillus cereus NVH0597-99]
 gi|196046321|ref|ZP_03113547.1| recombination protein O [Bacillus cereus 03BB108]
 gi|217961788|ref|YP_002340358.1| DNA repair protein RecO [Bacillus cereus AH187]
 gi|218905435|ref|YP_002453269.1| recombination protein O [Bacillus cereus AH820]
 gi|225866279|ref|YP_002751657.1| DNA repair protein RecO [Bacillus cereus 03BB102]
 gi|227817074|ref|YP_002817083.1| DNA repair protein RecO [Bacillus anthracis str. CDC 684]
 gi|229603091|ref|YP_002868587.1| DNA repair protein RecO [Bacillus anthracis str. A0248]
 gi|254684055|ref|ZP_05147915.1| DNA repair protein RecO [Bacillus anthracis str. CNEVA-9066]
 gi|254721889|ref|ZP_05183678.1| DNA repair protein RecO [Bacillus anthracis str. A1055]
 gi|254736403|ref|ZP_05194109.1| DNA repair protein RecO [Bacillus anthracis str. Western North
           America USA6153]
 gi|254741441|ref|ZP_05199128.1| DNA repair protein RecO [Bacillus anthracis str. Kruger B]
 gi|254750879|ref|ZP_05202918.1| DNA repair protein RecO [Bacillus anthracis str. Vollum]
 gi|254757793|ref|ZP_05209820.1| DNA repair protein RecO [Bacillus anthracis str. Australia 94]
 gi|301055791|ref|YP_003794002.1| DNA repair protein RecO [Bacillus anthracis CI]
 gi|42559458|sp|Q81LT9|RECO_BACAN RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|61214838|sp|Q634P2|RECO_BACCZ RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|61215015|sp|Q6HDM2|RECO_BACHK RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|226737854|sp|B7JN23|RECO_BACC0 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|226737857|sp|B7HPJ7|RECO_BACC7 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|254790509|sp|C3P8K4|RECO_BACAA RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|254790510|sp|C3L5Q1|RECO_BACAC RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|254790511|sp|C1ESJ2|RECO_BACC3 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|30259026|gb|AAP28231.1| DNA repair protein RecO [Bacillus anthracis str. Ames]
 gi|47552009|gb|AAT33643.2| recombination protein O [Bacillus anthracis str. 'Ames Ancestor']
 gi|49181121|gb|AAT56497.1| recombination protein O [Bacillus anthracis str. Sterne]
 gi|49332866|gb|AAT63512.1| recombination protein O (DNA repair protein) [Bacillus
           thuringiensis serovar konkukian str. 97-27]
 gi|51974674|gb|AAU16224.1| recombination protein O (DNA repair protein O) [Bacillus cereus
           E33L]
 gi|164712162|gb|EDR17699.1| recombination protein O [Bacillus anthracis str. A0488]
 gi|167513437|gb|EDR88807.1| recombination protein O [Bacillus anthracis str. A0193]
 gi|167530007|gb|EDR92742.1| recombination protein O [Bacillus anthracis str. A0442]
 gi|170127677|gb|EDS96550.1| recombination protein O [Bacillus anthracis str. A0389]
 gi|170668697|gb|EDT19443.1| recombination protein O [Bacillus anthracis str. A0465]
 gi|172081531|gb|EDT66603.1| recombination protein O [Bacillus anthracis str. A0174]
 gi|190561907|gb|EDV15876.1| recombination protein O [Bacillus anthracis Tsiankovskii-I]
 gi|196022791|gb|EDX61472.1| recombination protein O [Bacillus cereus 03BB108]
 gi|196029916|gb|EDX68517.1| recombination protein O [Bacillus cereus NVH0597-99]
 gi|217063057|gb|ACJ77307.1| recombination protein O [Bacillus cereus AH187]
 gi|218539840|gb|ACK92238.1| recombination protein O [Bacillus cereus AH820]
 gi|225789516|gb|ACO29733.1| DNA repair protein RecO [Bacillus cereus 03BB102]
 gi|227007270|gb|ACP17013.1| DNA repair protein RecO [Bacillus anthracis str. CDC 684]
 gi|229267499|gb|ACQ49136.1| DNA repair protein RecO [Bacillus anthracis str. A0248]
 gi|300377960|gb|ADK06864.1| DNA repair protein RecO [Bacillus cereus biovar anthracis str. CI]
 gi|324328202|gb|ADY23462.1| DNA repair protein RecO [Bacillus thuringiensis serovar finitimus
           YBT-020]
          Length = 248

 Score =  100 bits (249), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 26/179 (14%), Positives = 65/179 (36%), Gaps = 1/179 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M+ + + I++    YGE N I+ + +R+ G+     R  +  + +    +  +   ++  
Sbjct: 1   MFQKVEGIVIRTTDYGETNKIVTIFSRELGKVSAMARGAKKPKSRLASVSQLMTHGHFLI 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSI-VPLFRFLPEREPCLELYDMLNIFLN 119
           ++   LG  +   + S   ++            I     +   +++    L++ML   L+
Sbjct: 61  QMGSGLGTLQQGEIISTMKEIREDIFLTAYASFIVELTDKATEDKKHNPYLFEMLYQTLH 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
                     + +  +  +L  +G       C +     D +  S + GG +C      
Sbjct: 121 YMCEGVDPEVLSLIYQTKMLPVLGMRPYFDTCAICHQETDFVAFSVREGGFLCSRHAEQ 179


>gi|228987548|ref|ZP_04147667.1| DNA repair protein recO [Bacillus thuringiensis serovar
           tochigiensis BGSC 4Y1]
 gi|228772280|gb|EEM20727.1| DNA repair protein recO [Bacillus thuringiensis serovar
           tochigiensis BGSC 4Y1]
          Length = 252

 Score =  100 bits (249), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 26/179 (14%), Positives = 65/179 (36%), Gaps = 1/179 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M+ + + I++    YGE N I+ + +R+ G+     R  +  + +    +  +   ++  
Sbjct: 5   MFQKVEGIVIRTIDYGETNKIVTIFSRELGKVSAMARGAKKPKSRLASVSQLMTHGHFLI 64

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSI-VPLFRFLPEREPCLELYDMLNIFLN 119
           ++   LG  +   + S   ++            I     +   +++    L++ML   L+
Sbjct: 65  QMGSGLGTLQQGEIISTMKEIREDIFLTAYASFIVELTDKATEDKKHNPYLFEMLYQTLH 124

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
                     + +  +  +L  +G       C +     D +  S + GG +C      
Sbjct: 125 YMCEGVDPEVLSLIYQTKMLPVLGMRPYFDTCAICHQETDFVAFSVREGGFLCSRHAEQ 183


>gi|229031946|ref|ZP_04187933.1| DNA repair protein recO [Bacillus cereus AH1271]
 gi|229174972|ref|ZP_04302492.1| DNA repair protein recO [Bacillus cereus MM3]
 gi|228608640|gb|EEK65942.1| DNA repair protein recO [Bacillus cereus MM3]
 gi|228729410|gb|EEL80400.1| DNA repair protein recO [Bacillus cereus AH1271]
          Length = 252

 Score =  100 bits (249), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 27/179 (15%), Positives = 65/179 (36%), Gaps = 1/179 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M+ + + I++    YGE N I+ + +R+ G+     R  +  + +    +  +   N+  
Sbjct: 5   MFQKVEGIVIRTTDYGETNKIVTIFSRELGKVSAMARGAKKPKSRLASVSQLMTHGNFLI 64

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSI-VPLFRFLPEREPCLELYDMLNIFLN 119
           ++   LG  +   + S   ++            I     +   +++    L++ML   L+
Sbjct: 65  QMGSGLGTLQQGEIISTMKEIREDIFLTAYASFIVELTDKATEDKKHNPYLFEMLYQTLH 124

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
                     + +  +  +L  +G       C +     D +  S + GG +C      
Sbjct: 125 YMCEGVDSEVLSLIYQTKMLPVLGMRPYFDTCAICHQETDFVAFSVREGGFLCSRHAEQ 183


>gi|228923050|ref|ZP_04086343.1| DNA repair protein recO [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
 gi|228836683|gb|EEM82031.1| DNA repair protein recO [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
          Length = 252

 Score =  100 bits (248), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 26/179 (14%), Positives = 65/179 (36%), Gaps = 1/179 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M+ + + I++    YGE N I+ + +R+ G+     R  +  + +    +  +   ++  
Sbjct: 5   MFQKVEGIVIRTTDYGETNKIVTIFSRELGKVSAMARGAKKPKSRLASVSQLMTHGHFLI 64

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSI-VPLFRFLPEREPCLELYDMLNIFLN 119
           ++   LG  +   + S   ++            I     +   +++    L++ML   L+
Sbjct: 65  QMGSGLGTLQQGEIISTMKEIREDIFLTAYASFIVELTDKATEDKKHNPYLFEMLYQTLH 124

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
                     + +  +  +L  +G       C +     D +  S + GG +C      
Sbjct: 125 YMCEGVDSEVLSLIYQTKMLPVLGMRPYFDTCAICHQETDFVAFSVREGGFLCSRHAEQ 183


>gi|47567862|ref|ZP_00238570.1| DNA repair protein RecO [Bacillus cereus G9241]
 gi|118479468|ref|YP_896619.1| DNA repair protein RecO [Bacillus thuringiensis str. Al Hakam]
 gi|222097743|ref|YP_002531800.1| DNA repair protein reco [Bacillus cereus Q1]
 gi|47555539|gb|EAL13882.1| DNA repair protein RecO [Bacillus cereus G9241]
 gi|118418693|gb|ABK87112.1| DNA replication and repair protein RecO [Bacillus thuringiensis
           str. Al Hakam]
 gi|221241801|gb|ACM14511.1| recombination protein O [Bacillus cereus Q1]
          Length = 257

 Score =  100 bits (248), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 26/179 (14%), Positives = 65/179 (36%), Gaps = 1/179 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M+ + + I++    YGE N I+ + +R+ G+     R  +  + +    +  +   ++  
Sbjct: 10  MFQKVEGIVIRTTDYGETNKIVTIFSRELGKVSAMARGAKKPKSRLASVSQLMTHGHFLI 69

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSI-VPLFRFLPEREPCLELYDMLNIFLN 119
           ++   LG  +   + S   ++            I     +   +++    L++ML   L+
Sbjct: 70  QMGSGLGTLQQGEIISTMKEIREDIFLTAYASFIVELTDKATEDKKHNPYLFEMLYQTLH 129

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
                     + +  +  +L  +G       C +     D +  S + GG +C      
Sbjct: 130 YMCEGVDPEVLSLIYQTKMLPVLGMRPYFDTCAICHQETDFVAFSVREGGFLCSRHAEQ 188


>gi|228902821|ref|ZP_04066966.1| DNA repair protein recO [Bacillus thuringiensis IBL 4222]
 gi|228967363|ref|ZP_04128398.1| DNA repair protein recO [Bacillus thuringiensis serovar sotto str.
           T04001]
 gi|228792398|gb|EEM39965.1| DNA repair protein recO [Bacillus thuringiensis serovar sotto str.
           T04001]
 gi|228856830|gb|EEN01345.1| DNA repair protein recO [Bacillus thuringiensis IBL 4222]
          Length = 252

 Score =  100 bits (248), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 26/179 (14%), Positives = 65/179 (36%), Gaps = 1/179 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M+ + + I++    YGE N I+ + +R+ G+     R  +  + +    +  +   ++  
Sbjct: 5   MFQKVEGIVIRTTDYGETNKIVTIFSRELGKISAMARGAKKPKSRLASVSQLMTHGHFLI 64

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSI-VPLFRFLPEREPCLELYDMLNIFLN 119
           ++   LG  +   + S   ++            I     +   +++    L++ML   L+
Sbjct: 65  QMGSGLGTLQQGEIISTMKEIREDIFLTAYASFIVELTDKATEDKKHNPYLFEMLYQTLH 124

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
                     + +  +  +L  +G       C +     D +  S + GG +C      
Sbjct: 125 YMCEGVDSEVLSLIYQTKMLPVLGMRPYFDTCAICHQETDFVAFSVREGGFLCSRHAEQ 183


>gi|218899464|ref|YP_002447875.1| recombination protein O [Bacillus cereus G9842]
 gi|226737855|sp|B7IYE9|RECO_BACC2 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|218545290|gb|ACK97684.1| recombination protein O [Bacillus cereus G9842]
          Length = 248

 Score =  100 bits (248), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 26/179 (14%), Positives = 65/179 (36%), Gaps = 1/179 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M+ + + I++    YGE N I+ + +R+ G+     R  +  + +    +  +   ++  
Sbjct: 1   MFQKVEGIVIRTTDYGETNKIVTIFSRELGKISAMARGAKKPKSRLASVSQLMTHGHFLI 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSI-VPLFRFLPEREPCLELYDMLNIFLN 119
           ++   LG  +   + S   ++            I     +   +++    L++ML   L+
Sbjct: 61  QMGSGLGTLQQGEIISTMKEIREDIFLTAYASFIVELTDKATEDKKHNPYLFEMLYQTLH 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
                     + +  +  +L  +G       C +     D +  S + GG +C      
Sbjct: 121 YMCEGVDSEVLSLIYQTKMLPVLGMRPYFDTCAICHQETDFVAFSVREGGFLCSRHAEQ 179


>gi|75761899|ref|ZP_00741824.1| DNA repair protein recO [Bacillus thuringiensis serovar israelensis
           ATCC 35646]
 gi|74490607|gb|EAO53898.1| DNA repair protein recO [Bacillus thuringiensis serovar israelensis
           ATCC 35646]
          Length = 257

 Score = 99.9 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 26/179 (14%), Positives = 65/179 (36%), Gaps = 1/179 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M+ + + I++    YGE N I+ + +R+ G+     R  +  + +    +  +   ++  
Sbjct: 10  MFQKVEGIVIRTTDYGETNKIVTIFSRELGKISAMARGAKKPKSRLASVSQLMTHGHFLI 69

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSI-VPLFRFLPEREPCLELYDMLNIFLN 119
           ++   LG  +   + S   ++            I     +   +++    L++ML   L+
Sbjct: 70  QMGSGLGTLQQGEIISTMKEIREDIFLTAYASFIVELTDKATEDKKHNPYLFEMLYQTLH 129

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
                     + +  +  +L  +G       C +     D +  S + GG +C      
Sbjct: 130 YMCEGVDSEVLSLIYQTKMLPVLGMRPYFDTCAICHQETDFVAFSVREGGFLCSRHAEQ 188


>gi|5114185|gb|AAD40231.1|AF123492_3 RecO [Pseudomonas aeruginosa]
          Length = 203

 Score = 99.9 bits (247), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 29/156 (18%), Positives = 52/156 (33%), Gaps = 5/156 (3%)

Query: 8   IILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQNLG 67
            +L  R Y E + +++  T   GR    +R  +  +   + +    +   WR R      
Sbjct: 10  YVLHSRPYKETSALVDFFTP-LGRLRAVLRGARG-KAGALARPFVPLEAEWRGRGELKT- 66

Query: 68  EFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPSVI 127
                +  +    LL+      GL     L R LP  +P  E++      L        I
Sbjct: 67  --VARLESAGVPNLLNGQALFSGLYLNELLIRLLPAEDPQPEIFAHYAATLPLLAAGRPI 124

Query: 128 GKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWV 163
             +    E  LL+ +G+G  L   +     +     
Sbjct: 125 EPLLRAFEWRLLEQLGYGFALDVDIDGRPIEPQALY 160


>gi|148981905|ref|ZP_01816563.1| DNA repair protein RecO [Vibrionales bacterium SWAT-3]
 gi|145960706|gb|EDK26048.1| DNA repair protein RecO [Vibrionales bacterium SWAT-3]
          Length = 222

 Score = 99.9 bits (247), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 38/217 (17%), Positives = 69/217 (31%), Gaps = 11/217 (5%)

Query: 20  IILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLAQNLGEFRFEVLESH 77
           +IL++ + ++GR     +  +S R   +  LQ    + + W    +    +   +     
Sbjct: 1   MILDIFSEEFGRVTLMSKGARSKRSNLKGALQPFTPLLLKWSGNSS---MKTLRQAEPIS 57

Query: 78  CAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPSVIGKIFVQIELM 137
               L+       +     + R L    P   L+      L              + EL 
Sbjct: 58  LGLPLTGINLYSAMYVNELIGRVLMAEVPMPALFHDYLHALTELAHNENPEPALRRFELA 117

Query: 138 LLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKMLVLPSFLWKEEQTI 197
           LL  +G+G+D   C  TG   D              +         +        E + I
Sbjct: 118 LLSAMGYGVDFLHCAGTGEPIDPTMTYRYREQKGFIASVRRDNLTFMGDELIAISERRFI 177

Query: 198 DADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENFL 233
             + LK+A + T     + AL+  +       RE FL
Sbjct: 178 TKEQLKAAKRFT-----RIALKPYLGGKPLKSRELFL 209


>gi|319651592|ref|ZP_08005719.1| DNA repair protein RecO [Bacillus sp. 2_A_57_CT2]
 gi|317396659|gb|EFV77370.1| DNA repair protein RecO [Bacillus sp. 2_A_57_CT2]
          Length = 250

 Score = 99.5 bits (246), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 31/179 (17%), Positives = 66/179 (36%), Gaps = 1/179 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNW-R 59
           M  + + I++   +Y E N I+ + TR++G+     R  +    +           N+  
Sbjct: 1   MLDKCEGIVIRTTNYSETNKIVTLYTREWGKVGVMARGAKKPNSRLAAVTQLFTYGNFLV 60

Query: 60  SRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLN 119
            R +      + +++ S  +      L  Y    +    + + +++P   L+++L   LN
Sbjct: 61  QRGSGLGTLQQGDMISSMRSIKEDIFLTAYASYIVDLTDKSIEDKKPNPFLFELLYQTLN 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
                     +    E+ +L  +G    L +C V G T      S +  G +C      
Sbjct: 121 LINEGYDPEILTNIYEMKMLNALGLYPVLDQCSVCGSTDGHFAFSIRENGLICHRCLDK 179


>gi|114564091|ref|YP_751605.1| DNA repair protein RecO [Shewanella frigidimarina NCIMB 400]
 gi|114335384|gb|ABI72766.1| DNA repair protein RecO [Shewanella frigidimarina NCIMB 400]
          Length = 240

 Score = 99.5 bits (246), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 36/239 (15%), Positives = 71/239 (29%), Gaps = 15/239 (6%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVR-NGQSHRMQPILQAGNLVRVNWRSRLA- 63
              +L  R + E ++I+ ++    GR     R       ++ ILQ    + + + ++   
Sbjct: 6   RGYVLHHRQFRESSVIVNLLVEGVGRVDAITRVGSGKRSIKSILQPFQPLIIQFSAKSEA 65

Query: 64  -QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHK 122
                +   ++  +  A  LS +    G      L R L        L+   +  L    
Sbjct: 66  RNLGLKNITQIESAAPAMPLSGNSLYSGFYLNEILVRLLSVDHQAEGLFLDYHRALLALA 125

Query: 123 IPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGG-----AVCRSVGL 177
                  +    E+ LL  +G    L          +       +       A  +    
Sbjct: 126 KQFCSSHLR-YFEMALLLELGALPSLAYDTQGDSLDNRCHYRFIAESGFIPVATTQESPF 184

Query: 178 PYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENFLGK 235
            + +  L     L    Q +  +    A       L +Y L   + +   L R+ F  K
Sbjct: 185 SHGKGCLSGAMLLALASQNLQPEQFNQAKG-----LMRYLLTPLLGNKPLLSRQLFSNK 238


>gi|229543821|ref|ZP_04432880.1| DNA repair protein RecO [Bacillus coagulans 36D1]
 gi|229324960|gb|EEN90636.1| DNA repair protein RecO [Bacillus coagulans 36D1]
          Length = 255

 Score = 99.5 bits (246), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 32/176 (18%), Positives = 66/176 (37%), Gaps = 1/176 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M+ + + I++    YGE N IL + T+++G+     R  +    +    +      N+  
Sbjct: 1   MFEKCEGIVIKNTDYGESNKILHIYTKEFGKLGFMARGAKKPNSRLAAVSQVFTYGNFLF 60

Query: 61  RLAQNLGE-FRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLN 119
           + ++ L    + E +              Y    +  L R + +++    L+++L   L 
Sbjct: 61  QPSRGLATLQQGETVSPMRHIREDIFKTAYAAYVVELLGRAVEDKKKNPSLFELLLRTLE 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSV 175
                     I    E+ +L  +G    + KC V G T+     S +  G +C   
Sbjct: 121 YIDEGYDPEIIRDIFEMKMLNVLGMYPVMDKCAVCGNTEGPFAFSIRENGLLCPRC 176


>gi|91775219|ref|YP_544975.1| DNA repair protein RecO [Methylobacillus flagellatus KT]
 gi|91775363|ref|YP_545119.1| DNA repair protein RecO [Methylobacillus flagellatus KT]
 gi|91709206|gb|ABE49134.1| DNA repair protein RecO [Methylobacillus flagellatus KT]
 gi|91709350|gb|ABE49278.1| DNA replication and repair protein RecO [Methylobacillus
           flagellatus KT]
          Length = 244

 Score = 99.1 bits (245), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 35/234 (14%), Positives = 74/234 (31%), Gaps = 13/234 (5%)

Query: 8   IILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLAQN 65
            +L    + E ++++E+ +R++GR     +  +  R   + +LQA   ++  W  +    
Sbjct: 15  YVLHTYPFKETSLVVELFSREFGRVAAVAKGARRPRSAMRGMLQAFQPLQATWSGKAELK 74

Query: 66  LGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPS 125
                  +       LL     + G      L R LP  +    L+D  +  L       
Sbjct: 75  NLH---SMEWGAGLLLLRGEALMCGFYLNELLLRLLPREDGHDALFDYYSQTLRILAQDQ 131

Query: 126 -VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGG--AVCRSVGLPYAEK 182
             +     + EL +L+ +G+ + L         +     S  +    A       P    
Sbjct: 132 VPVATTLRRFELRMLQELGYAVPLEYDEAGNAIKPEHMYSYVAEQGAAPTSQHVAPPNGV 191

Query: 183 MLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENFLGK 235
            L   + L   +        +   +     L +  L H +       R+  +  
Sbjct: 192 QLSGKTLLAMAQDDYSDALTQQQSK----QLMRALLAHYLGDKPLHTRQLLMDL 241


>gi|126173441|ref|YP_001049590.1| DNA repair protein RecO [Shewanella baltica OS155]
 gi|125996646|gb|ABN60721.1| DNA repair protein RecO [Shewanella baltica OS155]
          Length = 236

 Score = 99.1 bits (245), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 37/232 (15%), Positives = 78/232 (33%), Gaps = 12/232 (5%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVR-NGQSHRMQPILQAGNLVRVNWRSRLAQ 64
              +L  R Y E ++++ ++    GR     R       ++ ILQ    +   +  +   
Sbjct: 3   RGYVLHHRPYRESSVLVNLLVDGIGRVDVVARTGSGKRSIKSILQPFQPLIFEFSGKSEL 62

Query: 65  NLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIP 124
                  +V  +  A  LS      G+     L R L  +    EL+ + +  L      
Sbjct: 63  KT---LTQVEAAAPAVPLSGQSLFAGMYINELLVRTLSVQHNAEELFLIYHQALVGLAAK 119

Query: 125 SVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKML 184
               ++   IEL LL+ +GF   L++            +  +    +   +G  +     
Sbjct: 120 FCQSQLR-YIELALLRELGFMPSLSRDTQGEP------LVAEDYYQLVPELGFQFVLNSR 172

Query: 185 VLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENFLGK 235
              ++       ++ + L     L+   L +  L+  +     L R+ F+  
Sbjct: 173 ARNAYQGAMLTALNDNQLIDVHFLSAKLLMRSLLKPLLGTKPLLSRQLFVSA 224


>gi|229129575|ref|ZP_04258545.1| DNA repair protein recO [Bacillus cereus BDRD-Cer4]
 gi|229152498|ref|ZP_04280690.1| DNA repair protein recO [Bacillus cereus m1550]
 gi|228631106|gb|EEK87743.1| DNA repair protein recO [Bacillus cereus m1550]
 gi|228653892|gb|EEL09760.1| DNA repair protein recO [Bacillus cereus BDRD-Cer4]
          Length = 252

 Score = 99.1 bits (245), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 26/179 (14%), Positives = 65/179 (36%), Gaps = 1/179 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M+ + + I++    YGE N I+ + +R+ G+     R  +  + +    +  +   ++  
Sbjct: 5   MFQKVEGIVIRTTDYGETNKIVTIFSRELGKVSAMARGSKKPKSRLASVSQLMTHGHFLI 64

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSI-VPLFRFLPEREPCLELYDMLNIFLN 119
           ++   LG  +   + S   ++            I     +   +++    L++ML   L+
Sbjct: 65  QMGSGLGTLQQGEIISTMKEIREDIFLTAYASFIVELTDKATEDKKHNPYLFEMLYQTLH 124

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
                     + +  +  +L  +G       C +     D +  S + GG +C      
Sbjct: 125 YMCEGVDPEVLSLIYQTKMLPVLGMRPYFDTCAICHQETDFVAFSVREGGFLCSRHAEQ 183


>gi|30022376|ref|NP_834007.1| DNA repair protein RecO [Bacillus cereus ATCC 14579]
 gi|218231111|ref|YP_002369105.1| DNA repair protein RecO [Bacillus cereus B4264]
 gi|42559457|sp|Q818G3|RECO_BACCR RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|226737856|sp|B7HCS2|RECO_BACC4 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|29897934|gb|AAP11208.1| DNA repair protein recO [Bacillus cereus ATCC 14579]
 gi|218159068|gb|ACK59060.1| recombination protein O [Bacillus cereus B4264]
          Length = 248

 Score = 99.1 bits (245), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 26/179 (14%), Positives = 65/179 (36%), Gaps = 1/179 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M+ + + I++    YGE N I+ + +R+ G+     R  +  + +    +  +   ++  
Sbjct: 1   MFQKVEGIVIRTTDYGETNKIVTIFSRELGKVSAMARGSKKPKSRLASVSQLMTHGHFLI 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSI-VPLFRFLPEREPCLELYDMLNIFLN 119
           ++   LG  +   + S   ++            I     +   +++    L++ML   L+
Sbjct: 61  QMGSGLGTLQQGEIISTMKEIREDIFLTAYASFIVELTDKATEDKKHNPYLFEMLYQTLH 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
                     + +  +  +L  +G       C +     D +  S + GG +C      
Sbjct: 121 YMCEGVDPEVLSLIYQTKMLPVLGMRPYFDTCAICHQETDFVAFSVREGGFLCSRHAEQ 179


>gi|171463194|ref|YP_001797307.1| DNA repair protein RecO [Polynucleobacter necessarius subsp.
           necessarius STIR1]
 gi|254764652|sp|B1XTL6|RECO_POLNS RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|171192732|gb|ACB43693.1| DNA repair protein RecO [Polynucleobacter necessarius subsp.
           necessarius STIR1]
          Length = 244

 Score = 99.1 bits (245), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 46/219 (21%), Positives = 80/219 (36%), Gaps = 12/219 (5%)

Query: 4   QDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQS--HRMQPILQAGNLVRVNWRSR 61
            + A +L    Y E ++IL+V TRQYGR     +  +     ++P+LQ    + V+W  +
Sbjct: 8   DEPAFVLHSIPYKETSLILDVFTRQYGRMALIAKGAKRQHSTLRPVLQRFQPLLVSWSGK 67

Query: 62  LAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCH 121
                   + E +    + +      L G      L +FL   +   +LYD     +N  
Sbjct: 68  SELRT-LTKSEWVGGMPSLVGD--ALLCGFYLNELLVKFLAREDDYEKLYDRYAETINAL 124

Query: 122 KIPSVI----GKIFVQIELMLLKNIGFGLDLTKCVVTGV---TQDLLWVSPKSGGAVCRS 174
                      +I  Q EL LL+  G+   L +CV        Q+     P+ G    + 
Sbjct: 125 SNLEFESKGLEEILRQFELSLLQETGYAAALDRCVENNEAPLAQEQYVYQPERGVRPVQV 184

Query: 175 VGLPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFL 213
               +   +              D ++L  + QL  + L
Sbjct: 185 DDPGHWPVLTGKSLLAIAISDFSDPETLSESKQLMRFLL 223


>gi|167463436|ref|ZP_02328525.1| DNA repair protein RecO [Paenibacillus larvae subsp. larvae
           BRL-230010]
 gi|322383676|ref|ZP_08057427.1| RecO-like protein [Paenibacillus larvae subsp. larvae B-3650]
 gi|321151888|gb|EFX44831.1| RecO-like protein [Paenibacillus larvae subsp. larvae B-3650]
          Length = 250

 Score = 98.7 bits (244), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 35/189 (18%), Positives = 72/189 (38%), Gaps = 2/189 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNW-R 59
           M ++ + IIL    YGE N I+ V+T+  G+     R  +  + +       L+   +  
Sbjct: 1   MLYRIEGIILRTVDYGEGNKIITVLTQA-GKVGLMARGAKKVKSRLSAVTQLLIYGEFVF 59

Query: 60  SRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLN 119
            + +        +++E +        L  Y    +  + + LPE E  + L++ L   L 
Sbjct: 60  FKQSGMGTLNHADIIEPYHRLREDIYLSAYASYLVEMVDKMLPEGEANIYLFEQLKSALK 119

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
             +       +    E+ +L + G+   +  CV  G     +  S   GG +C       
Sbjct: 120 TMEEGKDPQIVVHIFEMAMLASAGYSPVMDVCVSCGSVDGDMMFSSLMGGILCPGCTHKD 179

Query: 180 AEKMLVLPS 188
            +K+ +  +
Sbjct: 180 PQKIRISEN 188


>gi|298369997|ref|ZP_06981313.1| DNA repair protein RecO [Neisseria sp. oral taxon 014 str. F0314]
 gi|298281457|gb|EFI22946.1| DNA repair protein RecO [Neisseria sp. oral taxon 014 str. F0314]
          Length = 250

 Score = 98.7 bits (244), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 40/219 (18%), Positives = 68/219 (31%), Gaps = 9/219 (4%)

Query: 2   YWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWR 59
              + A +L    + E ++ LEV +R YGR     R+ +  +   + +L     +  +W 
Sbjct: 6   INHEPAFLLASVPWRESSLRLEVFSRSYGRVALLARSARKRQSELRGVLVPFVPMSASWY 65

Query: 60  SRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLN 119
                                         GL     + R     +P  ELYD L   L 
Sbjct: 66  GSGELKTLH---RAEWLGGWPQPQGRALFSGLYVNELVLRLTAREDPQPELYDALQDVLQ 122

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                        + E  LL ++G+  DL +               +   AV        
Sbjct: 123 TLCRQPNHAGALRRFEWKLLDSLGYAPDLQRDGNGDPVDAGRRYLVRPEEAVMPLEQDDV 182

Query: 180 ---AEKMLVLPSFLWKEEQTIDADS-LKSAFQLTDYFLN 214
              AE  +   + L   +   D+   L+ A Q+T   L+
Sbjct: 183 RTAAEVAVDGGTLLQLRQGKFDSGEGLQQALQITRLLLD 221


>gi|332975247|gb|EGK12147.1| recombination protein O [Kingella kingae ATCC 23330]
          Length = 242

 Score = 98.7 bits (244), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 33/231 (14%), Positives = 76/231 (32%), Gaps = 15/231 (6%)

Query: 8   IILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLAQN 65
            +L  + + E ++ LEV ++ YGR     R+ ++     + +L     + V+W  +  + 
Sbjct: 11  FVLSSKPWRETSLWLEVFSQNYGRVALLARSARTRGSELRGVLVPFVPISVSWFGK-EEL 69

Query: 66  LGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPS 125
               R E L         +      + +   + +     +P   +Y  L   +      +
Sbjct: 70  KTIHRAEWLGGWAQ--PKNRALFSAMYANELVLKLTVREDPNPAIYQALQQLMQQIAQAT 127

Query: 126 VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWV---SPKSGGAVCRSVGLPYAEK 182
                    E  LL  +G+  D              +    +  +  A+  S  +   + 
Sbjct: 128 SHTAALRYFEWQLLNALGYAPDTQTDQHGNAIIADAYYLLRAEHAAQAIEPSQAVLSPDS 187

Query: 183 MLVLPSFL-WKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENF 232
            L+  + L   ++ ++  + L SA  L         L  + +     R+  
Sbjct: 188 CLIQGNVLHALQQSSLQPNQLNSALAL------NRVLIQHHVPHIASRQVL 232


>gi|85712958|ref|ZP_01043997.1| Recombinational DNA repair protein, RecO, RecF pathway [Idiomarina
           baltica OS145]
 gi|85693196|gb|EAQ31155.1| Recombinational DNA repair protein, RecO, RecF pathway [Idiomarina
           baltica OS145]
          Length = 228

 Score = 98.7 bits (244), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 37/238 (15%), Positives = 67/238 (28%), Gaps = 18/238 (7%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNW 58
           M     A +L    Y E +++++  + + GR     +  +      + +LQ    + V W
Sbjct: 1   MQ---PAFVLHRWDYQETSLLVDCFSLEDGRVRLLAKGAKRKTSSWKGVLQPFIPLNVQW 57

Query: 59  RSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFL 118
             R           +  ++    L S     G      L R LP+      L++     L
Sbjct: 58  GGRGELKTLTHAEAMSHNY---ELRSDFLYSGFYINELLQRVLPQHVAVPSLFECYPQLL 114

Query: 119 NCHKIPSVIGKIFVQIELMLLKNIG---FGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSV 175
                   I       E  LL  +G       L +      T      S  S        
Sbjct: 115 QRLADKQPIETTLRWFEWQLLDELGSVFEWPQLEQRNELPETLYFRSYSGFSVDYHDSDC 174

Query: 176 GLPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENF 232
                ++ + L    W     +      +  ++      ++AL   I       R  F
Sbjct: 175 VTISRDEAIALGQSDWLN-DPLTESQRYNLKRI-----MRHALAPFIGDKPLRARALF 226


>gi|110834490|ref|YP_693349.1| DNA repair protein RecO [Alcanivorax borkumensis SK2]
 gi|110647601|emb|CAL17077.1| DNA repair protein RecO [Alcanivorax borkumensis SK2]
          Length = 225

 Score = 98.7 bits (244), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 38/227 (16%), Positives = 70/227 (30%), Gaps = 16/227 (7%)

Query: 7   AIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQNL 66
           A ++  R +   ++ +++     GR    VR G+     P+L     + V  +       
Sbjct: 11  AWLIHRRPFRNTSLTVDLFLPNLGRVGAVVRGGRK---DPLLAPFTPLWVELKPSGD--- 64

Query: 67  GEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPSV 126
                         LLS      G      L R L   +P   ++ +    L+       
Sbjct: 65  MYSLRACEPRGNRLLLSGKALYCGFYLNELLTRLLHRDDPNPAIWPLYEQALSDLLTDIP 124

Query: 127 IGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKMLVL 186
           +     Q EL  L+ IG+G+ L + V     +            + R+   P      V 
Sbjct: 125 LDITLRQFELAALEEIGYGIALDQDVHGQELEADARYQLNPEQGLVRTEAAP----SYVG 180

Query: 187 PSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENF 232
              L          + K+A  +      +  L  ++ +     RE F
Sbjct: 181 ADLLAICGGNWHPTARKAALNVC-----RQMLAPHLGNRPLKSRELF 222


>gi|294669325|ref|ZP_06734404.1| DNA repair protein RecO [Neisseria elongata subsp. glycolytica ATCC
           29315]
 gi|291308735|gb|EFE49978.1| DNA repair protein RecO [Neisseria elongata subsp. glycolytica ATCC
           29315]
          Length = 244

 Score = 98.7 bits (244), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 35/212 (16%), Positives = 65/212 (30%), Gaps = 8/212 (3%)

Query: 8   IILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLAQN 65
            +L    + E ++ LEV +R+YGR     R+ +  +   + IL     +  +W       
Sbjct: 14  FLLNAVPWRESSLRLEVFSRRYGRVALLARSARKRQSELRGILVPFVPIDASWYGNTELK 73

Query: 66  LGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPS 125
                                   GL     +++     +P  +LYD L          +
Sbjct: 74  TLH---RAEWLGGWSQPQGRALFSGLYLNELVWKLTAREDPHPKLYDALAEAHREICTRN 130

Query: 126 VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKMLV 185
                  + E  LL  +G+  DL         Q       ++  A       P     + 
Sbjct: 131 NHVAALRRFEWRLLTELGYAPDLLHDADGAAVQAEKQYLLQAEQAPLLLASAPNNANGIT 190

Query: 186 LP---SFLWKEEQTIDADSLKSAFQLTDYFLN 214
                       +  + +SL+ A Q+T   L+
Sbjct: 191 ANGSTLLQLHAGRFDNGESLQQALQITRMLLD 222


>gi|217974267|ref|YP_002359018.1| DNA repair protein RecO [Shewanella baltica OS223]
 gi|304409364|ref|ZP_07390984.1| DNA repair protein RecO [Shewanella baltica OS183]
 gi|307303722|ref|ZP_07583475.1| DNA repair protein RecO [Shewanella baltica BA175]
 gi|217499402|gb|ACK47595.1| DNA repair protein RecO [Shewanella baltica OS223]
 gi|304351882|gb|EFM16280.1| DNA repair protein RecO [Shewanella baltica OS183]
 gi|306912620|gb|EFN43043.1| DNA repair protein RecO [Shewanella baltica BA175]
          Length = 236

 Score = 98.7 bits (244), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 37/232 (15%), Positives = 78/232 (33%), Gaps = 12/232 (5%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVR-NGQSHRMQPILQAGNLVRVNWRSRLAQ 64
              +L  R Y E ++++ ++    GR     R       ++ ILQ    +   +  +   
Sbjct: 3   RGYVLHHRPYRESSVLVNLLVDGIGRVDVVARTGSGKRSIKSILQPFQPLIFEFSGKSEL 62

Query: 65  NLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIP 124
                  +V  +  A  LS      G+     L R L  +    EL+ + +  L      
Sbjct: 63  KT---LTQVEAAAPAVPLSGQSLFAGMYINELLVRTLSVQHNAEELFLIYHQALVGLAAK 119

Query: 125 SVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKML 184
               ++   IEL LL+ +GF   L++            +  +    +   +G  +     
Sbjct: 120 FCQSQLR-YIELALLRELGFMPSLSRDTQGEP------LVAEDYYQLVPELGFQFVLNSR 172

Query: 185 VLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENFLGK 235
              ++       ++ + L     L+   L +  L+  +     L R+ F+  
Sbjct: 173 ARNAYQGAMLTALNDNQLTDVHFLSAKLLMRSLLKPLLGTKPLLSRQLFVSA 224


>gi|302878422|ref|YP_003846986.1| DNA repair protein RecO [Gallionella capsiferriformans ES-2]
 gi|302581211|gb|ADL55222.1| DNA repair protein RecO [Gallionella capsiferriformans ES-2]
          Length = 241

 Score = 98.3 bits (243), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 30/156 (19%), Positives = 58/156 (37%), Gaps = 6/156 (3%)

Query: 4   QDD-AIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRS 60
           QD+ A +L    + E +++L+V +R+YGR     R  +  R   + +L +   +R++W  
Sbjct: 9   QDELAFVLHCHPFRETSLLLDVYSREYGRMAIVARGARRPRSALRGVLMSFQPLRLSWFG 68

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           +                    L  +  + G      L   L   +   +L+D     L  
Sbjct: 69  KGEVRTLH---SAEWQGGQPYLQGTALMCGFYLNELLINLLARDDAHEQLFDYYRATLYR 125

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGV 156
               +         E  LL+ +G+ L+L     +G 
Sbjct: 126 LAHETDHAATLRCFEKHLLQELGYALNLETEAASGS 161


>gi|260903905|ref|ZP_05912227.1| DNA repair protein RecO [Brevibacterium linens BL2]
          Length = 242

 Score = 98.3 bits (243), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 33/231 (14%), Positives = 70/231 (30%), Gaps = 15/231 (6%)

Query: 2   YWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQ--PILQAGNLVRVNWR 59
            ++D+ I+L     GE + I+ V+TR +G      +  +  + +    L+   LV +   
Sbjct: 3   NYRDEGIVLQGHKLGEADRIVTVLTRSHGLIRAVAKGIRRTKSRFGSRLEPFMLVDLQCH 62

Query: 60  SRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLN 119
              + ++      +             +           R           + +L   + 
Sbjct: 63  VGRSLDIVTQVELIEPFARGIGADYDAYSAASVMAETAARITEVEPQSRTHFLLLVSAIR 122

Query: 120 CHKIPSVIGKIF-VQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSV--- 175
                    ++      L  +   G+   L  C   G        S   GGAVC +    
Sbjct: 123 SLCNGEHPPRLALDAYLLRAMSVAGWAPSLLDCAQCGSPGPHRAFSASLGGAVCTTCRPS 182

Query: 176 --GLPYAEKMLVLPSFL---WKEEQTIDADSLKSAFQLTDYF----LNKYA 217
              LP  + +  + + L   W+  ++ D        +L   +    L +  
Sbjct: 183 GAALPDTDALEHMAALLSGDWERAESSDLHDQIDGSKLVSDWVSWHLERNI 233


>gi|119944414|ref|YP_942094.1| DNA repair protein RecO [Psychromonas ingrahamii 37]
 gi|166221907|sp|A1SSN0|RECO_PSYIN RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|119863018|gb|ABM02495.1| DNA replication and repair protein RecO [Psychromonas ingrahamii
           37]
          Length = 233

 Score = 98.3 bits (243), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 31/230 (13%), Positives = 75/230 (32%), Gaps = 11/230 (4%)

Query: 7   AIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNWRSRLAQ 64
           A IL  R Y E + ++++  +  G+     + G+S     +   Q   L++V++  R + 
Sbjct: 8   AFILHRRPYRETSQLIDLFCQDVGKVSLVYKGGRSSTRMRRGTAQPFTLLQVSYFGRGSL 67

Query: 65  NLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIP 124
              +      +      L        +     L+R L     C  L++     L      
Sbjct: 68  KTVKSFEAQTQVVP---LVGQRLFLAMYINELLYRLLQAETACDGLFECYQQTLLAIAGA 124

Query: 125 SVIGKIFVQIELMLLKNIGFGLDLTKCVVTGV-TQDLLWVSPKSGGAVCRSVGLPYAEKM 183
                     EL L++ +G+G++ ++ + +G   +       +          +     +
Sbjct: 125 VDPQIALRLFELTLIETLGYGVNFSEDIYSGELIESGYEYQYQHQAGFFAKQAIHKQHDV 184

Query: 184 LVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENF 232
                 L   ++     ++  + +       + AL + +       R  F
Sbjct: 185 YSGQDILALAQRDFSNQNVLKSAKRFC----RQALANLLGGKPLHSRALF 230


>gi|108760610|ref|YP_631289.1| DNA repair protein RecO [Myxococcus xanthus DK 1622]
 gi|119361467|sp|Q1D7T4|RECO_MYXXD RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|108464490|gb|ABF89675.1| DNA repair protein RecO [Myxococcus xanthus DK 1622]
          Length = 244

 Score = 98.3 bits (243), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 36/178 (20%), Positives = 66/178 (37%), Gaps = 3/178 (1%)

Query: 2   YWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQ--PILQAGNLVRVNWR 59
            + DDA++L    YGE + ++ ++TR++G+   F    +  + +    L+    +RV+  
Sbjct: 3   RYDDDALVLSSVDYGESDRLVTLLTREHGKLTAFAAGARKSKRRFAGALEPFMRLRVHIV 62

Query: 60  SRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLN 119
                 +     +++    A     SL    L ++        + EP  EL+ +L  +L 
Sbjct: 63  ETRGSTVRLDGTDIVAGFYAAREDLSLIARALYAVELCRELTRDHEPQPELFALLESYLT 122

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLL-WVSPKSGGAVCRSVG 176
                       +  EL  L + G       C + G             GGAVC   G
Sbjct: 123 RLDAKEAGPTSLLAFELSALAHAGLMPRFDSCSLCGGAPGERPRFDQAHGGAVCEPCG 180


>gi|161511021|ref|NP_980671.2| DNA repair protein RecO [Bacillus cereus ATCC 10987]
 gi|61215101|sp|Q730N8|RECO_BACC1 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
          Length = 248

 Score = 98.3 bits (243), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 26/179 (14%), Positives = 63/179 (35%), Gaps = 1/179 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M+ + + I++    YGE N I+ + +R+ G+     R  +  + +    +  +   ++  
Sbjct: 1   MFQKVEGIVIRTTDYGETNKIVTIFSRELGKVSAMARGAKXPKSRLASVSQLMTHGHFLI 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSI-VPLFRFLPEREPCLELYDMLNIFLN 119
           ++   LG  +   + S   +             I     +   ++     L++ML   L+
Sbjct: 61  QMGSGLGTLQQGEIISTMKEFREDIFLTAYASFIXELTDKQXXDKXHNPYLFEMLYQTLH 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
                     + +  +  +L  +G       C +     D +  S + GG +C      
Sbjct: 121 YMCEGVDPEVLSLIYQTKMLPVLGMRPYFDTCAICHQETDFVAFSVREGGFLCSRHAEQ 179


>gi|160874399|ref|YP_001553715.1| DNA repair protein RecO [Shewanella baltica OS195]
 gi|160859921|gb|ABX48455.1| DNA repair protein RecO [Shewanella baltica OS195]
 gi|315266634|gb|ADT93487.1| DNA repair protein RecO [Shewanella baltica OS678]
          Length = 236

 Score = 98.3 bits (243), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 36/232 (15%), Positives = 78/232 (33%), Gaps = 12/232 (5%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVR-NGQSHRMQPILQAGNLVRVNWRSRLAQ 64
              +L  R Y E ++++ ++    GR     R       ++ ILQ    +   +  +   
Sbjct: 3   RGYVLHHRPYRESSVLVNLLVDGIGRVDVVARTGSGKRSIKSILQPFQPLIFEFSGKSEL 62

Query: 65  NLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIP 124
                  ++  +  A  LS      G+     L R L  +    EL+ + +  L      
Sbjct: 63  KT---LTQIEAAAPAVPLSGQSLFAGMYINELLVRTLSVQHNAEELFLIYHQALVGLAAK 119

Query: 125 SVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKML 184
               ++   IEL LL+ +GF   L++            +  +    +   +G  +     
Sbjct: 120 FCQSQLR-YIELALLRELGFMPSLSRDTQGEP------LVAEDYYQLVPELGFQFVLNSR 172

Query: 185 VLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENFLGK 235
              ++       ++ + L     L+   L +  L+  +     L R+ F+  
Sbjct: 173 ARNAYQGAMLTALNDNQLTDVHFLSAKLLMRSLLKPLLGTKPLLSRQLFVSA 224


>gi|294501285|ref|YP_003564985.1| DNA repair protein RecO [Bacillus megaterium QM B1551]
 gi|294351222|gb|ADE71551.1| DNA repair protein RecO [Bacillus megaterium QM B1551]
          Length = 254

 Score = 98.3 bits (243), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 35/205 (17%), Positives = 73/205 (35%), Gaps = 3/205 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M+ + + I++    YGE N I+ + +R+ G+     R  +    +            +  
Sbjct: 1   MFKKCEGIVIRTNDYGESNKIVTIYSRELGKVGLMARGAKKPSSRLASVTQLFTYGYFFI 60

Query: 61  RLAQNLGE-FRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLN 119
           +    +G   + EV+ S  +         Y    +    +     +P   L+++L+  ++
Sbjct: 61  QAGSGMGTLHQGEVISSMRSIREDIFTTAYASYILELTDKATENNKPNPFLFELLHQTIH 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSV--GL 177
                     +    E+ +L  +G    L +C V    +     S + GG +C       
Sbjct: 121 YMNEEYDAEILTFIYEMKMLNVLGLHPTLNECAVCHQGEGTFHFSIREGGFICHRCLEKD 180

Query: 178 PYAEKMLVLPSFLWKEEQTIDADSL 202
           PY  K+  +   L +    ID   L
Sbjct: 181 PYHLKISPMTVKLLRLFYYIDLKRL 205


>gi|42739353|gb|AAS43279.1| recombination protein O [Bacillus cereus ATCC 10987]
          Length = 257

 Score = 98.3 bits (243), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 26/179 (14%), Positives = 63/179 (35%), Gaps = 1/179 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M+ + + I++    YGE N I+ + +R+ G+     R  +  + +    +  +   ++  
Sbjct: 10  MFQKVEGIVIRTTDYGETNKIVTIFSRELGKVSAMARGAKXPKSRLASVSQLMTHGHFLI 69

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSI-VPLFRFLPEREPCLELYDMLNIFLN 119
           ++   LG  +   + S   +             I     +   ++     L++ML   L+
Sbjct: 70  QMGSGLGTLQQGEIISTMKEFREDIFLTAYASFIXELTDKQXXDKXHNPYLFEMLYQTLH 129

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
                     + +  +  +L  +G       C +     D +  S + GG +C      
Sbjct: 130 YMCEGVDPEVLSLIYQTKMLPVLGMRPYFDTCAICHQETDFVAFSVREGGFLCSRHAEQ 188


>gi|40063416|gb|AAR38227.1| DNA repair protein RecO [uncultured marine bacterium 580]
          Length = 236

 Score = 98.0 bits (242), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 33/231 (14%), Positives = 74/231 (32%), Gaps = 13/231 (5%)

Query: 8   IILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLAQN 65
            +L    + E ++I+E+ ++ +GR     +  +  +   + +LQ+   +  +W       
Sbjct: 14  YVLHTYPFKETSLIVEIFSKAFGRVSLVAKGARRPKSALRGMLQSFQALEASWSGIGELK 73

Query: 66  LGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPS 125
                    +      +  +  + G      L R LP+ +    L+D  +  +       
Sbjct: 74  TLHGIDWCDQYLP---MEGNSLICGFYLNELLLRLLPKEDNYESLFDFYHTTMENLSQGV 130

Query: 126 VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKMLV 185
            IG    + EL LL  +G+ + L         +       ++            + K++ 
Sbjct: 131 NIGVTLRRFELKLLLELGYEVVLKVDANANEIKADKTYYYEAEQGALEKFRTEKSIKVIG 190

Query: 186 LPSFLWKEEQTIDADSLKSAFQLTDYFLNKYAL--QHNIIHCHLLRENFLG 234
                        A +   +  L   FL  Y L  +         ++ FL 
Sbjct: 191 QTLIDMGNNNFDSATTELQSKNLMR-FLINYYLGDKPLN-----SKQLFLN 235


>gi|161511220|ref|NP_826805.2| DNA repair protein RecO [Streptomyces avermitilis MA-4680]
 gi|119370512|sp|Q82BS6|RECO_STRAW RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
          Length = 248

 Score = 98.0 bits (242), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 37/211 (17%), Positives = 83/211 (39%), Gaps = 14/211 (6%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQ--PILQAGNLVRVNWRS 60
           ++DD I+L  +  GE + I+ ++TR +GR     R  +  + +    L+  + V V + S
Sbjct: 4   FRDDGIVLRTQKLGEADRIITLLTRGHGRVRAVARGVRRTKSKFGARLEPFSHVDVQFFS 63

Query: 61  RLAQNLG-----EFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLEL--YDM 113
           R ++ +G       + E +  +   +++         +++       + E    +  Y +
Sbjct: 64  RGSELIGRGLPLCTQSETIAPYGGAIVTDYARYTAGTAMLETAERFTDHEGEPAVQQYLL 123

Query: 114 LNIFLNCHKIPSVIGKIFVQIELMLLKNI---GFGLDLTKCVVTGVTQDLLWVSPKSGGA 170
           L   L           +   ++  LL+++   G+    + C   G+     + S  +GG+
Sbjct: 124 LVGGLRTLARGEHEPHLV--LDAFLLRSLAVNGYAPSFSNCAKCGMPGPNRFFSVAAGGS 181

Query: 171 VCRSVGLPYAEKMLVLPSFLWKEEQTIDADS 201
           VC    +P +         L     T D ++
Sbjct: 182 VCVDCRVPGSVVPSAQALVLLGALLTGDWET 212


>gi|29609289|dbj|BAC73340.1| putative DNA recombination and repair protein [Streptomyces
           avermitilis MA-4680]
          Length = 251

 Score = 98.0 bits (242), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 37/211 (17%), Positives = 83/211 (39%), Gaps = 14/211 (6%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQ--PILQAGNLVRVNWRS 60
           ++DD I+L  +  GE + I+ ++TR +GR     R  +  + +    L+  + V V + S
Sbjct: 7   FRDDGIVLRTQKLGEADRIITLLTRGHGRVRAVARGVRRTKSKFGARLEPFSHVDVQFFS 66

Query: 61  RLAQNLG-----EFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLEL--YDM 113
           R ++ +G       + E +  +   +++         +++       + E    +  Y +
Sbjct: 67  RGSELIGRGLPLCTQSETIAPYGGAIVTDYARYTAGTAMLETAERFTDHEGEPAVQQYLL 126

Query: 114 LNIFLNCHKIPSVIGKIFVQIELMLLKNI---GFGLDLTKCVVTGVTQDLLWVSPKSGGA 170
           L   L           +   ++  LL+++   G+    + C   G+     + S  +GG+
Sbjct: 127 LVGGLRTLARGEHEPHLV--LDAFLLRSLAVNGYAPSFSNCAKCGMPGPNRFFSVAAGGS 184

Query: 171 VCRSVGLPYAEKMLVLPSFLWKEEQTIDADS 201
           VC    +P +         L     T D ++
Sbjct: 185 VCVDCRVPGSVVPSAQALVLLGALLTGDWET 215


>gi|261380742|ref|ZP_05985315.1| DNA repair protein RecO [Neisseria subflava NJ9703]
 gi|284796460|gb|EFC51807.1| DNA repair protein RecO [Neisseria subflava NJ9703]
          Length = 247

 Score = 97.6 bits (241), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 37/233 (15%), Positives = 68/233 (29%), Gaps = 16/233 (6%)

Query: 8   IILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLAQN 65
            +L    + E ++ +E  +R+YGR     R+ +  +   + +L     V  +W       
Sbjct: 13  FLLASAPWRESSLWVEAFSRRYGRVALLARSARKRQSELRGVLVPFVPVSASWYGSQELK 72

Query: 66  LGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPS 125
                                   GL     + +     +P  ELYD+L   +      +
Sbjct: 73  TLH---RAEWIGGWPQPQGRALFSGLYVNELMLKLTVREDPLPELYDVLAKTMKTICCEA 129

Query: 126 VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKMLV 185
                  + E  LL  +GF  DL                     AV           +  
Sbjct: 130 NHIATLRRFEWSLLTRLGFAPDLFHDGNGNEINGEETYWLTPEEAVVPLAEADRFHALNK 189

Query: 186 LPSFL------WKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENF 232
             + L       +E   +  +SL  A ++T   ++   L    I     R+  
Sbjct: 190 GVAVLGATLIDLREGSFVHQESLGQALKVTRLLIDN--LLPEGI---KSRQVL 237


>gi|127511989|ref|YP_001093186.1| DNA repair protein RecO [Shewanella loihica PV-4]
 gi|126637284|gb|ABO22927.1| DNA repair protein RecO [Shewanella loihica PV-4]
          Length = 231

 Score = 97.6 bits (241), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 38/231 (16%), Positives = 66/231 (28%), Gaps = 13/231 (5%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVR-NGQSHRMQPILQAGNLVRVNWRSRLAQ 64
              +L  R Y E ++++ ++    GR     R       ++ ILQ    +      R + 
Sbjct: 3   RGYVLHTRPYRESSVLVNLLVDGLGRVDAVARLGSGKTSIKSILQPFQPLLFQLSGRSSL 62

Query: 65  NLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIP 124
                      +  A  LS +    G      L R L       + +   +  L      
Sbjct: 63  KSLYQVEA---ASPAVPLSGNDSFAGFYLNELLVRCLSVEHGAEQFFFTYHKTLMAMAAA 119

Query: 125 SVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKML 184
               ++    EL LLK +G    L   +     +   +    S      ++G        
Sbjct: 120 FSEAQLRQ-FELSLLKELGVMPSLNLDIEGSPIETDFYYRLLSEEGFSTALGPKPNHFSG 178

Query: 185 VLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENFLG 234
            +   L  EE  +     K A       L +  L   +       R  FL 
Sbjct: 179 EMLRAL--EEDRLTEADFKQAK-----LLMRQLLSPLLGDKPLKSRALFLK 222


>gi|302545505|ref|ZP_07297847.1| DNA repair protein RecO [Streptomyces hygroscopicus ATCC 53653]
 gi|302463123|gb|EFL26216.1| DNA repair protein RecO [Streptomyces himastatinicus ATCC 53653]
          Length = 248

 Score = 97.6 bits (241), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 33/190 (17%), Positives = 76/190 (40%), Gaps = 14/190 (7%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQ--PILQAGNLVRVNWRS 60
           ++DD I+L  +  GE + I+ ++TR +GR     R  +  + +    L+  + V V + +
Sbjct: 4   FRDDGIVLRTQKLGEADRIITLLTRNHGRVRAVARGVRRTKSKFGARLEPFSHVDVQFFA 63

Query: 61  RLAQNLG-----EFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLEL--YDM 113
           R  + +G       + E +  +   +++         +++       + E    +  Y +
Sbjct: 64  RGGELIGRGLPLCTQSETIAPYGGGIVTDYARYTAGTAMLETAERFTDHEGEPAVQQYLL 123

Query: 114 LNIFLNCHKIPSVIGKIFVQIELMLLKNI---GFGLDLTKCVVTGVTQDLLWVSPKSGGA 170
           L   L           +   ++  LL+++   G+      C   G+     + S  +GGA
Sbjct: 124 LVGGLRTLASGEHEPHL--ILDAFLLRSLAVNGYAPSFDDCAKCGMPGPNRFFSVGAGGA 181

Query: 171 VCRSVGLPYA 180
           +C    +P +
Sbjct: 182 ICGECRVPGS 191


>gi|295706632|ref|YP_003599707.1| DNA repair protein RecO [Bacillus megaterium DSM 319]
 gi|294804291|gb|ADF41357.1| DNA repair protein RecO [Bacillus megaterium DSM 319]
          Length = 254

 Score = 97.6 bits (241), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 35/205 (17%), Positives = 72/205 (35%), Gaps = 3/205 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M+ + + I++    YGE N I+ + +R+ G+     R  +    +            +  
Sbjct: 1   MFKKCEGIVIRTNDYGESNKIVTIYSRELGKVGLMARGAKKPSSRLASVTQLFTYGYFFI 60

Query: 61  RLAQNLGE-FRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLN 119
           +    +G   + EV+ S  +         Y    +    +     +P   L+++L   ++
Sbjct: 61  QAGSGMGTLHQGEVISSMRSIREDIFTTAYASYILELTDKATENNKPNPFLFELLYQTIH 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSV--GL 177
                     +    E+ +L  +G    L +C V    +     S + GG +C       
Sbjct: 121 YMNEEYDAEILTFIYEMKMLNVLGLHPTLNECAVCHRGEGTFHFSIREGGFICHRCLEKD 180

Query: 178 PYAEKMLVLPSFLWKEEQTIDADSL 202
           PY  K+  +   L +    ID   L
Sbjct: 181 PYHLKISPMTVKLLRLFYYIDLKRL 205


>gi|237746714|ref|ZP_04577194.1| RecO DNA repair protein [Oxalobacter formigenes HOxBLS]
 gi|229378065|gb|EEO28156.1| RecO DNA repair protein [Oxalobacter formigenes HOxBLS]
          Length = 277

 Score = 97.6 bits (241), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 39/234 (16%), Positives = 72/234 (30%), Gaps = 12/234 (5%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQS--HRMQPILQAGNLVRVNWRSRLA 63
              +L    Y E ++++EV TR YGR     +  +    R++ +LQ    + + W  +  
Sbjct: 49  PGFVLHSYVYRESSLVVEVFTRDYGRVALVAKGAKRPTSRLRGVLQTFQPLSIGWSGKSE 108

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKI 123
                             L +S  LYG      L + L   +P   L++     L     
Sbjct: 109 LRT---LTSAEWVGGMIPLENSALLYGFYLNELLLKLLAREDPHQGLFEHYVRALARLAT 165

Query: 124 PSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGV-TQDLLWVSPKSGGAVCRSVGLPYAEK 182
                 +    EL LLK  G   D +  +      +               +     A +
Sbjct: 166 AESAQTVLRIFELALLKETGVASDFSVNIQDRSPVEPDGIYVVDPESGPRPATLGDTAPR 225

Query: 183 MLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLL-RENFLGK 235
           +          E   D  +   +       L ++ L H++    L  R+  +  
Sbjct: 226 VSGKTLLDMVREDYADPQTQLQSKH-----LMRFLLAHHLDGVPLQTRKILIDL 274


>gi|254429213|ref|ZP_05042920.1| DNA repair protein RecO [Alcanivorax sp. DG881]
 gi|196195382|gb|EDX90341.1| DNA repair protein RecO [Alcanivorax sp. DG881]
          Length = 225

 Score = 97.6 bits (241), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 35/230 (15%), Positives = 70/230 (30%), Gaps = 16/230 (6%)

Query: 7   AIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQNL 66
           A ++  R +   ++ +++     GR    VR G+     P+L     + V  +       
Sbjct: 11  AWLIHRRPFRNTSLTVDLFLPALGRIGAVVRGGRK---DPLLAPFTPLWVALKPSGE--- 64

Query: 67  GEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPSV 126
                         +L+      G      L R L   +P   ++ +    L+  +  + 
Sbjct: 65  MYSLRACEPRGNRLMLTGKALYCGFYLNELLTRLLHRDDPNPSVWPLYEQALSDLQTQTP 124

Query: 127 IGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKMLVL 186
                 Q EL +L+ IG+G+ L + V                  +               
Sbjct: 125 FDITLRQFELAVLEQIGYGIALDQDVHGHGLDPEALYQLNPEQGL----AKTETGGGYAG 180

Query: 187 PSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENFLGK 235
              L   +      S ++A  L      ++ L  ++ +     RE F  K
Sbjct: 181 ADLLAIAQGDWHPASRRAALSLC-----RHLLAPHLGNRPLKSRELFREK 225


>gi|170718281|ref|YP_001785298.1| DNA repair protein RecO [Haemophilus somnus 2336]
 gi|168826410|gb|ACA31781.1| DNA repair protein RecO [Haemophilus somnus 2336]
          Length = 217

 Score = 97.6 bits (241), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 36/221 (16%), Positives = 71/221 (32%), Gaps = 10/221 (4%)

Query: 20  IILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLAQNLGEFRFEVLESH 77
           +++E+ T ++GR     +  ++ R   + +LQ    + +NW  R          +     
Sbjct: 1   MLVELFTEEHGRLTVLAKGARAKRSAWKSLLQPFTPLLLNWSGRGELK---ILIKAEAIS 57

Query: 78  CAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHK-IPSVIGKIFVQIEL 136
               L ++    G      + R L       +L+      L      P  I K     E 
Sbjct: 58  LTLPLQTTALYSGFYVNELIARLLAPETAYPDLFQYYLQCLTALASSPQEIEKSLRTFEF 117

Query: 137 MLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKMLVLPSFLWKEEQT 196
            LL+ +G+ +D   C  +G   D              +  +             ++  + 
Sbjct: 118 QLLEVLGYAVDFCHCAGSGKPVDEKMTYRYREEKGFIASLIKDNLTFYGRELLAFERREF 177

Query: 197 IDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLL 237
           +D   L++A + +   L  Y            RE F   +L
Sbjct: 178 VDKTVLQAAKRFSRIALKYYL---GNKPL-KSRELFTQNIL 214


>gi|315645985|ref|ZP_07899106.1| DNA repair protein RecO [Paenibacillus vortex V453]
 gi|315278746|gb|EFU42060.1| DNA repair protein RecO [Paenibacillus vortex V453]
          Length = 262

 Score = 97.6 bits (241), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 30/159 (18%), Positives = 58/159 (36%), Gaps = 2/159 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQ--PILQAGNLVRVNW 58
           M ++ + I++    YGE N I+ + T++ G+    VR  +  + +   + Q        +
Sbjct: 12  MLYRAEGIVIRSMDYGEGNKIITLCTKESGKVGVLVRGAKKVKSRHAALTQLFTYGEYVF 71

Query: 59  RSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFL 118
                        E++ESH           Y   +   L R L + E     +  L   +
Sbjct: 72  FRNGTGLGNLNAGEIMESHHRLREDLVKAAYASYACELLDRVLQDEETGAFWFHQLKACM 131

Query: 119 NCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVT 157
              +       I    E+ +L+  G+G +L  C+    T
Sbjct: 132 EALQEDKDPQIIINLYEMKILQAAGYGPELDVCISCNQT 170


>gi|311031642|ref|ZP_07709732.1| DNA repair protein RecO [Bacillus sp. m3-13]
          Length = 258

 Score = 97.6 bits (241), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 38/207 (18%), Positives = 75/207 (36%), Gaps = 3/207 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M  + + I++   +YGE N I+ + +++ G+     R       +    +       +  
Sbjct: 1   MLHKCEGIVIRTNAYGENNKIVTIYSKELGKVGVMARGANKPSSRFTAVSQLFSHATFVF 60

Query: 61  RLAQNLGEFRFEVL-ESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLN 119
           + +  LG  +   + +S  +      L  Y    +  + R   E +    LYD+L   L+
Sbjct: 61  QRSTGLGSLQQGEIMDSMRSIREDIFLTAYASFIVELMDRTTDEGKRNPALYDLLYQVLH 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSV--GL 177
                     +    E+ +   IG   +L +C   G T+     S K GG +C       
Sbjct: 121 YINDGFDAEILTFIFEMKMCDVIGITPELNRCASCGATEGSFAFSIKEGGFLCNRCFHKD 180

Query: 178 PYAEKMLVLPSFLWKEEQTIDADSLKS 204
           PY  K+      L +     D + + +
Sbjct: 181 PYLIKVSPATLRLLRTFYYYDLNRIGN 207


>gi|88608141|ref|YP_506346.1| putative DNA repair protein RecO [Neorickettsia sennetsu str.
           Miyayama]
 gi|88600310|gb|ABD45778.1| putative DNA repair protein RecO [Neorickettsia sennetsu str.
           Miyayama]
          Length = 237

 Score = 97.6 bits (241), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 64/206 (31%), Positives = 102/206 (49%), Gaps = 8/206 (3%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+++ I+L  +   E   +  + T+ YG   G          +  +  GN+V   W  
Sbjct: 1   MQWENEGIVLSNKGLVENKAVTTLFTKDYGLKRGLC------SRKTTIDVGNVVYCRWSG 54

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSI-VPLFRFLPEREPCLELYDMLNIFLN 119
           RL   LG FR EV E     L +    L  L ++   L + LPE EP  E+Y      L 
Sbjct: 55  RLEVQLGYFRVEVKEIISPFLFTDYKKLKLLNAVLSILLKVLPENEPQKEIYKTFIQLLQ 114

Query: 120 CHKIPSVIGKIFVQ-IELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
             K  ++        ++L +L+ +GF LDL++C VTG T+DL ++SPK+G AV ++VG  
Sbjct: 115 AFKSNTLCYYRQYIEMDLSILQYLGFQLDLSRCAVTGETKDLFYISPKTGRAVTKAVGEA 174

Query: 179 YAEKMLVLPSFLWKEEQTIDADSLKS 204
           Y +K+L+LP  L+K    +  + +  
Sbjct: 175 YKDKLLLLPPSLYKIANGLSIEEISQ 200


>gi|226311655|ref|YP_002771549.1| DNA repair protein [Brevibacillus brevis NBRC 100599]
 gi|254790514|sp|C0ZB86|RECO_BREBN RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|226094603|dbj|BAH43045.1| DNA repair protein [Brevibacillus brevis NBRC 100599]
          Length = 257

 Score = 97.2 bits (240), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 33/178 (18%), Positives = 61/178 (34%), Gaps = 3/178 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M  + + I++    YGE + ++ + TR+ G+     R  +  + +    +       +  
Sbjct: 1   MLVKWEGIVIRSVDYGESSKVVTMFTRENGKLGVMARGAKKTKSRLAAVSQLFSHSYYLC 60

Query: 61  RLAQNLGEFRF---EVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
           +     G       ++L+S      S +   Y       L R   EREP   L+ +L   
Sbjct: 61  KAGPGTGMPDLSQGDMLDSFRDMRQSLTATAYAAYIAELLDRLTQEREPNPYLFQLLLHT 120

Query: 118 LNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSV 175
                       +    E  +L   G    LT C   G  ++   +S   GG +C   
Sbjct: 121 FRHLDEGRDAEILCRIFETKMLIVAGISPQLTACANCGEQREPYAISVGQGGLLCPVC 178


>gi|303257005|ref|ZP_07343019.1| DNA repair protein RecO [Burkholderiales bacterium 1_1_47]
 gi|302860496|gb|EFL83573.1| DNA repair protein RecO [Burkholderiales bacterium 1_1_47]
          Length = 235

 Score = 97.2 bits (240), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 28/145 (19%), Positives = 51/145 (35%), Gaps = 6/145 (4%)

Query: 4   QDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQS--HRMQPILQAGNLVRVNWRSR 61
           Q  A +L    + E ++I+E  TR YGR     R  +    + + +L     + V++  +
Sbjct: 14  QQPAFVLHTYPWRETSLIVEFFTRDYGRIPLVARGAKRPMSQYRGLLNPFCPLAVSYSGK 73

Query: 62  LAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCH 121
                        E +    ++  + +        L R LP  EP   L+ +    L   
Sbjct: 74  GEVKNLTRC----EWYGTIPMNEKVLMSAFYINELLVRLLPRGEPEPSLFTIYYDTLKKL 129

Query: 122 KIPSVIGKIFVQIELMLLKNIGFGL 146
            +           E   LK +G+ L
Sbjct: 130 ALEKDYLVPLRYFERDFLKVLGYAL 154


>gi|329924075|ref|ZP_08279338.1| DNA repair protein RecO [Paenibacillus sp. HGF5]
 gi|328940914|gb|EGG37222.1| DNA repair protein RecO [Paenibacillus sp. HGF5]
          Length = 251

 Score = 97.2 bits (240), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 30/157 (19%), Positives = 57/157 (36%), Gaps = 2/157 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQ--PILQAGNLVRVNW 58
           M ++ + I++    YGE N I+ + T++ G+    VR  +  + +   + Q        +
Sbjct: 1   MLYRAEGIVIRSMDYGEGNKIITLCTKESGKVGVLVRGAKKVKSRHAALTQLFTYGEYVF 60

Query: 59  RSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFL 118
                        E++ESH           Y   +   L R L + E     +  L   L
Sbjct: 61  FRNGTGLGNLNAGEIMESHHGLREDLVKAAYASYACELLDRVLQDEETGAFWFHQLKACL 120

Query: 119 NCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTG 155
              +       I    E+ +L+  G+G +L  C+   
Sbjct: 121 EALQEDKDPQIIINLYEMKILQAAGYGPELDVCISCN 157


>gi|311693677|gb|ADP96550.1| DNA repair protein RecO [marine bacterium HP15]
          Length = 242

 Score = 97.2 bits (240), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 25/151 (16%), Positives = 51/151 (33%), Gaps = 5/151 (3%)

Query: 2   YWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWR 59
             Q+ A +L  R + E ++++++ +  +GR     R   S +   +  LQ    + V+W 
Sbjct: 5   ELQEPAYVLHRRPWRETSLMVDLFSLNHGRMTVIARGANSAKSPLKAQLQPFQPLIVDWA 64

Query: 60  SRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLN 119
            R                   +  +     GL     L R LP  +P   L+      + 
Sbjct: 65  GRGDLKTLTQVDVRA---GPTITRTVSLYSGLYLNELLQRILPAADPHPTLFAAYIDAIG 121

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTK 150
                  +  +  + EL     +G+     +
Sbjct: 122 QLSDTRDVEPVLRRFELAFASALGYDFAWDR 152


>gi|222054844|ref|YP_002537206.1| DNA repair protein RecO [Geobacter sp. FRC-32]
 gi|221564133|gb|ACM20105.1| DNA repair protein RecO [Geobacter sp. FRC-32]
          Length = 244

 Score = 97.2 bits (240), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 27/150 (18%), Positives = 55/150 (36%), Gaps = 3/150 (2%)

Query: 8   IILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQ--PILQAGNLVRVNWRSRLAQN 65
           ++LGV  Y + + I+ + T + G+  G  RN +  R +    L+    +R+    +    
Sbjct: 9   VVLGVLDYADADKIVTLFTLENGKVKGLARNAKKSRKRFGGALEPFARLRLQLTLK-EGL 67

Query: 66  LGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPS 125
                 +V+          S       +   + + + E E    L+ +L  +L    +  
Sbjct: 68  STLNGADVINVFPHIRADLSKIANAAYACELVEQLVGEGEQNPRLFRLLTAYLEHLNLTD 127

Query: 126 VIGKIFVQIELMLLKNIGFGLDLTKCVVTG 155
                    E  LLK +G+  +L +C    
Sbjct: 128 HAPSDRRFFEANLLKVLGYQPELARCASCD 157


>gi|261405618|ref|YP_003241859.1| DNA repair protein RecO [Paenibacillus sp. Y412MC10]
 gi|261282081|gb|ACX64052.1| DNA repair protein RecO [Paenibacillus sp. Y412MC10]
          Length = 251

 Score = 97.2 bits (240), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 30/157 (19%), Positives = 57/157 (36%), Gaps = 2/157 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQ--PILQAGNLVRVNW 58
           M ++ + I++    YGE N I+ + T++ G+    VR  +  + +   + Q        +
Sbjct: 1   MLYRAEGIVIRSMDYGEGNKIITLCTKESGKVGVLVRGAKKVKSRHAALTQLFTYGEYVF 60

Query: 59  RSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFL 118
                        E++ESH           Y   +   L R L + E     +  L   L
Sbjct: 61  FRNGTGLGNLNAGEIMESHHGLREDLVKAAYASYACELLDRVLQDEETGAFWFHQLKACL 120

Query: 119 NCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTG 155
              +       I    E+ +L+  G+G +L  C+   
Sbjct: 121 EALQEDKDPQIIINLYEMKILQAAGYGPELDVCISCN 157


>gi|118594603|ref|ZP_01551950.1| DNA repair protein RecO [Methylophilales bacterium HTCC2181]
 gi|118440381|gb|EAV47008.1| DNA repair protein RecO [Methylophilales bacterium HTCC2181]
          Length = 237

 Score = 97.2 bits (240), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 34/211 (16%), Positives = 74/211 (35%), Gaps = 5/211 (2%)

Query: 8   IILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLAQN 65
            IL    + E ++I+E++++++GR     +  +  R   + +L     ++  W       
Sbjct: 13  YILHTYPFKETSLIVEMLSKEFGRIAVAAKGARRPRSSLRGMLLPLQPLQATWSGLNELK 72

Query: 66  LGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPS 125
                  +  S     +     + G      + R LP+ +P   LYD  +  +       
Sbjct: 73  TLH---SIEWSDQFLSIEGDALICGFYLNELMMRLLPKDDPHPALYDHYHQAVLALSKNK 129

Query: 126 VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKMLV 185
            +     + EL LL+ +G+ + L   +   +          +        GL  + ++  
Sbjct: 130 GLSVTLRRFELRLLQELGYQVPLNNDIHGRIIDFDKTYIYHADSGPLEGKGLEGSVEISG 189

Query: 186 LPSFLWKEEQTIDADSLKSAFQLTDYFLNKY 216
                   +   D  + K + QL  Y +N Y
Sbjct: 190 KTLIDMAADNYQDPLTEKQSKQLMRYLINHY 220


>gi|114320505|ref|YP_742188.1| DNA repair protein RecO [Alkalilimnicola ehrlichii MLHE-1]
 gi|119361445|sp|Q0A8Y9|RECO_ALHEH RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|114226899|gb|ABI56698.1| DNA replication and repair protein RecO [Alkalilimnicola ehrlichii
           MLHE-1]
          Length = 247

 Score = 97.2 bits (240), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 37/180 (20%), Positives = 62/180 (34%), Gaps = 8/180 (4%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQ-SHRMQPILQAGNLVRVNWRSRLAQ 64
            A +L  R + E ++I+E+ +R +GR     R G+ S R + +L+  + V  +W+ R   
Sbjct: 10  PAWVLHRRPWSESSLIVELFSRDFGRIGAVARGGRNSRRWRGLLEPFSPVLASWQGRGEL 69

Query: 65  NLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIP 124
                                    G      L R L   +P  EL+ +    LN     
Sbjct: 70  RSLVAAEPDGARPALAGA---ALASGFYLNELLLRLLRRDDPHPELHPLYGDTLNRL--- 123

Query: 125 SVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKML 184
                     E  LL+ +G+GL L + +                    R   +P A + L
Sbjct: 124 -PDEAALRGFECRLLEALGYGLLLLEDMGGEPVHGEAHYRYHLEHGPERLAAVPEAGEGL 182


>gi|330999957|ref|ZP_08323655.1| DNA repair protein RecO [Parasutterella excrementihominis YIT
           11859]
 gi|329573364|gb|EGG54976.1| DNA repair protein RecO [Parasutterella excrementihominis YIT
           11859]
          Length = 234

 Score = 97.2 bits (240), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 28/145 (19%), Positives = 51/145 (35%), Gaps = 6/145 (4%)

Query: 4   QDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQS--HRMQPILQAGNLVRVNWRSR 61
           Q  A +L    + E ++I+E  TR YGR     R  +    + + +L     + V++  +
Sbjct: 13  QQPAFVLHTYPWRETSLIVEFFTRDYGRIPLVARGAKRPMSQYRGLLNPFCPLAVSYSGK 72

Query: 62  LAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCH 121
                        E +    ++  + +        L R LP  EP   L+ +    L   
Sbjct: 73  GEVKNLTRC----EWYGTIPMNEKVLMSAFYINELLVRLLPRGEPEPSLFTIYYDTLKKL 128

Query: 122 KIPSVIGKIFVQIELMLLKNIGFGL 146
            +           E   LK +G+ L
Sbjct: 129 ALEKDYLVPLRYFERDFLKVLGYAL 153


>gi|297160638|gb|ADI10350.1| DNA repair protein RecO [Streptomyces bingchenggensis BCW-1]
          Length = 249

 Score = 97.2 bits (240), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 35/212 (16%), Positives = 78/212 (36%), Gaps = 15/212 (7%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQ--PILQAGNLVRVNWRS 60
           ++DD I+L  +  GE + I+ ++TR +GR     R  +  + +    L+  + V V + S
Sbjct: 4   FRDDGIVLRTQKLGEADRIITLLTRGHGRVRAVARGVRRTKSKFGARLEPFSHVDVQFFS 63

Query: 61  RLAQN------LGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLEL--YD 112
           R              + E +  + + +++         +++       + E    +  Y 
Sbjct: 64  RGGGELVGRGLPLCTQSETIAPYGSAIVTDYARYTAGTAMLETAERFTDHEGEPAMQQYL 123

Query: 113 MLNIFLNCHKIPSVIGKIFVQIELMLLKNI---GFGLDLTKCVVTGVTQDLLWVSPKSGG 169
           +L   L           +   ++  LL+++   G+      C   G+     + S  +GG
Sbjct: 124 LLVGALRTLASGEHEPHL--ILDAFLLRSLAVNGYAPSFDNCAKCGMPGPNRFFSVGAGG 181

Query: 170 AVCRSVGLPYAEKMLVLPSFLWKEEQTIDADS 201
            +C    +P +         L     T D ++
Sbjct: 182 VICGECRVPGSVVPSAEALMLLGALLTGDWET 213


>gi|197119173|ref|YP_002139600.1| DNA repair protein RecO [Geobacter bemidjiensis Bem]
 gi|197088533|gb|ACH39804.1| DNA repair protein RecO [Geobacter bemidjiensis Bem]
          Length = 217

 Score = 96.8 bits (239), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 26/146 (17%), Positives = 52/146 (35%), Gaps = 1/146 (0%)

Query: 4   QDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLA 63
           + +AI+L    +GE + I+   T + G+  G  R  +  + +          +  + +  
Sbjct: 10  EAEAIVLRFTDFGEADRIVTFFTLEQGKLQGVARGAKRSKKRFAGALEQFAHLKLQLQQG 69

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFL-PEREPCLELYDMLNIFLNCHK 122
            +L       + S    +    + +        L   L P+ EP   L+ +L  +L    
Sbjct: 70  NSLATLSSADIVSIFPGIRGDLVKIGCAAYACELVERLTPDEEPAPRLFRLLYCYLERLN 129

Query: 123 IPSVIGKIFVQIELMLLKNIGFGLDL 148
                        + LLK +G+  DL
Sbjct: 130 EAPPSPSDRRFFAVNLLKILGYQPDL 155


>gi|268315979|ref|YP_003289698.1| DNA repair protein RecO [Rhodothermus marinus DSM 4252]
 gi|262333513|gb|ACY47310.1| DNA repair protein RecO [Rhodothermus marinus DSM 4252]
          Length = 254

 Score = 96.8 bits (239), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 30/154 (19%), Positives = 54/154 (35%), Gaps = 4/154 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQ--SHRMQPILQAGNLVRVNW 58
           M  + +AI+L    YGE ++I  + TR  GR     +  +    R    LQ  + ++V +
Sbjct: 1   MIVRTEAIVLRTLPYGETSLIASLFTRAKGRLSMMAKGARLPGSRFGGTLQPPSCLQVVF 60

Query: 59  RSRLAQNLGEFRFEVLESHCAKL-LSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
             R  + L          +  +L          L+ +      LP  EP  E ++     
Sbjct: 61  YYRPTRELQTLSESSFAQYLPELGRDLEKLTLSLRMVELAHALLPPEEPMPEFFETFWQV 120

Query: 118 LNCHKIPSVIGK-IFVQIELMLLKNIGFGLDLTK 150
           L            +    +L L   +GF   + +
Sbjct: 121 LARLDATPTRAWNLLPWFQLRLAAALGFAPRIER 154


>gi|120599800|ref|YP_964374.1| DNA repair protein RecO [Shewanella sp. W3-18-1]
 gi|120559893|gb|ABM25820.1| DNA repair protein RecO [Shewanella sp. W3-18-1]
 gi|319425563|gb|ADV53637.1| DNA repair protein RecO [Shewanella putrefaciens 200]
          Length = 236

 Score = 96.8 bits (239), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 35/232 (15%), Positives = 71/232 (30%), Gaps = 12/232 (5%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVR-NGQSHRMQPILQAGNLVRVNWRSRLAQ 64
              +L  R Y E ++++ ++    GR     R       ++ ILQ    +   +  +   
Sbjct: 3   RGYVLHHRPYRESSVLVNLLVDGIGRVDVVARTGSGKRSIKSILQPFQPLIFEFSGKSEL 62

Query: 65  NLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIP 124
                  ++  +  A  LS      G+     L R L  +     L+ + +  L      
Sbjct: 63  KT---LTQIEAAAPAVPLSGQSLFAGMYINELLVRTLSVQHHAEALFLIYHRALVGLAAK 119

Query: 125 SVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKML 184
               ++   IEL LL+ +G    L++           +            +    A    
Sbjct: 120 FCQSQLR-YIELALLQELGAMPSLSRDTQGEPLVPEDYYQLVPELGFQFVLN-SRARNAY 177

Query: 185 VLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENFLGK 235
                +   +  +      SA +L    L +  L   +     L R+ F+  
Sbjct: 178 QGAMLMALNDNQLTEAQFLSA-KL----LMRSLLTPLLGTKPLLSRQLFVSS 224


>gi|257093155|ref|YP_003166796.1| DNA repair protein RecO [Candidatus Accumulibacter phosphatis clade
           IIA str. UW-1]
 gi|257045679|gb|ACV34867.1| DNA repair protein RecO [Candidatus Accumulibacter phosphatis clade
           IIA str. UW-1]
          Length = 238

 Score = 96.8 bits (239), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 42/231 (18%), Positives = 70/231 (30%), Gaps = 13/231 (5%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLA 63
            A +L    Y E ++I++V +R +GR     R  +  R   + +L A   + + W  R  
Sbjct: 11  PAFVLHAYPYSETSLIIDVFSRDFGRVALLARGARRPRSVLRGVLLAFQPLELAWAGRGE 70

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKI 123
                   +        LL+      G      L   LP  +    L+ +    L     
Sbjct: 71  VQTLM---KAEWQGGQPLLAGKSLFCGYYLNELLMNLLPREDAHARLFAVYAETLRRFAD 127

Query: 124 PSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGA-VCRSVGLPYAEK 182
            +    +    E  LL+ +G+GL L         +     + +     V        A  
Sbjct: 128 GAQEADLRC-FERALLQELGYGLLLETDAEGVAVEADGDYAYEIERGPVRLQRPGGSALS 186

Query: 183 MLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHN-IIHCHLLRENF 232
           +          E   D  SL  A Q     L +  + H         R  F
Sbjct: 187 VSGRTLIDLAREDFSDPRSLSEAKQ-----LMRTLIGHYTGGRSLASRRIF 232


>gi|167037773|ref|YP_001665351.1| DNA repair protein RecO [Thermoanaerobacter pseudethanolicus ATCC
           33223]
 gi|256751967|ref|ZP_05492837.1| DNA repair protein RecO [Thermoanaerobacter ethanolicus CCSD1]
 gi|320116188|ref|YP_004186347.1| DNA repair protein RecO [Thermoanaerobacter brockii subsp. finnii
           Ako-1]
 gi|238687665|sp|B0KA52|RECO_THEP3 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|166856607|gb|ABY95015.1| DNA repair protein RecO [Thermoanaerobacter pseudethanolicus ATCC
           33223]
 gi|256749172|gb|EEU62206.1| DNA repair protein RecO [Thermoanaerobacter ethanolicus CCSD1]
 gi|319929279|gb|ADV79964.1| DNA repair protein RecO [Thermoanaerobacter brockii subsp. finnii
           Ako-1]
          Length = 248

 Score = 96.8 bits (239), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 37/177 (20%), Positives = 68/177 (38%), Gaps = 2/177 (1%)

Query: 4   QDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNW-RSRL 62
           + +AI+L     GE + I  + T+ YG+     +  +  + + +      +  N+     
Sbjct: 5   KTEAIVLKNNLIGETDKIATLFTKSYGKLQAVAKGARRSKSRFVNAIRPFIVANYVIFEG 64

Query: 63  AQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHK 122
                  ++E++E+H         F         + + L E +    LY  L   L    
Sbjct: 65  KNYYYIDQWELIEAHRNIEKDLVKFSVASYIAETINKILEENQKSERLYLFLKHSLKAVD 124

Query: 123 IPSVIGKIFV-QIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
              +   IF+    L L+  +G+   L  CVV G  ++L + S   GGAVC +    
Sbjct: 125 ELQIDPLIFISSYNLKLVSLLGYMPQLDNCVVCGKRENLKYFSNSCGGAVCINCKNK 181


>gi|325266693|ref|ZP_08133370.1| recombination protein O [Kingella denitrificans ATCC 33394]
 gi|324982136|gb|EGC17771.1| recombination protein O [Kingella denitrificans ATCC 33394]
          Length = 252

 Score = 96.8 bits (239), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 33/220 (15%), Positives = 64/220 (29%), Gaps = 11/220 (5%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLA 63
            A +L    + E ++ LEV +R YGR     R+ ++     + IL     + ++W  +  
Sbjct: 10  PAFLLASSPWRENSLRLEVFSRDYGRVALLARSARARGSELRGILMPFVPLSISWFGKEE 69

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKI 123
                           +   + L    L +   L +     +P   LY  L   +     
Sbjct: 70  LKTLH---RAEWVGGWQQPKNLLLFSALYANEILLKLTAREDPHPNLYHALAQLMQHFGT 126

Query: 124 PSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKM 183
                      E  LL  +G+             +       +   A  R      +   
Sbjct: 127 GQHHLAPLRHFEWQLLHELGYAPSAQHDRQQQPIETHANYLMRPETAAERMAEAESSLHS 186

Query: 184 LVLPSFLWK------EEQTIDADSLKSAFQLTDYFLNKYA 217
           +     +        E  ++    L++A  L   F+  Y 
Sbjct: 187 VPNSCIISGDVLQALETSSLQPHQLQAALALNRLFIQHYL 226


>gi|225024982|ref|ZP_03714174.1| hypothetical protein EIKCOROL_01871 [Eikenella corrodens ATCC
           23834]
 gi|224942212|gb|EEG23421.1| hypothetical protein EIKCOROL_01871 [Eikenella corrodens ATCC
           23834]
          Length = 246

 Score = 96.8 bits (239), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 36/219 (16%), Positives = 67/219 (30%), Gaps = 13/219 (5%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLA 63
            A +L    + E +++ E+ +R YGR     R+ +  +   + +L     V+V W  +  
Sbjct: 11  PAFLLSATPWRETSLLAELFSRDYGRVAVVARSARKRQSELRGVLVPFVPVQVAWYGKEE 70

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKI 123
                                   L GL     + +     +P   LY+ L   +     
Sbjct: 71  LKTLH---RAEWLGGWPQPQGRALLSGLYVNELVQKLTAREDPQPALYEALRQVMRTLCT 127

Query: 124 PSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKM 183
                 +  + E  LL   G+  DL K       +       +   AV            
Sbjct: 128 EPNHAAVLRRFEWTLLTLAGYAPDLQKDSAGCPVEADRQYWLQPEHAVLPLEQRHSLTPA 187

Query: 184 LVLP--------SFLWKEEQTIDADSLKSAFQLTDYFLN 214
            V P            +  +  D  +L+ A ++T   L+
Sbjct: 188 EVQPGVAVDGDVLIQLQNGEFTDTSALQQARRITRLLLD 226


>gi|213420940|ref|ZP_03354006.1| DNA repair protein RecO [Salmonella enterica subsp. enterica
           serovar Typhi str. E01-6750]
          Length = 222

 Score = 96.8 bits (239), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 40/216 (18%), Positives = 70/216 (32%), Gaps = 12/216 (5%)

Query: 21  ILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLAQNLGEFRFEVLESHC 78
           +L+V T + GR     +  +S R   +  LQ    + + +  R                 
Sbjct: 1   MLDVFTEESGRVRLVAKGARSKRSNLKGALQPFTPLLLRYSGRGEVKTLR---SAEAVSL 57

Query: 79  AKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPS-VIGKIFVQIELM 137
           A  LS      GL     L R L       EL+      +      +        + EL 
Sbjct: 58  ALPLSGITLYSGLYINELLSRVLEYETRFSELFFDYLNCIQALAGTTGSPEPALRRFELA 117

Query: 138 LLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKMLVLPSFLWKEEQTI 197
           LL ++G+G++ T C  +G   D              +  +              +  +  
Sbjct: 118 LLGHLGYGVNFTHCAGSGERVDDTMTYRYREEKGFFASVVIDNNTFTGRHLKALEAREFP 177

Query: 198 DADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENF 232
           D D+L++A + T     + AL+  +       RE F
Sbjct: 178 DVDTLRAAKRFT-----RMALKPYLGGKPLKSRELF 208


>gi|319943507|ref|ZP_08017789.1| recombination protein O [Lautropia mirabilis ATCC 51599]
 gi|319743322|gb|EFV95727.1| recombination protein O [Lautropia mirabilis ATCC 51599]
          Length = 234

 Score = 96.8 bits (239), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 27/177 (15%), Positives = 53/177 (29%), Gaps = 5/177 (2%)

Query: 4   QDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSR 61
            +   +L   +Y E ++I+++  R+ GR     +  +      +P+L     +      R
Sbjct: 7   DEPGFVLHSHAYRETSLIVDLFLRERGRVSAVAKGARRPTSALRPVLLQFQPIEFRLSGR 66

Query: 62  LAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCH 121
                              + +    L+       + R L   +P  +L+D     L   
Sbjct: 67  NELRT---LTRAEWQGGMAVPAGRALLFAFYLNELVMRLLAREDPHPQLFDAYADALYQL 123

Query: 122 KIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
                  +I  + E +LL  IG+  DL         +         G         P
Sbjct: 124 GEQGADERILRRFEWLLLTEIGYAPDLACDHRGLPLEPQRNYRMDGGQWFATQGEDP 180


>gi|161502269|ref|YP_001569381.1| hypothetical protein SARI_00299 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|160863616|gb|ABX20239.1| hypothetical protein SARI_00299 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 222

 Score = 96.8 bits (239), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 39/216 (18%), Positives = 71/216 (32%), Gaps = 12/216 (5%)

Query: 21  ILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLAQNLGEFRFEVLESHC 78
           +L+V T + GR     +  +S R   +  LQ    + + +  R                 
Sbjct: 1   MLDVFTEESGRVRLVAKGARSKRSNLKGALQPFTPLLLRYSGRGEVKTLR---SAEAVSL 57

Query: 79  AKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPS-VIGKIFVQIELM 137
           A  L+      GL     L R L       EL+      +      +     +  + EL 
Sbjct: 58  ALPLNGITLYSGLYINELLSRVLEYETRFSELFFDYLNCIQALAGTTGSPEPVLRRFELA 117

Query: 138 LLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKMLVLPSFLWKEEQTI 197
           LL ++G+G++ T C  +G   D              +  +              +  +  
Sbjct: 118 LLGHLGYGVNFTHCAGSGEQVDDTMTYRYREEKGFIASVVIDNNTFTGRHLKALEAREFP 177

Query: 198 DADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENF 232
           D D+L++A + T     + AL+  +       RE F
Sbjct: 178 DVDTLRAAKRFT-----RMALKPYLGGKPLKSRELF 208


>gi|302551286|ref|ZP_07303628.1| DNA repair protein RecO [Streptomyces viridochromogenes DSM 40736]
 gi|302468904|gb|EFL31997.1| DNA repair protein RecO [Streptomyces viridochromogenes DSM 40736]
          Length = 248

 Score = 96.8 bits (239), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 38/211 (18%), Positives = 82/211 (38%), Gaps = 14/211 (6%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQ--PILQAGNLVRVNWRS 60
           ++DD I+L  +  GE + I+ ++TR +GR     R  +  + +    L+  + V V + +
Sbjct: 4   FRDDGIVLRTQKLGEADRIITLLTRGHGRVRAVARGVRRTKSKFGARLEPFSHVDVQFFA 63

Query: 61  RLAQNLG-----EFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLEL--YDM 113
           + ++ +G       + E +  +   ++S          ++       + E    +  Y +
Sbjct: 64  KGSELVGRGLPLCTQSETIAPYGGGIVSDYARYTAGTVMLETAERFTDHEGEPAVQQYLL 123

Query: 114 LNIFLNCHKIPSVIGKIFVQIELMLLKNI---GFGLDLTKCVVTGVTQDLLWVSPKSGGA 170
           L   L           +   ++  LL+++   G+    T C   G+     + S  SGG+
Sbjct: 124 LVGGLRTLARGEHAPHLV--LDAFLLRSLAVNGYAPSFTDCAKCGMPGPNRFFSVASGGS 181

Query: 171 VCRSVGLPYAEKMLVLPSFLWKEEQTIDADS 201
           VC    +P +         L     T D ++
Sbjct: 182 VCVDCRVPGSVVPSPQALELLGALLTGDWET 212


>gi|322420171|ref|YP_004199394.1| DNA repair protein RecO [Geobacter sp. M18]
 gi|320126558|gb|ADW14118.1| DNA repair protein RecO [Geobacter sp. M18]
          Length = 212

 Score = 96.4 bits (238), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 33/207 (15%), Positives = 71/207 (34%), Gaps = 7/207 (3%)

Query: 4   QDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQ--PILQAGNLVRVNWRSR 61
           + + I+L +  +GE + I+ + T + G+  G  R  +  R +    L+    +++     
Sbjct: 5   EAEGIVLRLTDFGEADRIVTMFTLEQGKLQGVARGAKRSRKRFAGALEPFAHLKLQLHL- 63

Query: 62  LAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCH 121
                     +++          +       +   + R  PE EP   L+ +L  +L   
Sbjct: 64  GTGLATLSSADIVGIFPGIRADLTKIGCAAYACELVERLTPEDEPSPRLFRLLYCYLERL 123

Query: 122 KIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAE 181
                         + LLK +G+  DL    ++  T  LL  + ++G        + + E
Sbjct: 124 NEAPASPSDRRFFAVNLLKILGYQPDLQLRAISEETATLLARAMRTGRF----GAIVFPE 179

Query: 182 KMLVLPSFLWKEEQTIDADSLKSAFQL 208
            +L     L      +  D    +   
Sbjct: 180 PLLSEADLLLNPAIDLHLDRELKSLAF 206


>gi|152999780|ref|YP_001365461.1| DNA repair protein RecO [Shewanella baltica OS185]
 gi|151364398|gb|ABS07398.1| DNA repair protein RecO [Shewanella baltica OS185]
          Length = 236

 Score = 96.4 bits (238), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 37/232 (15%), Positives = 78/232 (33%), Gaps = 12/232 (5%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVR-NGQSHRMQPILQAGNLVRVNWRSRLAQ 64
              +L  R Y E ++++ ++    GR     R       ++ ILQ    +   +  +   
Sbjct: 3   RGYVLHHRPYRESSVLVNLLVDGIGRVDVVSRTGSGKRSIKSILQPFQPLIFEFSGKSEL 62

Query: 65  NLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIP 124
                  +V  +  A  LS      G+     L R L  +    EL+ + +  L      
Sbjct: 63  KT---LTQVEAAAPAVPLSGQSLFAGMYINELLVRTLSVQHNAEELFLIYHQALVGLAAK 119

Query: 125 SVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKML 184
               ++   IEL LL+ +GF   L++            +  +    +   +G  +     
Sbjct: 120 FCQSQLR-YIELALLRELGFMPSLSRDTQGEP------LVAEDYYQLVPELGFQFVLNSR 172

Query: 185 VLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENFLGK 235
              ++       ++ + L     L+   L +  L+  +     L R+ F+  
Sbjct: 173 ARNAYQGAMLTALNDNQLTDVHFLSAKLLMRSLLKPLLGTKPLLSRQLFVSA 224


>gi|157144499|ref|YP_001451818.1| hypothetical protein CKO_00217 [Citrobacter koseri ATCC BAA-895]
 gi|157081704|gb|ABV11382.1| hypothetical protein CKO_00217 [Citrobacter koseri ATCC BAA-895]
          Length = 225

 Score = 96.4 bits (238), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 41/216 (18%), Positives = 69/216 (31%), Gaps = 12/216 (5%)

Query: 21  ILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLAQNLGEFRFEVLESHC 78
           +L+V T + GR     +  +S R   +  LQ    + + +  R                 
Sbjct: 1   MLDVFTEESGRVRLVAKGARSKRSSLKGALQPFTPLLLRFGGRGEVKTLR---SAEAVSL 57

Query: 79  AKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPS-VIGKIFVQIELM 137
           A  LS      GL     L R L       EL+      +      +        + EL 
Sbjct: 58  ALPLSGITLYSGLYINELLSRVLEYETRFSELFFDYLNCIQSLAGATGSPEPALRRFELA 117

Query: 138 LLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKMLVLPSFLWKEEQTI 197
           LL ++G+G+D   C  +G T D              +  +                 +  
Sbjct: 118 LLGHLGYGVDFLHCAGSGETVDDTMTYRYREEKGFMASVVIDNSTFTGRHLKALDAREFP 177

Query: 198 DADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENF 232
           D D+L++A + T     + AL+  +       RE F
Sbjct: 178 DVDTLRAAKRFT-----RMALKPYLGGKPLKSRELF 208


>gi|319638209|ref|ZP_07992972.1| DNA repair protein [Neisseria mucosa C102]
 gi|317400482|gb|EFV81140.1| DNA repair protein [Neisseria mucosa C102]
          Length = 247

 Score = 96.4 bits (238), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 36/233 (15%), Positives = 66/233 (28%), Gaps = 16/233 (6%)

Query: 8   IILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLAQN 65
            +L    + E ++ +E  +R+YGR     R+ +  +   + +L     V  +W       
Sbjct: 13  FLLASAPWRESSLWVEAFSRRYGRVALLARSARKRQSELRGVLVPFVPVSASWYGSQELK 72

Query: 66  LGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPS 125
                                   GL     + +     +P  ELYD+L   +      +
Sbjct: 73  TLH---RAEWIGGWPQPQGRALFSGLYVNELMLKLTVREDPLPELYDVLAETMKTICCEA 129

Query: 126 VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKMLV 185
                  + E  LL  +GF  DL                     AV           +  
Sbjct: 130 NHIAALRRFEWTLLTRLGFAPDLFHDGNGNEINGEETYWLTPEEAVVPLAEADRFHALNK 189

Query: 186 ------LPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENF 232
                       +E   +  +SL  A ++T   ++   L    I     R+  
Sbjct: 190 GVAVSGATLIDLREGSFVHQESLGQALKVTRLLIDN--LLPEGI---KSRQVL 237


>gi|253700038|ref|YP_003021227.1| DNA repair protein RecO [Geobacter sp. M21]
 gi|251774888|gb|ACT17469.1| DNA repair protein RecO [Geobacter sp. M21]
          Length = 217

 Score = 96.4 bits (238), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 25/146 (17%), Positives = 53/146 (36%), Gaps = 3/146 (2%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQ--PILQAGNLVRVNWRSRLA 63
           +AI+L +  +GE + I+   T + G+  G  R  +  + +    L+A   +++      +
Sbjct: 12  EAIVLRLTDFGEADRIVTFFTLEQGKLQGVARGAKRSKKRFAGALEAFAHLKLQLHLGNS 71

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKI 123
                   +++                  +   + R  P+ EP   L+ +L  +L     
Sbjct: 72  LPT-LSSADIVSIFPGIRSDLVKIGSAAYACELVERLTPDEEPAPRLFRLLYCYLERLDQ 130

Query: 124 PSVIGKIFVQIELMLLKNIGFGLDLT 149
                       + LLK +G+  DL 
Sbjct: 131 DPPSASDRRFFAVNLLKILGYQPDLK 156


>gi|119713603|gb|ABL97654.1| DNA repair protein RecO [uncultured marine bacterium EB0_39H12]
          Length = 241

 Score = 96.4 bits (238), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 28/211 (13%), Positives = 74/211 (35%), Gaps = 9/211 (4%)

Query: 5   DDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRL 62
           + A +L  R Y E ++I+E  T+ +GR     +  +  +   + +L   + + V+   + 
Sbjct: 10  EPAFVLHTRPYQETSLIVEFFTQSFGRINAVAKGAKRPKSPLRSVLTPVSRLSVSLSGKS 69

Query: 63  AQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHK 122
                     +       L   +     +     + +   + +P   ++     FL    
Sbjct: 70  ELKNLSSAEILDHYP---LSDGASLNSIIYINELITKATEKEDPHKIIFLKYQNFLENIS 126

Query: 123 IPSVIGKIFVQ---IELMLLKNIGFGLDLTKCVVTGVT-QDLLWVSPKSGGAVCRSVGLP 178
             + +  + +     E+ LL+ +G+G+DLT+   T    ++                   
Sbjct: 127 KNNNLDNLELLLRDFEMTLLQEMGYGIDLTRDAETNNKLKEDTNYRFDPNIGFTFITAGN 186

Query: 179 YAEKMLVLPSFLWKEEQTIDADSLKSAFQLT 209
             +   +    +   E   +  S+++A ++ 
Sbjct: 187 RPKISFLGKDIIDFSEGKFEKKSVRAASKII 217


>gi|146292264|ref|YP_001182688.1| DNA repair protein RecO [Shewanella putrefaciens CN-32]
 gi|145563954|gb|ABP74889.1| DNA repair protein RecO [Shewanella putrefaciens CN-32]
          Length = 236

 Score = 96.4 bits (238), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 35/232 (15%), Positives = 77/232 (33%), Gaps = 12/232 (5%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVR-NGQSHRMQPILQAGNLVRVNWRSRLAQ 64
              +L  R Y E ++++ ++    GR     R       ++ ILQ    +   +  +   
Sbjct: 3   RGYVLHHRPYRESSVLVNLLVDGIGRVDVVARTGSGKRSIKSILQPFQPLIFEFSGKSEL 62

Query: 65  NLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIP 124
                  ++  +  A  L       G+     L R L  +     L+ + +  L      
Sbjct: 63  KT---LTQIEAAAPAVPLFGQSLFAGMYINELLVRTLSVQHHAEALFLIYHRALVGLAAK 119

Query: 125 SVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKML 184
               ++   IEL LL+ +G    L++  +         + P     +   +G  +     
Sbjct: 120 FCQSQLR-YIELALLQELGAMPSLSRDTLGEP------LVPDDYYQLVPELGFQFVLNSR 172

Query: 185 VLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENFLGK 235
              ++       ++ + L  A  L+   L +  L+  +     L R+ F+  
Sbjct: 173 ARNAYQGAMLMALNDNQLTEAQFLSAKLLMRSLLKPLLGTKPLLSRQLFVNS 224


>gi|326389847|ref|ZP_08211411.1| DNA repair protein RecO [Thermoanaerobacter ethanolicus JW 200]
 gi|325994115|gb|EGD52543.1| DNA repair protein RecO [Thermoanaerobacter ethanolicus JW 200]
          Length = 248

 Score = 96.4 bits (238), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 38/177 (21%), Positives = 69/177 (38%), Gaps = 2/177 (1%)

Query: 4   QDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNW-RSRL 62
           + +AI+L     GE + I  + T+ YG+     +  +  + + +      V  N+     
Sbjct: 5   KTEAIVLKNNLIGETDKIATLFTKSYGKLQAVAKGARRSKSRFVNAIRPFVVANYVIFEG 64

Query: 63  AQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHK 122
                  ++E++E+H       + F         + + L E +    LY  L   L    
Sbjct: 65  QNYYYIDQWELIEAHKNIEKDLAKFSVASYIAETINKILEENQKSERLYLFLKHSLKAVD 124

Query: 123 IPSVIGKIFV-QIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
              +   IF+    L L+  +G+   L  CVV G  ++L + S   GGAVC +    
Sbjct: 125 ELQIDPLIFISSYNLKLVSLLGYMPQLDNCVVCGKRENLKYFSNSCGGAVCINCKNK 181


>gi|225075848|ref|ZP_03719047.1| hypothetical protein NEIFLAOT_00864 [Neisseria flavescens
           NRL30031/H210]
 gi|224952794|gb|EEG34003.1| hypothetical protein NEIFLAOT_00864 [Neisseria flavescens
           NRL30031/H210]
          Length = 247

 Score = 96.4 bits (238), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 36/233 (15%), Positives = 68/233 (29%), Gaps = 16/233 (6%)

Query: 8   IILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLAQN 65
            +L    + + ++ +E  +R+YGR     R+ +  +   + +L     V  +W       
Sbjct: 13  FLLASAPWRDSSLWVEAFSRRYGRVALLARSARKRQSELRGVLVPFVPVSASWYGSQELK 72

Query: 66  LGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPS 125
                                   GL     + +     +P  ELYD+L   +      +
Sbjct: 73  TLH---RAEWIGGWPQPQGRALFSGLYVNELMLKLTVREDPLPELYDVLAETMKTICCEA 129

Query: 126 VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKMLV 185
                  + E  LL  +GF  DL                     AV           +  
Sbjct: 130 NHIAALRRFEWSLLTRLGFAPDLFHDGNGNEINGEETYWLTPEEAVVPLAEADRFHALNK 189

Query: 186 LPSFL------WKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENF 232
             + L       +E   +  +SL  A ++T   ++   L    I     R+  
Sbjct: 190 GVAVLGATLIDLREGSFVHQESLGQALKVTRLLIDN--LLPEGI---KSRQVL 237


>gi|269836984|ref|YP_003319212.1| DNA repair protein RecO [Sphaerobacter thermophilus DSM 20745]
 gi|269786247|gb|ACZ38390.1| DNA repair protein RecO [Sphaerobacter thermophilus DSM 20745]
          Length = 276

 Score = 96.4 bits (238), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 29/157 (18%), Positives = 57/157 (36%), Gaps = 3/157 (1%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQS--HRMQPILQAGNLVRVNWRS 60
           ++ +A++L  R  GE + IL + T ++G+     +  +    ++   L+      +   +
Sbjct: 33  YRTEAVVLRRRDLGEADRILTLFTARHGKLRVVAKGVRRPQSKLAGHLEPCARTSLLL-A 91

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           +        + ++++ + A   +     Y       L     E +P    YD L      
Sbjct: 92  QGRNLDIITQAQLVKPYRALRENEISIAYAGYFADLLDALTVEAQPNPAAYDALVSAFEM 151

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVT 157
                    I    EL LL   GF  +L +C   G T
Sbjct: 152 LDRGLDPFVIARIFELHLLTVTGFRPELYRCAGCGET 188


>gi|325142930|gb|EGC65289.1| DNA repair protein RecO [Neisseria meningitidis 961-5945]
          Length = 263

 Score = 96.0 bits (237), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 40/234 (17%), Positives = 72/234 (30%), Gaps = 16/234 (6%)

Query: 8   IILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLAQN 65
            +L    + E ++ +E  +R+YGR     R+ +  +   + +L     V  +W       
Sbjct: 12  FLLASSPWRESSLRVEAFSRRYGRVALLARSARKRQSELRGVLVPFVPVSASWYGSQELK 71

Query: 66  LGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPS 125
                                   GL     + +     +P  ELYD L   +      +
Sbjct: 72  TLH---RAEWIGGWPQPQGRALFSGLYVNELMLKLTVREDPLPELYDALAEVMEAVCCKA 128

Query: 126 VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGL----PYAE 181
                  + E  LL  +G   DL +    G          +   AV          P+A 
Sbjct: 129 AYIDDLRRFEWRLLNLLGVAPDLNRDGDGGTIAAGGTYLVRPETAVFPVGKGFAVPPHAA 188

Query: 182 KMLVLPSFLWK--EEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFL 233
            ++     L    E     A+SL+ A ++T  F+    L    +     R+   
Sbjct: 189 GVVAPGQSLIDLREGSFRTAESLQQALKITRLFI--RHLLPEGL---KSRQVLE 237


>gi|56963448|ref|YP_175179.1| DNA repair protein RecO [Bacillus clausii KSM-K16]
 gi|61214764|sp|Q5WHD7|RECO_BACSK RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|56909691|dbj|BAD64218.1| DNA repair protein RecO [Bacillus clausii KSM-K16]
          Length = 256

 Score = 96.0 bits (237), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 33/191 (17%), Positives = 63/191 (32%), Gaps = 2/191 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNW-R 59
           M  + DAI+L    YGE N I+ + T++ G+     +  +    +        V  ++  
Sbjct: 1   MLKKQDAIVLKSIDYGETNKIVTLFTKEDGKLAVLAKGAKKPNSRFAAVTQPFVYGSYLY 60

Query: 60  SRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLN 119
            +        + E ++S            Y       + +   ER+P   L+D L + L 
Sbjct: 61  FQGNGLPSLSQGEAVDSFKELQFDIVKSAYAAYITELVDKLTEERKPTFFLFDWLLLALR 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQ-DLLWVSPKSGGAVCRSVGLP 178
                     I   +++ +L   G   +L  C        D +  S    G +C +    
Sbjct: 121 QINTGQDAEIIARIMDMKMLPLAGAKPELDCCACCRSETRDPVAFSVAYAGFLCSNCIHK 180

Query: 179 YAEKMLVLPSF 189
                 +   F
Sbjct: 181 DERAFPITLPF 191


>gi|262040301|ref|ZP_06013552.1| DNA repair protein RecO [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|330007688|ref|ZP_08306027.1| DNA repair protein RecO [Klebsiella sp. MS 92-3]
 gi|259042410|gb|EEW43430.1| DNA repair protein RecO [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|328535369|gb|EGF61851.1| DNA repair protein RecO [Klebsiella sp. MS 92-3]
          Length = 225

 Score = 96.0 bits (237), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 41/216 (18%), Positives = 68/216 (31%), Gaps = 12/216 (5%)

Query: 21  ILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLAQNLGEFRFEVLESHC 78
           +L+V T + GR     +  +S R   +  LQ    + V +  R                 
Sbjct: 1   MLDVFTEESGRVRLVAKGARSKRSNLKGALQPFTPLLVRFGGRGEVKTLR---SAEAVSL 57

Query: 79  AKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPS-VIGKIFVQIELM 137
           A  LS      GL     + R L       EL+      +      S        + EL 
Sbjct: 58  ALPLSGITLYSGLYVNELISRVLEHETRFSELFFDYLHCIQALAGASGSPEPALRRFELA 117

Query: 138 LLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKMLVLPSFLWKEEQTI 197
           LL ++G+G+D   C  +G   D              +  +                 +  
Sbjct: 118 LLGHLGYGVDFLHCAGSGEPVDDTMTYRYREEKGFIASLVIDNNTFTGHHLKALASREFP 177

Query: 198 DADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENF 232
           D D+L++A + T     + AL+  +       RE F
Sbjct: 178 DVDTLRAAKRFT-----RIALKPYLGGKPLKSRELF 208


>gi|167039987|ref|YP_001662972.1| DNA repair protein RecO [Thermoanaerobacter sp. X514]
 gi|300914077|ref|ZP_07131393.1| DNA repair protein RecO [Thermoanaerobacter sp. X561]
 gi|307724690|ref|YP_003904441.1| DNA repair protein RecO [Thermoanaerobacter sp. X513]
 gi|238687639|sp|B0K710|RECO_THEPX RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|166854227|gb|ABY92636.1| DNA repair protein RecO [Thermoanaerobacter sp. X514]
 gi|300889012|gb|EFK84158.1| DNA repair protein RecO [Thermoanaerobacter sp. X561]
 gi|307581751|gb|ADN55150.1| DNA repair protein RecO [Thermoanaerobacter sp. X513]
          Length = 248

 Score = 96.0 bits (237), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 38/177 (21%), Positives = 69/177 (38%), Gaps = 2/177 (1%)

Query: 4   QDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNW-RSRL 62
           + +AI+L     GE + I  + T+ YG+     +  +  + + +      V  N+     
Sbjct: 5   KTEAIVLKNNLIGETDKIATLFTKSYGKLQAVAKGARRSKSRFVNAIRPFVVANYVIFEG 64

Query: 63  AQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHK 122
                  ++E++E+H       + F         + + L E +    LY  L   L    
Sbjct: 65  QNYYYIDQWELIEAHKNIEKDLAKFSVASYIAETINKILEENQKSERLYLFLKHSLKAVD 124

Query: 123 IPSVIGKIFV-QIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
              +   IF+    L L+  +G+   L  CVV G  ++L + S   GGAVC +    
Sbjct: 125 ELQIDPLIFISSYNLKLVSLLGYMPQLDNCVVCGKRENLKYFSNSCGGAVCINCKNK 181


>gi|149374707|ref|ZP_01892481.1| DNA repair protein RecO [Marinobacter algicola DG893]
 gi|149361410|gb|EDM49860.1| DNA repair protein RecO [Marinobacter algicola DG893]
          Length = 238

 Score = 96.0 bits (237), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 38/235 (16%), Positives = 72/235 (30%), Gaps = 10/235 (4%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNW 58
           M  Q+ A +L  R + E +++++V +   GR     R G S +   +  LQ    + ++W
Sbjct: 1   MQ-QEPAYVLHRRPWRETSLMVDVFSLNAGRVTVVARGGNSAKSPLKAQLQPFQPLLLDW 59

Query: 59  RSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFL 118
             R                   L  +     GL     L R LP  +P  +L+      +
Sbjct: 60  TGRSDLKTLTQADVR---SGPSLKRTLSLYSGLYVNELLQRLLPMADPHHQLFAAYIDVI 116

Query: 119 NCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGV-TQDLLWVSPKSGGAVCRSVGL 177
                   +  I  + E  L   +G+     +   +G   +            +      
Sbjct: 117 AELSEARDVEPILRRFEQSLAAELGYDFVWDQATDSGQPVEAGRLYCYDPEQGILAEPSP 176

Query: 178 PYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENF 232
               + L   + L      +++   +   +     L  Y LQ         R  F
Sbjct: 177 GARLRNLPGGTLLALANGDLESVECRRIAKRVTRVLVDYLLQ---GKVLHSRSLF 228


>gi|241760492|ref|ZP_04758585.1| DNA repair protein RecO [Neisseria flavescens SK114]
 gi|241318996|gb|EER55498.1| DNA repair protein RecO [Neisseria flavescens SK114]
          Length = 247

 Score = 96.0 bits (237), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 37/233 (15%), Positives = 68/233 (29%), Gaps = 16/233 (6%)

Query: 8   IILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLAQN 65
            +L    + E ++ +E  +R+YGR     R+ +  +   + +L     V  +W       
Sbjct: 13  FLLASAPWRESSLWVEAFSRRYGRVALLARSARKRQSELRGVLVPFVPVSASWYGSQELK 72

Query: 66  LGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPS 125
                                   GL     + +     +P  ELYD+L   +      +
Sbjct: 73  TLH---RAEWIGGWPQPQGRALFSGLYVNELMLKLTVREDPLPELYDVLAETMKTICCEA 129

Query: 126 VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKMLV 185
                  + E  LL  +GF  DL                     AV           +  
Sbjct: 130 NHIAALRRFEWTLLTRLGFAPDLFHDGNGNEINSDETYWLTPEEAVVHLAEADRFHALNK 189

Query: 186 LPSFL------WKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENF 232
             + L       +E   +  +SL  A ++T   ++   L    I     R+  
Sbjct: 190 GVAVLGATLIDLREGSFVHQESLGQALKVTRLLIDN--LLPEGI---KSRQVL 237


>gi|218768788|ref|YP_002343300.1| DNA repair protein (recombination protein o) [Neisseria
           meningitidis Z2491]
 gi|121052796|emb|CAM09142.1| DNA repair protein (recombination protein o) [Neisseria
           meningitidis Z2491]
          Length = 264

 Score = 95.6 bits (236), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 41/234 (17%), Positives = 73/234 (31%), Gaps = 16/234 (6%)

Query: 8   IILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLAQN 65
            +L    + E ++ +E  +R+YGR     R+ +  +   + +L    LV  +W       
Sbjct: 13  FLLASSPWRESSLRVEAFSRRYGRVALLARSARKRQSELRGVLVPFVLVSASWYGSQELK 72

Query: 66  LGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPS 125
                                   GL     + +     +P  ELYD L   +      +
Sbjct: 73  TLH---RAEWIGGWPQPQGRALFSGLYVNELMLKLTVREDPLPELYDALAEVMEAVCCKA 129

Query: 126 VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGL----PYAE 181
                  + E  LL  +G   DL +    G          +   AV          P+A 
Sbjct: 130 AYIDDLRRFEWRLLNLLGVAPDLNRDGDGGTIAAGGTYLVRPETAVFPVGKGFAVPPHAA 189

Query: 182 KMLVLPSFLWK--EEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFL 233
            ++     L    E     A+SL+ A ++T  F+    L    +     R+   
Sbjct: 190 GVVAPGQSLIDLREGSFRTAESLQQALKITRLFI--RHLLPEGL---KSRQVLE 238


>gi|17865561|sp|Q9JT15|RECO_NEIMA RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|6274541|gb|AAF06689.1|AF163663_14 putative DNA repair protein homolog RecO [Neisseria meningitidis]
          Length = 263

 Score = 95.6 bits (236), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 41/234 (17%), Positives = 73/234 (31%), Gaps = 16/234 (6%)

Query: 8   IILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLAQN 65
            +L    + E ++ +E  +R+YGR     R+ +  +   + +L    LV  +W       
Sbjct: 12  FLLASSPWRESSLRVEAFSRRYGRVALLARSARKRQSELRGVLVPFVLVSASWYGSQELK 71

Query: 66  LGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPS 125
                                   GL     + +     +P  ELYD L   +      +
Sbjct: 72  TLH---RAEWIGGWPQPQGRALFSGLYVNELMLKLTVREDPLPELYDALAEVMEAVCCKA 128

Query: 126 VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGL----PYAE 181
                  + E  LL  +G   DL +    G          +   AV          P+A 
Sbjct: 129 AYIDDLRRFEWRLLNLLGVAPDLNRDGDGGTIAAGGTYLVRPETAVFPVGKGFAVPPHAA 188

Query: 182 KMLVLPSFLWK--EEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFL 233
            ++     L    E     A+SL+ A ++T  F+    L    +     R+   
Sbjct: 189 GVVAPGQSLIDLREGSFRTAESLQQALKITRLFI--RHLLPEGL---KSRQVLE 237


>gi|289578135|ref|YP_003476762.1| DNA repair protein RecO [Thermoanaerobacter italicus Ab9]
 gi|289527848|gb|ADD02200.1| DNA repair protein RecO [Thermoanaerobacter italicus Ab9]
          Length = 248

 Score = 95.6 bits (236), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 36/177 (20%), Positives = 67/177 (37%), Gaps = 2/177 (1%)

Query: 4   QDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNW-RSRL 62
           + +AI+L   S GE + +  + T+ YG+     +  +  + + +      +  N+     
Sbjct: 5   KTEAIVLKNNSIGETDKMATLFTKNYGKLRAVAKGARRSKSRFVNAIRPFMVANYVIFEG 64

Query: 63  AQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHK 122
                  ++E++ESH         F         + + L E +   +LY  L        
Sbjct: 65  QNYYYIDQWELIESHKNIEKDLVKFSVASYISETVNKILEENQKSEKLYQFLKHSFKAVD 124

Query: 123 IPSVIGKIFVQ-IELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
              +   IF+    L L+  +G+   L  C+V G  +DL + S   GG VC      
Sbjct: 125 ELQIDPLIFIASYNLKLVSLLGYMPQLDNCIVCGKREDLKYFSNSCGGVVCTICKNK 181


>gi|83589465|ref|YP_429474.1| DNA replication and repair protein RecO [Moorella thermoacetica
           ATCC 39073]
 gi|119361465|sp|Q2RKV8|RECO_MOOTA RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|83572379|gb|ABC18931.1| DNA replication and repair protein RecO [Moorella thermoacetica
           ATCC 39073]
          Length = 267

 Score = 95.6 bits (236), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 34/218 (15%), Positives = 68/218 (31%), Gaps = 16/218 (7%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRS 60
           +Q + I+L  R Y E + +L ++TR +G+    V+  +  R   +   Q     R  + +
Sbjct: 5   FQAEGIVLKSRDYQETDQLLTILTRTHGKLEAIVKGVRKPRSSLRSGTQQLCRSRFLFYA 64

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
             +           E +           Y    +      +   +    +Y +L   L  
Sbjct: 65  GKSLATVTQCEVQ-EIYGPLRQDLKRLAYAYYLVEIADGVVMPGQVNQAMYLLLQQGLEA 123

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVT---QDLLWVSPKSGGAVCRSVGL 177
                    +    E   LK +G    L  C +          + ++P +GGA+C     
Sbjct: 124 L-GELEPALVARAFEARTLKLLGLAPRLEACALCQRELKGNGRVAIAPAAGGALCPEC-- 180

Query: 178 PYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNK 215
               +      +L           L    +L   +L +
Sbjct: 181 ----RGHQGREYLVSRGGVKTWQQLN---RLNWSYLKR 211


>gi|300087574|ref|YP_003758096.1| DNA repair protein RecO [Dehalogenimonas lykanthroporepellens
           BL-DC-9]
 gi|299527307|gb|ADJ25775.1| DNA repair protein RecO [Dehalogenimonas lykanthroporepellens
           BL-DC-9]
          Length = 264

 Score = 95.6 bits (236), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 45/233 (19%), Positives = 76/233 (32%), Gaps = 17/233 (7%)

Query: 2   YWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQ--SHRMQPILQAGNLVRVNWR 59
             +  AI++      E + I+   TR+ GR     R  +  S R+   L+  N   +   
Sbjct: 6   ELKTPAIVIRRARLKEADRIITFFTRELGRVSALARGVRKPSSRLAGHLEPLNHTDLTLA 65

Query: 60  SRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLN 119
                       + L  H     S     Y L     + RF PE E    ++D+L   L+
Sbjct: 66  M-GKALPTIIGSQTLNPHLCLRSSLERTSYALYFAELVARFTPEEEANRRVFDLLAEALD 124

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGV-TQDLLWVSPKSGGAV------C 172
                  +  +    E+ LL  +G+   L  C+  G   +        S G V       
Sbjct: 125 AACDADNLELLARYFEVNLLAALGYQPRLGACLDCGKALKTETNYFANSLGGVLCPQCAS 184

Query: 173 RSVGLPYAEKMLVLPSFLWKEEQTIDADSLK-SAFQ-----LTDYFLNKYALQ 219
           R+   P +   L +  FL        A  +           L   +L ++ L+
Sbjct: 185 RAPVAPVSVNALKVLRFLDDHSLEQSARLILDDGLNREIRQLLGAYL-RFLLE 236


>gi|297544410|ref|YP_003676712.1| DNA repair protein RecO [Thermoanaerobacter mathranii subsp.
           mathranii str. A3]
 gi|296842185|gb|ADH60701.1| DNA repair protein RecO [Thermoanaerobacter mathranii subsp.
           mathranii str. A3]
          Length = 248

 Score = 95.6 bits (236), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 36/177 (20%), Positives = 67/177 (37%), Gaps = 2/177 (1%)

Query: 4   QDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNW-RSRL 62
           + +AI+L   S GE + +  + T+ YG+     +  +  + + +      +  N+     
Sbjct: 5   KTEAIVLKNNSIGETDKMATLFTKNYGKLRAVAKGARRSKSRFVNAIRPFMVANYVIFEG 64

Query: 63  AQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHK 122
                  ++E++ESH         F         + + L E +   +LY  L        
Sbjct: 65  QNYYYIDQWELIESHKNIEKDLVKFSVASYISETVNKILEENQKSEKLYQFLKHSFKAVN 124

Query: 123 IPSVIGKIFVQ-IELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
              +   IF+    L L+  +G+   L  C+V G  +DL + S   GG VC      
Sbjct: 125 ELQIDPLIFIVSYNLKLVSLLGYMPQLDNCIVCGKREDLKYFSNSCGGVVCTICKNK 181


>gi|119897935|ref|YP_933148.1| DNA repair protein RecO [Azoarcus sp. BH72]
 gi|166221882|sp|A1K606|RECO_AZOSB RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|119670348|emb|CAL94261.1| DNA repair protein RecO (recombination protein O) [Azoarcus sp.
           BH72]
          Length = 243

 Score = 95.6 bits (236), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 30/151 (19%), Positives = 57/151 (37%), Gaps = 5/151 (3%)

Query: 7   AIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLAQ 64
           A +L    + E ++I+EV +R +GR     +  +      + +L A   + ++W      
Sbjct: 12  AWVLHTLPWRETSLIVEVFSRDHGRLALVAKGARRPHSAFRGVLMAFQPLLMDWSGGGEV 71

Query: 65  NLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIP 124
                           LL+    L G      L +  P  +P   L+      +    + 
Sbjct: 72  RT---LVRAEWQGGQPLLTGQALLCGYYLNELLVKLTPRDDPHPNLFVAYADAVRELGLG 128

Query: 125 SVIGKIFVQIELMLLKNIGFGLDLTKCVVTG 155
                +  Q EL LL+ +G+G++L   V +G
Sbjct: 129 RPPPPVLRQFELALLQELGYGIELVHDVQSG 159


>gi|221135231|ref|ZP_03561534.1| DNA repair protein RecO [Glaciecola sp. HTCC2999]
          Length = 242

 Score = 95.6 bits (236), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 40/242 (16%), Positives = 82/242 (33%), Gaps = 21/242 (8%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLA 63
              +L  R+Y E + ++++++ + G+     R  +S +   + +LQ    +      +  
Sbjct: 10  TGFVLHRRAYQESSFLVDILSLEAGKIRCVARGMRSAKSDRKSVLQPFQPIACELTGKSE 69

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKI 123
               +      +S     L  +    G+     + R LP   PC ++ +     L     
Sbjct: 70  LKSVKNAENTDKSIP---LQHTSLFCGMYLNELINRVLPSNIPCPDIVNDYYETLKQLHT 126

Query: 124 --------PSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGV-TQDLLWVSPKSGGAVCRS 174
                              EL LL  +G+  DL+  V T    +D +     S   +   
Sbjct: 127 SQKFNSTLQPHQEAQLRCFELNLLAELGYLPDLSCEVRTQTAIEDDMDYVFISDQGLFLK 186

Query: 175 VGLPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENFL 233
              P+   +          ++    +SL++A  +T     + A Q  +       RE F+
Sbjct: 187 QWYPHLTSVKGQWINDALAQR-WHPESLRTAKWIT-----RQAFQPLLGDKPLKSRELFV 240

Query: 234 GK 235
            K
Sbjct: 241 SK 242


>gi|188585832|ref|YP_001917377.1| DNA repair protein RecO [Natranaerobius thermophilus JW/NM-WN-LF]
 gi|179350519|gb|ACB84789.1| DNA repair protein RecO [Natranaerobius thermophilus JW/NM-WN-LF]
          Length = 257

 Score = 95.3 bits (235), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 34/194 (17%), Positives = 77/194 (39%), Gaps = 2/194 (1%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRL 62
           +  DA+++  R Y + + I+ + T  YGR    V+  +  + +      +    N++   
Sbjct: 5   YNSDAVVIRSRDYRDYDKIINLFTPYYGRVSAVVKGVKKPKSKLAGIVQSFTYGNYQLYS 64

Query: 63  AQNLGEFRFEVLESHCAKLLSSSLFLYGLQSI-VPLFRFLPEREPCLELYDMLNIFLNCH 121
            ++LG      +     +L +  + +     I   + + +PE E    L+ +     +  
Sbjct: 65  GKSLGRLVQGKVLHGFQELRTDLVLMSAGMCILELIDKAIPEGEEYPALFGVTLSCFHLL 124

Query: 122 KIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVT-QDLLWVSPKSGGAVCRSVGLPYA 180
           +       +    E  L+ N+G   +L+ C+  G   Q  L+  P++GG +C +      
Sbjct: 125 EKSYPPSLVLRIFEAKLIHNLGVSPELSGCINHGSITQGNLYFDPETGGLICETCFEQLT 184

Query: 181 EKMLVLPSFLWKEE 194
           E      +F  ++ 
Sbjct: 185 ENRGPGRAFPVEKG 198


>gi|212636521|ref|YP_002313046.1| Recombination protein O, RecO [Shewanella piezotolerans WP3]
 gi|212558005|gb|ACJ30459.1| Recombination protein O, RecO [Shewanella piezotolerans WP3]
          Length = 237

 Score = 95.3 bits (235), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 37/235 (15%), Positives = 73/235 (31%), Gaps = 12/235 (5%)

Query: 5   DDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM-QPILQAGNLVRVNWRSRLA 63
           +   +L  R + E ++++ ++    GR     R G S    + I+Q    +    + +  
Sbjct: 2   ERGYVLHTRPFRESSVLVNLLVDGKGRVDAVARLGSSKNSIRSIVQPFQPLIFQLQGKSD 61

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKI 123
                   +V  +  A  L+ +    GL     L R L  +     L+   +  L     
Sbjct: 62  LKN---LKQVEAASPAVPLTGNCLYSGLYLNELLIRCLTVQHSAENLFFNYHQTLIAMAK 118

Query: 124 PSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA-EK 182
                ++    EL LL+ +G    L             +   +        +   Y   K
Sbjct: 119 EFNQSQLR-YFELALLQELGTMPSLEYDPSGAAMTASGFYRLEIEHGFMPVIATQYNQHK 177

Query: 183 MLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENFLGKL 236
                     ++Q++ A     A +     L +  L   +       R  FL K+
Sbjct: 178 FFTGEMLFALKKQSLSATHFAEAKK-----LMRQLLAPTLGDKPLHSRNLFLKKM 227


>gi|225182108|ref|ZP_03735536.1| DNA repair protein RecO [Dethiobacter alkaliphilus AHT 1]
 gi|225167195|gb|EEG76018.1| DNA repair protein RecO [Dethiobacter alkaliphilus AHT 1]
          Length = 247

 Score = 95.3 bits (235), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 37/173 (21%), Positives = 66/173 (38%), Gaps = 1/173 (0%)

Query: 4   QDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQ-PILQAGNLVRVNWRSRL 62
           +  AI+L  R Y E + ++ ++TR  G+     R  +  + +   L     +      R 
Sbjct: 5   RSPAIVLRGRDYREADRLVTLLTRDAGKVTVVARGTKKTKSKFSALVEPLTLGHFLLRRG 64

Query: 63  AQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHK 122
                  + E+++ + +      LF Y         R LPE EP + ++ +L   L   +
Sbjct: 65  KSLDTLIQGEIIKPYNSLRKDLLLFTYAQYFCEVCERSLPENEPAVPVFTLLLTALETLE 124

Query: 123 IPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSV 175
             +   ++    EL LL  +GF   L  C   G        +P  GG +C   
Sbjct: 125 TEADSARVARCFELNLLDELGFRPVLDACCTCGTATGPFLFTPGHGGLLCGHC 177


>gi|331004917|ref|ZP_08328331.1| DNA recombination and repair protein RecO [gamma proteobacterium
           IMCC1989]
 gi|330421267|gb|EGG95519.1| DNA recombination and repair protein RecO [gamma proteobacterium
           IMCC1989]
          Length = 229

 Score = 95.3 bits (235), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 36/235 (15%), Positives = 81/235 (34%), Gaps = 18/235 (7%)

Query: 10  LGVRSYGEKNIILEVMTRQYGRHLGFVRNGQ-----SHRMQPILQAGNLVRVNWRSRLAQ 64
           L  R Y + +++++++++ +G+     R  +     S   + +LQ    + ++W  +   
Sbjct: 2   LHTRPYRDTSLLVDILSQSHGKLTLIARGARKTSKSSQNPRHLLQPFMPLSLSWTGKGTL 61

Query: 65  NLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCH-KI 123
                   +  +  A  L        + +   L   L E +P  ++Y      L+     
Sbjct: 62  KT---LTTMEAAAPAIPLIGHHLYSAMYANELLVYLLQEGDPNEDIYVHYEKLLSMLSNT 118

Query: 124 PSVIGKIFVQIELMLLKNIGFGLDLTKCVVTG--VTQDLLWVSPKSGGAVCRSVGLPYAE 181
              I     Q E  LL  +G+ +  +    T   +     +      G V  +       
Sbjct: 119 QYSIEAALRQFEFALLAVLGYEIGFSHDAETQLPLKASEYYYYVHEQGFVAANAHPEIRG 178

Query: 182 KMLVLPSFLWKEEQTID-ADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENFLG 234
                 S L       +  ++L++A Q+      + AL+  + +     +E FL 
Sbjct: 179 MSFDGESLLGISVSNYERPNTLQAAKQI-----ARMALKPYLRNRPLHSKELFLS 228


>gi|307266974|ref|ZP_07548491.1| DNA repair protein RecO [Thermoanaerobacter wiegelii Rt8.B1]
 gi|306918023|gb|EFN48280.1| DNA repair protein RecO [Thermoanaerobacter wiegelii Rt8.B1]
          Length = 248

 Score = 95.3 bits (235), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 38/177 (21%), Positives = 69/177 (38%), Gaps = 2/177 (1%)

Query: 4   QDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNW-RSRL 62
           + +AI+L     GE + I  + T+ YG+     +  +  + + +      V  N+     
Sbjct: 5   KTEAIVLKNNLIGETDKIATLFTKSYGKLQAVAKGARRSKSRFVNAIRLFVVANYVIFEG 64

Query: 63  AQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHK 122
                  ++E++E+H       + F         + + L E +    LY  L   L    
Sbjct: 65  QNYYYIDQWELIEAHKNIEKDLAKFSVASYIAETINKILEENQKSERLYLFLKHSLKAVD 124

Query: 123 IPSVIGKIFV-QIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
              +   IF+    L L+  +G+   L  CVV G  ++L + S   GGAVC +    
Sbjct: 125 ELQIDPLIFISSYNLKLVSLLGYMPQLDNCVVCGKRENLKYFSNSCGGAVCINCKNK 181


>gi|302391465|ref|YP_003827285.1| DNA repair protein RecO [Acetohalobium arabaticum DSM 5501]
 gi|302203542|gb|ADL12220.1| DNA repair protein RecO [Acetohalobium arabaticum DSM 5501]
          Length = 251

 Score = 95.3 bits (235), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 33/180 (18%), Positives = 61/180 (33%), Gaps = 4/180 (2%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNW-RSR 61
           ++ +AI+L      E + I+ + TRQ+G+        +  + +           ++   +
Sbjct: 4   YKTEAIVLKYYELKEADKIIVLYTRQHGKVQAVANGARKTKSRLAGSVELFTYSDFLLYQ 63

Query: 62  LAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCH 121
                   + E++ S  +         Y    +  +  F  + E    L+ +L   L   
Sbjct: 64  GKSLSTISQTEIINSFASLRDDLFKMAYASYVVEVVNEFTVDEEKNEPLFALLLATLYML 123

Query: 122 KIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTG---VTQDLLWVSPKSGGAVCRSVGLP 178
                +       EL LL  +G+   L  CV         D +  S K GG VC    L 
Sbjct: 124 DRGEELELATRFFELRLLNLLGYRPQLDACVDCDLDLAKIDKVKFSSKLGGVVCADCALE 183


>gi|302038212|ref|YP_003798534.1| putative DNA repair protein RecO [Candidatus Nitrospira defluvii]
 gi|300606276|emb|CBK42609.1| putative DNA repair protein RecO [Candidatus Nitrospira defluvii]
          Length = 252

 Score = 94.9 bits (234), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 34/178 (19%), Positives = 66/178 (37%), Gaps = 5/178 (2%)

Query: 4   QDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQ--PILQAGNLVRVNWRSR 61
           +  AI+L  R +G+ + I+   T + G+  G  R  +  + +   +++   L +++   +
Sbjct: 5   KTAAIVLHSRKWGDADRIVTFYTMRLGKLRGVARGARRLKSRLGGMIEPFTLCQLDLFEK 64

Query: 62  LAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPER-EPCLELYDMLNIFLNC 120
              +L       L+   AK       +     +V L   +    +P   +++ML   L  
Sbjct: 65  PGDSLYRISQVALDEPFAKFRDDLTLMTAAGRMVNLVSAVMAEGDPEPRVFEMLESGLRT 124

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQ--DLLWVSPKSGGAVCRSVG 176
                      +  ++ LL   GF     +C   G      L   SP +GG VC    
Sbjct: 125 LLESRDAAWTTLLFQIRLLGMTGFRPQTEQCATCGQVHRSPLPQFSPMAGGIVCERCA 182


>gi|255065035|ref|ZP_05316890.1| DNA repair protein RecO [Neisseria sicca ATCC 29256]
 gi|255050456|gb|EET45920.1| DNA repair protein RecO [Neisseria sicca ATCC 29256]
          Length = 262

 Score = 94.9 bits (234), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 37/233 (15%), Positives = 65/233 (27%), Gaps = 16/233 (6%)

Query: 8   IILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLAQN 65
            +L    + E ++ +EV +R+YGR     R+ +  +   + +L     V  +W       
Sbjct: 28  FLLASAPWRESSLWVEVFSRRYGRVALLARSARKRQSELRGVLVPFVPVSASWYGSQELK 87

Query: 66  LGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPS 125
                                   GL     + +     +P  ELYD L   +      S
Sbjct: 88  TLH---RAEWIGGWPQPQGRALFSGLYINELMLKLTTREDPIPELYDALEAVMRAVCGES 144

Query: 126 VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKMLV 185
                  + E  LL  +GF  DL         +           AV              
Sbjct: 145 GHTAALRRFEWTLLNRLGFAPDLFHDGNGEAIRAEETYWLTPENAVVPIEEAERFNPRNH 204

Query: 186 LP------SFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENF 232
                       +E      +SL  + ++T   ++   L    I     R+  
Sbjct: 205 GVAIGGDILIQLREGDFTHPESLGQSLKITRLLIDN--LLPEGI---KSRQVL 252


>gi|254796817|ref|YP_003081654.1| DNA repair protein RecO [Neorickettsia risticii str. Illinois]
 gi|254590066|gb|ACT69428.1| DNA repair protein RecO [Neorickettsia risticii str. Illinois]
          Length = 238

 Score = 94.9 bits (234), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 63/203 (31%), Positives = 103/203 (50%), Gaps = 8/203 (3%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W+++ I+L  +   E   +  + T+ YG   G          +  +  GN+V   W +
Sbjct: 1   MQWENEGIVLSNKGLVENKAVTTLFTKDYGLKRGLC------SRKATIDVGNVVYCKWSA 54

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSI-VPLFRFLPEREPCLELYDMLNIFLN 119
           RL   LG FR EV E     L +    L  L ++   L + LPE EP  E+Y +    L 
Sbjct: 55  RLESQLGYFRVEVKEIISPFLFTDYKKLKLLNAVLSILLKVLPENEPQKEIYKIFIQLLQ 114

Query: 120 CHKIPSVIGKIFVQ-IELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
             K  +         ++L +L+++GF LDL++C VTG T++L ++SPK+G AV ++VG  
Sbjct: 115 AFKSETSCYYRQYIEMDLSILRHLGFQLDLSRCTVTGETKNLFYISPKTGRAVTKAVGEA 174

Query: 179 YAEKMLVLPSFLWKEEQTIDADS 201
           Y +K+L+LP  L+K    +  + 
Sbjct: 175 YKDKLLLLPPSLYKIANGLSLED 197


>gi|226943501|ref|YP_002798574.1| DNA repair protein RecO [Azotobacter vinelandii DJ]
 gi|226718428|gb|ACO77599.1| DNA repair protein RecO [Azotobacter vinelandii DJ]
          Length = 230

 Score = 94.9 bits (234), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 40/231 (17%), Positives = 76/231 (32%), Gaps = 12/231 (5%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQN 65
            A IL  R Y E +++ +  T   GR    +R+ +  +   + +    + +  R R    
Sbjct: 5   PAFILHSRPYRESSVLADFFTP-QGRLRAAMRSARG-KSGSLARPFVPLELVLRGRSELK 62

Query: 66  LGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPS 125
                  +  +   + L+ +    GL     L R LP  +P   L++  ++ L+   +  
Sbjct: 63  S---VARLESNGSPRWLTGASLFSGLYLNELLIRLLPPEDPFPSLFEHYSLTLDALAVGR 119

Query: 126 VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKMLV 185
            +  +    E  LL  +G+G  L + +     Q            V           +  
Sbjct: 120 PLEPLLRAFEWRLLVELGYGFSLDRDLNGQSVQVRRLYRLLPD--VGLEPVDQLQPGLFS 177

Query: 186 LPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHL-LRENFLGK 235
               L   E         +A +     L + AL  ++    L  RE F   
Sbjct: 178 GGELLAMAEADWRFPGALAAAKR----LMRQALAPHLGGRPLVSRELFTNL 224


>gi|15676358|ref|NP_273494.1| DNA repair protein (recombination protein o) [Neisseria
           meningitidis MC58]
 gi|17865562|sp|Q9K0W0|RECO_NEIMB RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|7225672|gb|AAF40884.1| DNA repair protein RecO [Neisseria meningitidis MC58]
 gi|316985790|gb|EFV64733.1| DNA repair protein RecO [Neisseria meningitidis H44/76]
 gi|325140961|gb|EGC63468.1| DNA repair protein RecO [Neisseria meningitidis CU385]
 gi|325199634|gb|ADY95089.1| DNA repair protein RecO [Neisseria meningitidis H44/76]
          Length = 263

 Score = 94.9 bits (234), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 42/234 (17%), Positives = 74/234 (31%), Gaps = 16/234 (6%)

Query: 8   IILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLAQN 65
            +L    + E ++ +E  +R+YGR     R+ +  +   + +L     V V+W       
Sbjct: 12  FMLASSPWRESSLWVEAFSRRYGRVALLARSARKRQSELRGVLVPFVPVSVSWYGSQELK 71

Query: 66  LGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPS 125
                  V                GL     + +     +P  ELYD L   +      +
Sbjct: 72  TLHRAEWVGGWRQP---QGRALFGGLYVNELVLKLTAREDPVPELYDALAEVMEAVCCKA 128

Query: 126 VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGL----PYAE 181
                  + E  LL  +G   DL +    G          +   AV          P+A 
Sbjct: 129 AYIDDLRRFEWRLLNLLGVAPDLNRDGDGGTIAAGGTYLVRPETAVFPVGKGFAVPPHAA 188

Query: 182 KMLVLPSFLWK--EEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFL 233
            ++     L    E     A+SL+ A ++T  F+    L    +     R+   
Sbjct: 189 GVVAPGQSLIDLREGSFRTAESLQQALKITRLFI--RHLLPEGL---KSRQVLE 237


>gi|308234875|ref|ZP_07665612.1| DNA repair protein RecO [Gardnerella vaginalis ATCC 14018]
          Length = 244

 Score = 94.9 bits (234), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 37/241 (15%), Positives = 78/241 (32%), Gaps = 23/241 (9%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQ--PILQAGNLVRVNWRS 60
           + D+A++L     GE + I+ ++T+++G+     +  +  + +    L+    V   + +
Sbjct: 4   YNDEAVVLKTFPLGEADRIVVMLTKKHGKIRAVAKGVRKIKSRFGARLEPFMRVNALFAT 63

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
               ++      V     +      L+             +       +     N+ +  
Sbjct: 64  GRTFDVVSQAVLVSAYAESICADYDLYSRASMIAEIADDLVSSSAQYQDSCMQYNLLVAA 123

Query: 121 HK----IPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVG 176
                        I     L  LK  G+   L +CVV     DL + S  SGG +C    
Sbjct: 124 LSALSRGLHSADSIGFSYVLRALKLAGWSPMLNECVVCATKDDLSYFSSCSGGVMCSKDH 183

Query: 177 LPYAEKMLVLPSFLWKEEQTIDADSLKSAFQL-----------TDYFLNK-----YALQH 220
              + K   L  F        D  ++     +            +Y+L +     + L++
Sbjct: 184 DLQSIKCNGLARFQMISLINGDWKNI-DGTDIDYLTYRCVEQWCEYYLERPIKSMHLLEN 242

Query: 221 N 221
           N
Sbjct: 243 N 243


>gi|329934670|ref|ZP_08284711.1| DNA recombination and repair protein RecO [Streptomyces
           griseoaurantiacus M045]
 gi|329305492|gb|EGG49348.1| DNA recombination and repair protein RecO [Streptomyces
           griseoaurantiacus M045]
          Length = 248

 Score = 94.9 bits (234), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 37/211 (17%), Positives = 80/211 (37%), Gaps = 14/211 (6%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQ--PILQAGNLVRVNWRS 60
           ++DD I+L  +  GE + I+ ++TR +GR     R  +  + +    L+  + V V + S
Sbjct: 4   FRDDGIVLRTQKLGEADRIITLLTRGHGRVRAVARGVRRTKSKFGARLEPFSHVDVQFFS 63

Query: 61  RLAQNLG-----EFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLEL--YDM 113
           + ++ +G       + E +  +   +++         +++       + E    +  Y +
Sbjct: 64  KGSELIGRGLPLCTQSETIAPYGGGIVTDYARYTAGTAMLETAERFTDHEGEPAVQQYLL 123

Query: 114 LNIFLNCHKIPSVIGKIFVQIELMLLKNI---GFGLDLTKCVVTGVTQDLLWVSPKSGGA 170
           L   L           +   ++  LL+++   G+      C   G+     + S  SGG 
Sbjct: 124 LVGGLRTLSRDEHAPHLV--LDAFLLRSLAVNGYAPSFGDCAKCGMPGPNRFFSVASGGV 181

Query: 171 VCRSVGLPYAEKMLVLPSFLWKEEQTIDADS 201
           VC    +P +         L     T D  +
Sbjct: 182 VCADCRVPGSVVPSPQALELLGALLTGDWAT 212


>gi|330811508|ref|YP_004355970.1| DNA repair protein [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327379616|gb|AEA70966.1| DNA repair protein [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 229

 Score = 94.9 bits (234), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 29/151 (19%), Positives = 53/151 (35%), Gaps = 5/151 (3%)

Query: 7   AIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQNL 66
           A +L  R+Y E + +++ +T   GR    +R  +  +   + +    + V +R R     
Sbjct: 11  AYVLHSRAYRESSALVDFLTP-QGRLRAVLRGARG-KAGTLARPFVPLEVEFRGRGELKN 68

Query: 67  GEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPSV 126
                       A  L+      GL     L R LP  +P   ++D     L        
Sbjct: 69  VGRMESN---GVAAWLNGEALFSGLYLNELLIRLLPAEDPHPAVFDHYAATLLALAEGRP 125

Query: 127 IGKIFVQIELMLLKNIGFGLDLTKCVVTGVT 157
           +  +    E  LL ++G+G  L   +     
Sbjct: 126 LEPLLRSFEWRLLDDLGYGFALNTDLHGEPI 156


>gi|261365754|ref|ZP_05978637.1| DNA repair protein RecO [Neisseria mucosa ATCC 25996]
 gi|288565714|gb|EFC87274.1| DNA repair protein RecO [Neisseria mucosa ATCC 25996]
          Length = 246

 Score = 94.9 bits (234), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 36/233 (15%), Positives = 65/233 (27%), Gaps = 16/233 (6%)

Query: 8   IILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLAQN 65
            +L    + E ++ +EV +R+YGR     R+ +  +   + +L     V  +W       
Sbjct: 12  FLLASAPWRESSLWVEVFSRRYGRVALLARSARKRQSELRGVLVPFVPVSASWYGSQELK 71

Query: 66  LGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPS 125
                                   GL     + +     +P  ELYD L   +      +
Sbjct: 72  TLH---RAEWIGGWPQPQGRALFSGLYINELMLKLTAREDPIPELYDALEAVMRAVCGEN 128

Query: 126 VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKMLV 185
                  + E  LL  +GF  DL         +           AV              
Sbjct: 129 SHTAALRRFEWALLTRLGFAPDLFHDGNGEAIRAEETYWLTPENAVVPIEEAERFNPRNH 188

Query: 186 LP------SFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENF 232
                       +E      +SL  + ++T   ++   L    I     R+  
Sbjct: 189 GVAVSGDILIQLREGDFTHPESLGQSLKITRLLIDN--LLPEGI---KSRQVL 236


>gi|328882348|emb|CCA55587.1| DNA recombination and repair protein RecO [Streptomyces venezuelae
           ATCC 10712]
          Length = 249

 Score = 94.9 bits (234), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 35/211 (16%), Positives = 80/211 (37%), Gaps = 14/211 (6%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQ--PILQAGNLVRVNWRS 60
           ++DD I+L  +  GE + I+ ++TR +GR     R  +  + +    L+  + V V + +
Sbjct: 4   FRDDGIVLRTQKLGEADRIITLLTRGHGRVRAVARGVRRTKSKFGARLEPFSHVDVQFFA 63

Query: 61  RLAQNLG-----EFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLEL--YDM 113
           R ++ +G       + E +  +   +++         +++       + E    +  Y +
Sbjct: 64  RGSELVGRGLPLCTQSETIAPYGGGIVTDYARYTAGTAMLETAERFTDHEGEPAVQQYLL 123

Query: 114 LNIFLNCHKIPSVIGKIFVQIELMLLKNI---GFGLDLTKCVVTGVTQDLLWVSPKSGGA 170
           L   L           +   ++  LL+++   G+      C   G+     + S  +GG 
Sbjct: 124 LVGGLRTLARGEHAPHL--ILDAFLLRSLAVNGYAPSFEDCAKCGIHGPNRFFSVAAGGV 181

Query: 171 VCRSVGLPYAEKMLVLPSFLWKEEQTIDADS 201
           +C    +P +         L     T D  +
Sbjct: 182 ICGDCRVPGSVVPSPEAIGLLSALLTGDWAT 212


>gi|309378286|emb|CBX23074.1| unnamed protein product [Neisseria lactamica Y92-1009]
          Length = 263

 Score = 94.9 bits (234), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 42/234 (17%), Positives = 74/234 (31%), Gaps = 16/234 (6%)

Query: 8   IILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLAQN 65
            +L    + E ++ +E  +R+YGR     R+ +  +   + +L     V V+W       
Sbjct: 12  FMLASSPWRESSLWVEAFSRRYGRVALLARSARKRQSELRGVLVPFVPVSVSWYGSQELK 71

Query: 66  LGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPS 125
                  V                GL     + +     +P  ELYD L   +      +
Sbjct: 72  TLHRAEWVGGWRQP---QGRALFGGLYVNELVLKLTAREDPVPELYDALAKVMEAVCCKA 128

Query: 126 VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGL----PYAE 181
                  + E  LL  +G   DL +    G          +   AV          P+A 
Sbjct: 129 AYIDDLRRFEWRLLNLLGVAPDLNRDGDGGTIAAGGTYLVRPETAVFPVGKGFAVPPHAA 188

Query: 182 KMLVLPSFLWK--EEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFL 233
            ++     L    E     A+SL+ A ++T  F+    L    +     R+   
Sbjct: 189 GVVAPGQSLIDLREGSFRTAESLQQALKITRLFI--RHLLPEGL---KSRQVLE 237


>gi|262277164|ref|ZP_06054957.1| DNA repair protein RecO [alpha proteobacterium HIMB114]
 gi|262224267|gb|EEY74726.1| DNA repair protein RecO [alpha proteobacterium HIMB114]
          Length = 208

 Score = 94.5 bits (233), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 53/239 (22%), Positives = 94/239 (39%), Gaps = 32/239 (13%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M W D   +L V +  E + +++V +R++G   G V    S + +P LQ GN +++N+ S
Sbjct: 1   MRWSDIGYLLSVSATKENSSLVKVFSREHGCVTGVVYGSSSKKKKPDLQIGNKIKLNFNS 60

Query: 61  RLAQNLGEFRFEVLESHCAKLLSS-SLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLN 119
           +    LG F  E++E+   K  +        + SI  + + +PE++   E +D  +  + 
Sbjct: 61  KNEDALGYFSIELMENISIKFFNDLKKLNLLIISIEVISKIMPEQQKYTECFDEYDQLIK 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
             +  S+   +    E   LKNIG+G+DL +                             
Sbjct: 121 SLEGDSLKSYL--IWEFNFLKNIGYGVDLNE----------------------------- 149

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLLE 238
                V+ S L         + LK+ F L    ++   +    I     R   L  L E
Sbjct: 150 EGFNPVIKSILNGSSIDFTIEDLKAIFNLNSETISNRLVDVINITNFKNRPKILNYLNE 208


>gi|239931393|ref|ZP_04688346.1| DNA repair protein RecO [Streptomyces ghanaensis ATCC 14672]
 gi|291439766|ref|ZP_06579156.1| DNA repair protein RecO [Streptomyces ghanaensis ATCC 14672]
 gi|291342661|gb|EFE69617.1| DNA repair protein RecO [Streptomyces ghanaensis ATCC 14672]
          Length = 248

 Score = 94.5 bits (233), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 35/211 (16%), Positives = 82/211 (38%), Gaps = 14/211 (6%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQ--PILQAGNLVRVNWRS 60
           ++DD I+L  +  GE + I+ ++TR +GR     R  +  + +    L+  + V V + +
Sbjct: 4   FRDDGIVLRTQKLGEADRIITLLTRGHGRVRAVARGVRRTKSKFGARLEPFSHVDVQFFA 63

Query: 61  RLAQNLG-----EFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLEL--YDM 113
           + ++ +G       + E +  +   +++         +++       + E    +  Y +
Sbjct: 64  KGSELVGRGLPLCTQSETIAPYGGGIVTDYARYTAGTAMLETAERFTDHEGEPAVQQYLL 123

Query: 114 LNIFLNCHKIPSVIGKIFVQIELMLLKNI---GFGLDLTKCVVTGVTQDLLWVSPKSGGA 170
           L   L           +   ++  LL+++   G+      C   G+     + S  SGG+
Sbjct: 124 LVGALRTLARGEHAPHLV--LDAFLLRSLAVNGYAPSFGDCAKCGMPGPNRFFSVASGGS 181

Query: 171 VCRSVGLPYAEKMLVLPSFLWKEEQTIDADS 201
           +C    +P +         L     T D ++
Sbjct: 182 LCVDCRVPGSVVPSPQALELLGALLTGDWET 212


>gi|282861797|ref|ZP_06270861.1| DNA repair protein RecO [Streptomyces sp. ACTE]
 gi|282563613|gb|EFB69151.1| DNA repair protein RecO [Streptomyces sp. ACTE]
          Length = 248

 Score = 94.5 bits (233), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 36/211 (17%), Positives = 81/211 (38%), Gaps = 14/211 (6%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQ--PILQAGNLVRVNWRS 60
           ++DD ++L  +  GE + I+ ++TR +GR     R  +  + +    L+  + V V + +
Sbjct: 4   FRDDGVVLRTQKLGEADRIITILTRGHGRVRAVARGVRRTKSKFGARLEPFSHVDVQFFA 63

Query: 61  RLAQNLG-----EFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLEL--YDM 113
           R ++ +G       + E +  +   +++         +++       + E    +  Y +
Sbjct: 64  RGSELIGRGLPLCTQSETIAPYGGGIVADYGRYTAGTAMLETAERFTDHEGEPAVQQYLL 123

Query: 114 LNIFLNCHKIPSVIGKIFVQIELMLLKNI---GFGLDLTKCVVTGVTQDLLWVSPKSGGA 170
           L   L           +   ++  LL+++   G+      C   G+     + S  SGG 
Sbjct: 124 LVGGLRTLARAEHAPNL--ILDAFLLRSLAVNGYAPSFDDCARCGMPGPNRFFSVASGGV 181

Query: 171 VCRSVGLPYAEKMLVLPSFLWKEEQTIDADS 201
           VC    +P +         L     T D ++
Sbjct: 182 VCGDCRVPGSVVPSAEAVELLSALLTGDWET 212


>gi|251796249|ref|YP_003010980.1| DNA repair protein RecO [Paenibacillus sp. JDR-2]
 gi|247543875|gb|ACT00894.1| DNA repair protein RecO [Paenibacillus sp. JDR-2]
          Length = 249

 Score = 94.5 bits (233), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 37/178 (20%), Positives = 67/178 (37%), Gaps = 3/178 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQ--PILQAGNLVRVNW 58
           M ++ + I++    YGE N I+ ++T+  G+    VR  +  + +   + Q        +
Sbjct: 1   MLYRVEGIVIRSMDYGEGNKIITLLTKTNGKLGVMVRGAKKVKSRHASLAQPFTYGEFVF 60

Query: 59  RSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFL 118
             R          E+LESH        L  Y         + L E E    L++ L   L
Sbjct: 61  F-RNKGLGTLNAGEILESHHLLREQLDLAAYASYLAELTDKMLQEDESGAMLFEQLKAGL 119

Query: 119 NCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVG 176
              +       +    E+ +L+  G+  +L  CV     Q    ++P +GG +C    
Sbjct: 120 AAMEEGKDPQIVSHLFEMRILEAAGYAPELEICVNCSSEQGPFRLNPHAGGVLCTRCA 177


>gi|70728455|ref|YP_258204.1| DNA repair protein RecO [Pseudomonas fluorescens Pf-5]
 gi|92087031|sp|Q4KHS9|RECO_PSEF5 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|68342754|gb|AAY90360.1| DNA repair protein RecO [Pseudomonas fluorescens Pf-5]
          Length = 229

 Score = 94.5 bits (233), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 30/147 (20%), Positives = 56/147 (38%), Gaps = 5/147 (3%)

Query: 7   AIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQNL 66
           A +L  R+Y E + +++ +T   GR    +RN +  +   + +    + V +R R     
Sbjct: 11  AYVLHSRAYRESSALVDFLTP-QGRLRAVLRNARG-KAGTLARPFVPLEVEFRGRGELKN 68

Query: 67  GEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPSV 126
                 +  +  A  L+      GL     L R LP  +P   ++D     L        
Sbjct: 69  ---VGRMESAGIAAWLNGEALFSGLYLNELLIRLLPAEDPHPAVFDHYAATLLALAEGRP 125

Query: 127 IGKIFVQIELMLLKNIGFGLDLTKCVV 153
           +  +    E  LL ++G+G  L   + 
Sbjct: 126 LEPLLRAFEWRLLDDLGYGFALDSDIH 152


>gi|254521728|ref|ZP_05133783.1| DNA repair protein RecO [Stenotrophomonas sp. SKA14]
 gi|219719319|gb|EED37844.1| DNA repair protein RecO [Stenotrophomonas sp. SKA14]
          Length = 239

 Score = 94.5 bits (233), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 39/230 (16%), Positives = 72/230 (31%), Gaps = 14/230 (6%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRN---GQSHRMQPILQAGNLVRVN 57
           M   D   +L  R+Y E ++++EV++ Q+GR     R     +   ++  LQ    +R +
Sbjct: 2   MIEDDTGFVLHARAYRETSLLVEVLSAQHGRIGLLARGVSTAKGQVLRAALQPLQWIRFS 61

Query: 58  WRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
            + R           +     A  L     L G        R  P ++P  ELY      
Sbjct: 62  AQQRGELAQLRAAEALD---AAPRLVGQAMLAGFYLSELTLRLAPRQDPLPELYLAYGEA 118

Query: 118 LNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSG---GAVCRS 174
                + + +     + E  LL  +G G +L                         +   
Sbjct: 119 RARLAVGAGLAWTLRRFERELLSALGLGFELDSASDGQPIDPAARYELDPQEGAQRLLSE 178

Query: 175 VGLPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIH 224
            G                 ++  DA  L ++ +L      +  L H++  
Sbjct: 179 RGGERRAAATGSALLALAADEEPDATDL-ASLRLP----MRRVLAHHLGP 223


>gi|25028739|ref|NP_738793.1| DNA repair protein RecO [Corynebacterium efficiens YS-314]
 gi|259507800|ref|ZP_05750700.1| DNA repair protein RecO [Corynebacterium efficiens YS-314]
 gi|23494025|dbj|BAC18993.1| conserved hypothetical protein [Corynebacterium efficiens YS-314]
 gi|259164593|gb|EEW49147.1| DNA repair protein RecO [Corynebacterium efficiens YS-314]
          Length = 242

 Score = 94.5 bits (233), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 29/183 (15%), Positives = 65/183 (35%), Gaps = 3/183 (1%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQ--PILQAGNLVRVNWRS 60
           ++D A+++    +GE + I+ ++TR +G   G  +  +  + +    LQ    + V    
Sbjct: 6   YRDRALVVRTHDFGEADRIVVLLTRDHGIVRGVAKGVRRSKSRFGSRLQLFVELDVQLYP 65

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
                      + +  + + ++          +I+ +   +   E    L+D     L  
Sbjct: 66  -GRNLSTISGADTVGYYASGIIDDFKRYSAASAILEIASSIAPMEQGPYLFDATTAALQR 124

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
            +       +  +  L  + + G+   L  C   G         P +GGAVC       +
Sbjct: 125 MQNAEHPVLLLDEYMLRAMDHAGWAPSLFDCAQCGRPGPHTAFHPGAGGAVCLYCRPQGS 184

Query: 181 EKM 183
            K+
Sbjct: 185 AKI 187


>gi|254382925|ref|ZP_04998281.1| DNA repair protein recO [Streptomyces sp. Mg1]
 gi|194341826|gb|EDX22792.1| DNA repair protein recO [Streptomyces sp. Mg1]
          Length = 248

 Score = 94.5 bits (233), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 31/190 (16%), Positives = 75/190 (39%), Gaps = 14/190 (7%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQ--PILQAGNLVRVNWRS 60
           ++DD I+L  +  GE + I+ ++TR +GR     R  +  + +    L+  +   V + +
Sbjct: 4   FRDDGIVLRTQKLGEADRIITLLTRGHGRVRAVARGVRRTKSKFGAGLEPFSHADVQFFA 63

Query: 61  RLAQNLG-----EFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLEL--YDM 113
           R ++ +G       + +++  +   +++         +++       E E    +  Y +
Sbjct: 64  RGSELIGRSLPLCTQTQIIAPYGNGIVTDYARYTAGTAMLETAERFTENEGEPAVQQYLL 123

Query: 114 LNIFLNCHKIPSVIGKIFVQIELMLLKNI---GFGLDLTKCVVTGVTQDLLWVSPKSGGA 170
           L   L           +   ++  LL+++   G+      C   G+       S  +GG 
Sbjct: 124 LVGALRTLSRGEHEPHL--ILDAFLLRSLAVNGYAPSFDDCAKCGIHGPNRHFSVAAGGV 181

Query: 171 VCRSVGLPYA 180
           +C    +P +
Sbjct: 182 ICGDCRVPGS 191


>gi|42559491|sp|Q8RB48|RECO_THETN RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
          Length = 247

 Score = 94.5 bits (233), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 38/193 (19%), Positives = 74/193 (38%), Gaps = 3/193 (1%)

Query: 1   MYW-QDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNW- 58
           M + + +AI+L      EK+ I  + TR YG+     +  +  + + +      +  N+ 
Sbjct: 1   MRFLKTEAIVLKSNLISEKDKIATLFTRDYGKLQAVAKGARRSKSRFVNAVRPFIVANYV 60

Query: 59  RSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFL 118
                      ++E++++          F         + R L E++   +LY      L
Sbjct: 61  IFEGQNYYYIDQWELVKNFENIEKDLKKFALASYISETISRVLEEKQKNTKLYFFTKHSL 120

Query: 119 NCHKIPSVIGKIFVQ-IELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGL 177
              +  +V   IF+    L L+  +G+   L  C V G  ++L + S   GGAVC+    
Sbjct: 121 EAVESLNVETSIFLFSYTLKLISLLGYMPVLDSCAVCGKKENLSYFSSSCGGAVCKDCNE 180

Query: 178 PYAEKMLVLPSFL 190
              +   +    L
Sbjct: 181 TCKDAKFLNKKVL 193


>gi|161831256|ref|YP_001597343.1| DNA repair protein RecO [Coxiella burnetii RSA 331]
 gi|189039654|sp|A9N940|RECO_COXBR RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|161763123|gb|ABX78765.1| DNA repair protein RecO [Coxiella burnetii RSA 331]
          Length = 234

 Score = 94.1 bits (232), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 48/234 (20%), Positives = 81/234 (34%), Gaps = 14/234 (5%)

Query: 5   DDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQ--SHRMQPILQAGNLVRVNWRSRL 62
           + A IL  R Y   ++ILE++T  +GR     R+ +    R +  L+  + + ++W  R 
Sbjct: 8   EPAFILHRRPYSNTSLILELLTPNHGRVCALARSARGLKSRYKGKLELFSPLLISWSGRS 67

Query: 63  AQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHK 122
                 F  +V  +    LL     L G      L R L   +P L L+      L    
Sbjct: 68  DLK---FLGDVEANGMPYLLEGEALLCGFYLNELLIRLLHHDDPYLRLFHHYQNTLEKL- 123

Query: 123 IPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTG---VTQDLLWVSPKSGGAVCRSVGLPY 179
           +   +       E  LL  +G+GL L+  V               P  G  +C       
Sbjct: 124 VNGRLEATLRCFEKQLLDELGYGLPLSCDVEMKLPFKPDQFYQYLPDRGFLLCEKSEESE 183

Query: 180 AEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENF 232
              +    S L  +E++   +S     +    +L +  L   +       RE  
Sbjct: 184 ERDVFSGKSLLALQEESFSDESSLKEIK----YLMRLTLNRLLGKKPLKTRELL 233


>gi|302534318|ref|ZP_07286660.1| DNA repair protein RecO [Streptomyces sp. C]
 gi|302443213|gb|EFL15029.1| DNA repair protein RecO [Streptomyces sp. C]
          Length = 248

 Score = 94.1 bits (232), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 35/210 (16%), Positives = 76/210 (36%), Gaps = 14/210 (6%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQ--PILQAGNLVRVNWRS 60
           ++DD I+L  +  GE + I+ ++TR +GR     R  +  + +    L+  +   V + +
Sbjct: 4   FRDDGIVLRTQKLGEADRIITLLTRGHGRVRAVARGVRRTKSKFGARLEPFSHADVQFFA 63

Query: 61  RLAQNLG-----EFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLEL--YDM 113
           R +  +G       + E++  +   + +         +++       E E    +  Y +
Sbjct: 64  RGSDLVGRSLPLCTQTEIIAPYGNGIATDYARYTAGTAMLETAERFTENEGEPAVQQYLL 123

Query: 114 LNIFLNCHKIPSVIGKIFVQIELMLLKNI---GFGLDLTKCVVTGVTQDLLWVSPKSGGA 170
           L   L           +   ++  LL+++   G+      C   G+       S  +GG 
Sbjct: 124 LVGALRTLSRGEHEPHL--ILDAFLLRSLAVNGYAPSFEDCAKCGIHGPNRHFSVAAGGV 181

Query: 171 VCRSVGLPYAEKMLVLPSFLWKEEQTIDAD 200
           +C    +P +         L     T D  
Sbjct: 182 ICGDCRVPGSVVPSSEAIGLLSALLTGDWK 211


>gi|89895849|ref|YP_519336.1| hypothetical protein DSY3103 [Desulfitobacterium hafniense Y51]
 gi|119361456|sp|Q24SV0|RECO_DESHY RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|89335297|dbj|BAE84892.1| hypothetical protein [Desulfitobacterium hafniense Y51]
          Length = 273

 Score = 94.1 bits (232), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 32/176 (18%), Positives = 61/176 (34%), Gaps = 4/176 (2%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNW-RSR 61
           +  DA+++  R YGE + +L + +R+YG+     +  +  + +    A       +   +
Sbjct: 4   YHADALVIRSREYGESDRLLTLFSREYGKIQAVAKGVRKPKSRQRAGAQLFTYAEYLLHK 63

Query: 62  LAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCH 121
                   +    ES         + +        L       +P  EL+ +    L   
Sbjct: 64  GKSLDTVNQVSPRESFPHLWTDLDMSMAATAMAELLDLATLPGQPHPELFTLTFSSLFLV 123

Query: 122 KIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTG--VTQDLLWVSPKSGGAVCRSV 175
           +               L+  +G+   L +C   G  V  + L  SP +GG VCR  
Sbjct: 124 ESCDPALVQCTYALK-LMNYLGYRPRLVECAECGQRVQGERLLFSPDAGGVVCRQC 178


>gi|219670279|ref|YP_002460714.1| DNA repair protein RecO [Desulfitobacterium hafniense DCB-2]
 gi|254790519|sp|B8FUK8|RECO_DESHD RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|219540539|gb|ACL22278.1| DNA repair protein RecO [Desulfitobacterium hafniense DCB-2]
          Length = 273

 Score = 94.1 bits (232), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 32/176 (18%), Positives = 61/176 (34%), Gaps = 4/176 (2%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNW-RSR 61
           +  DA+++  R YGE + +L + +R+YG+     +  +  + +    A       +   +
Sbjct: 4   YHADALVIRSREYGESDRLLTLFSREYGKIQAVAKGVRKPKSRQRAGAQLFTYAEYLLHK 63

Query: 62  LAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCH 121
                   +    ES         + +        L       +P  EL+ +    L   
Sbjct: 64  GKSLDTVNQVSPRESFPHLWTDLDMSMAATAMAELLDLATLPGQPHPELFTLTFSSLFLV 123

Query: 122 KIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTG--VTQDLLWVSPKSGGAVCRSV 175
           +               L+  +G+   L +C   G  V  + L  SP +GG VCR  
Sbjct: 124 ESCDPALVQCTYALK-LMNYLGYRPRLVECAECGQRVQGERLLFSPDAGGVVCRQC 178


>gi|311895950|dbj|BAJ28358.1| putative DNA repair protein RecO [Kitasatospora setae KM-6054]
          Length = 248

 Score = 94.1 bits (232), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 39/211 (18%), Positives = 84/211 (39%), Gaps = 14/211 (6%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQ--PILQAGNLVRVNWRS 60
           ++DD I+L  +  GE + I+  +TRQ+G+     R  +  + +    L+  + V V + S
Sbjct: 4   FRDDGIVLRTQKLGEADRIITFLTRQHGQVRAVARGVRRTKSKFGARLEPFSHVDVQFFS 63

Query: 61  RLAQNLG-----EFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLEL--YDM 113
           R +  +G       + E +  + A+++          +++       E E    +  Y +
Sbjct: 64  RGSDLVGRTLPLCTQVETIAPYGARIVDDYTRYTAGTAMLETAERFAENEGQPAVQQYLL 123

Query: 114 LNIFLNCHKIPSVIGKIFVQIELMLLKNI---GFGLDLTKCVVTGVTQDLLWVSPKSGGA 170
           L   L      +    +   ++  LL+++   G+G   T C   G+     + S ++GG 
Sbjct: 124 LVGALRTLAAGTHQAHLV--LDAFLLRSLAVNGYGASFTDCARCGLPGPNRFFSLQAGGV 181

Query: 171 VCRSVGLPYAEKMLVLPSFLWKEEQTIDADS 201
           +C    +P +         L     + D  +
Sbjct: 182 LCGDCRVPGSAVPSPETLVLLGALLSGDWQT 212


>gi|146317683|ref|YP_001197395.1| DNA repair protein RecO [Streptococcus suis 05ZYH33]
 gi|146319875|ref|YP_001199586.1| DNA repair protein RecO [Streptococcus suis 98HAH33]
 gi|223932387|ref|ZP_03624390.1| DNA repair protein RecO [Streptococcus suis 89/1591]
 gi|253750945|ref|YP_003024086.1| DNA repair protein RecO [Streptococcus suis SC84]
 gi|253752844|ref|YP_003025984.1| DNA repair protein RecO [Streptococcus suis P1/7]
 gi|302023128|ref|ZP_07248339.1| DNA repair protein RecO [Streptococcus suis 05HAS68]
 gi|330831873|ref|YP_004400698.1| DNA repair protein RecO [Streptococcus suis ST3]
 gi|166221913|sp|A4VYJ7|RECO_STRS2 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|166221915|sp|A4VSA6|RECO_STRSY RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|145688489|gb|ABP88995.1| Recombinational DNA repair protein (RecF pathway) [Streptococcus
           suis 05ZYH33]
 gi|145690681|gb|ABP91186.1| Recombinational DNA repair protein (RecF pathway) [Streptococcus
           suis 98HAH33]
 gi|223899068|gb|EEF65426.1| DNA repair protein RecO [Streptococcus suis 89/1591]
 gi|251815234|emb|CAZ50798.1| DNA repair protein RecO [Streptococcus suis SC84]
 gi|251819089|emb|CAR44123.1| DNA repair protein RecO [Streptococcus suis P1/7]
 gi|292557486|gb|ADE30487.1| Recombination protein O [Streptococcus suis GZ1]
 gi|319757194|gb|ADV69136.1| DNA repair protein RecO [Streptococcus suis JS14]
 gi|329306096|gb|AEB80512.1| DNA repair protein RecO [Streptococcus suis ST3]
          Length = 260

 Score = 94.1 bits (232), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 30/203 (14%), Positives = 66/203 (32%), Gaps = 2/203 (0%)

Query: 2   YWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSR 61
             +   ++L  R++ E + ++++ T + G+ + FV++    ++   +Q         +  
Sbjct: 3   RIETRGLVLYNRNFREDDKLVKIFTEKAGKRMFFVKHASKSKLVASIQPLTYADFIVKIN 62

Query: 62  LAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCH 121
                    F  ++             Y    +      L ++     L+  L   L+  
Sbjct: 63  DDGLSYIEDFHQVQPFKNINGDIFKLSYATYILALADAALQDKVYDPALFAFLVKTLDLM 122

Query: 122 KIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAE 181
           +       +    E+ LL   G  L+  +C            S K  G +C         
Sbjct: 123 ESGLDYEVLTNIFEIQLLGRFGISLNFHECAFCHRVGLPFDYSYKYSGVLCPQHYQQDER 182

Query: 182 KMLVLP--SFLWKEEQTIDADSL 202
           +  + P   +L  + Q I  D L
Sbjct: 183 RAYLDPNVPYLLDQFQAISFDEL 205


>gi|253754669|ref|YP_003027809.1| DNA repair protein RecO [Streptococcus suis BM407]
 gi|251817133|emb|CAZ54854.1| DNA repair protein RecO [Streptococcus suis BM407]
          Length = 260

 Score = 94.1 bits (232), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 30/203 (14%), Positives = 66/203 (32%), Gaps = 2/203 (0%)

Query: 2   YWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSR 61
             +   ++L  R++ E + ++++ T + G+ + FV++    ++   +Q         +  
Sbjct: 3   RIETRGLVLYNRNFREDDKLVKIFTEKAGKRMFFVKHASKSKLVASIQPLTYADFIVKIN 62

Query: 62  LAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCH 121
                    F  ++             Y    +      L ++     L+  L   L+  
Sbjct: 63  DDGLSYIEDFHQVQPFKNINGDIFKLSYATYILALADAALQDKVYDPALFAFLVKTLDLM 122

Query: 122 KIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAE 181
           +       +    E+ LL   G  L+  +C            S K  G +C         
Sbjct: 123 ESGLDYEVLTNIFEIQLLGRFGISLNFHECAFCHRVGLPFAYSYKYSGVLCPQHYQQDER 182

Query: 182 KMLVLP--SFLWKEEQTIDADSL 202
           +  + P   +L  + Q I  D L
Sbjct: 183 RAYLDPNVPYLLDQFQAISFDEL 205


>gi|192360449|ref|YP_001983039.1| DNA repair protein RecO [Cellvibrio japonicus Ueda107]
 gi|238692465|sp|B3PL65|RECO_CELJU RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|190686614|gb|ACE84292.1| DNA repair protein RecO [Cellvibrio japonicus Ueda107]
          Length = 236

 Score = 94.1 bits (232), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 43/231 (18%), Positives = 76/231 (32%), Gaps = 11/231 (4%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNWRSRLA 63
            A IL  R Y + +++L+++T  YGR     R  +  +   + +L   + + VNW+ +  
Sbjct: 7   PAYILHARPYRDTSLLLDLLTPVYGRITAVARGVRQSKGHKRQLLNPFHRLLVNWQGKSE 66

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKI 123
             L      V   H    L  +    G      L R LPE++    L++     L+    
Sbjct: 67  LKL---ITGVETDHHYLQLQGNALYSGFYLNELLVRLLPEQDVITGLFERYEWTLDALHR 123

Query: 124 PSVIGKIFVQIELMLLKNIGFGLD-LTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEK 182
              +  +  + E MLL+ +G+ LD L  C      Q   +                    
Sbjct: 124 GEPLEPLLREFEFMLLQGLGYALDFLHDCHSQQPIQSGYFYLCDIHQGFYSVPADSDPRF 183

Query: 183 MLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENF 232
            +     L        A       +     L +   +  +       RE F
Sbjct: 184 WIAGAHLLAIAAGDYSAAD----TRRVAKQLARLLFKPLLGKRPLKSRELF 230


>gi|29654792|ref|NP_820484.1| DNA repair protein [Coxiella burnetii RSA 493]
 gi|153208695|ref|ZP_01946942.1| DNA repair protein RecO [Coxiella burnetii 'MSU Goat Q177']
 gi|154706512|ref|YP_001423901.1| DNA repair protein [Coxiella burnetii Dugway 5J108-111]
 gi|165919322|ref|ZP_02219408.1| DNA repair protein RecO [Coxiella burnetii RSA 334]
 gi|212212138|ref|YP_002303074.1| DNA repair protein [Coxiella burnetii CbuG_Q212]
 gi|212219220|ref|YP_002306007.1| DNA repair protein [Coxiella burnetii CbuK_Q154]
 gi|1710073|sp|P51838|RECO_COXBU RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|189039653|sp|A9KFA2|RECO_COXBN RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|238058642|sp|B6J4J7|RECO_COXB1 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|238058643|sp|B6IZ01|RECO_COXB2 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|439873|gb|AAA69692.1| putative [Coxiella burnetii]
 gi|29542060|gb|AAO90998.1| DNA repair protein [Coxiella burnetii RSA 493]
 gi|120575806|gb|EAX32430.1| DNA repair protein RecO [Coxiella burnetii 'MSU Goat Q177']
 gi|154355798|gb|ABS77260.1| DNA repair protein [Coxiella burnetii Dugway 5J108-111]
 gi|165916982|gb|EDR35586.1| DNA repair protein RecO [Coxiella burnetii RSA 334]
 gi|212010548|gb|ACJ17929.1| DNA repair protein [Coxiella burnetii CbuG_Q212]
 gi|212013482|gb|ACJ20862.1| DNA repair protein [Coxiella burnetii CbuK_Q154]
          Length = 231

 Score = 94.1 bits (232), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 45/231 (19%), Positives = 78/231 (33%), Gaps = 11/231 (4%)

Query: 5   DDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQ--SHRMQPILQAGNLVRVNWRSRL 62
           + A IL  R Y   ++ILE++T  +GR     R+ +    R +  L+  + + ++W  R 
Sbjct: 8   EPAFILHRRPYSNTSLILELLTPNHGRVCALARSARGLKSRYKGKLELFSPLLISWSGRS 67

Query: 63  AQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHK 122
                 F  +V  +    LL     L G      L R L   +P L L+      L    
Sbjct: 68  DLK---FLGDVEANGMPYLLEGEALLCGFYLNELLIRLLHHDDPYLRLFHHYQNTLEKL- 123

Query: 123 IPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEK 182
           +   +       E  LL  +G+GL L+  V   +                          
Sbjct: 124 VNGRLEATLRCFEKQLLDELGYGLPLSCDVEMKLPFKPDQFYQYLPDRGFLLCEKSEERD 183

Query: 183 MLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENF 232
           +    S L  +E++   +S     +    +L +  L   +       RE  
Sbjct: 184 VFSGKSLLALQEESFSDESSLKEIK----YLMRLTLNRLLGKKPLKTRELL 230


>gi|295839012|ref|ZP_06825945.1| DNA repair protein RecO [Streptomyces sp. SPB74]
 gi|295827284|gb|EFG65328.1| DNA repair protein RecO [Streptomyces sp. SPB74]
          Length = 249

 Score = 94.1 bits (232), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 39/211 (18%), Positives = 80/211 (37%), Gaps = 14/211 (6%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQ--PILQAGNLVRVNWRS 60
           ++DD I+L  +  GE + I+ ++TR  GR     R  +  + +    L+  + V V + +
Sbjct: 4   FRDDGIVLRTQKLGEADRIITLLTRGQGRVRAVARGVRRTKSKFGARLEPFSHVDVQFFA 63

Query: 61  RLAQNLG-----EFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLEL--YDM 113
           R ++ +G       + E +  +   +++         +++         E    +  Y +
Sbjct: 64  RGSELIGRGLPLCTQSETIAPYGRHIVTDYSRYTAGTAMLETAERFTANEGEPAIQQYLL 123

Query: 114 LNIFLNCHKIPSVIGKIFVQIELMLLKNI---GFGLDLTKCVVTGVTQDLLWVSPKSGGA 170
           L   L      S    +   ++  LL+++   G+      C   G+     + S  SGGA
Sbjct: 124 LVGGLRTLAEGSHAPALV--MDAFLLRSLAVNGYAPSFGDCARCGLPGPNRFFSVSSGGA 181

Query: 171 VCRSVGLPYAEKMLVLPSFLWKEEQTIDADS 201
           VC    +P +         L     T D  +
Sbjct: 182 VCGDCRVPGSVVPSSETLILLGALLTGDWAT 212


>gi|311114387|ref|YP_003985608.1| recombination protein O [Gardnerella vaginalis ATCC 14019]
 gi|310945881|gb|ADP38585.1| recombination protein O [Gardnerella vaginalis ATCC 14019]
          Length = 247

 Score = 94.1 bits (232), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 37/241 (15%), Positives = 78/241 (32%), Gaps = 23/241 (9%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQ--PILQAGNLVRVNWRS 60
           + D+A++L     GE + I+ ++T+++G+     +  +  + +    L+    V   + +
Sbjct: 7   YNDEAVVLKTFPLGEADRIVVMLTKKHGKIRAVAKGVRKIKSRFGARLEPFMRVNALFAT 66

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
               ++      V     +      L+             +       +     N+ +  
Sbjct: 67  GRTFDVVSQAVLVSAYAESICADYDLYSRASMIAEIADDLVSSSAQYQDSCMQYNLLVAA 126

Query: 121 HK----IPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVG 176
                        I     L  LK  G+   L +CVV     DL + S  SGG +C    
Sbjct: 127 LSALSRGLHSADSIGFSYVLRALKLAGWSPMLNECVVCATKDDLSYFSSCSGGVMCSKDH 186

Query: 177 LPYAEKMLVLPSFLWKEEQTIDADSLKSAFQL-----------TDYFLNK-----YALQH 220
              + K   L  F        D  ++     +            +Y+L +     + L++
Sbjct: 187 DLQSIKCNGLARFQMISLINGDWKNI-DGTDIDYLTYRCVEQWCEYYLERPIKSMHLLEN 245

Query: 221 N 221
           N
Sbjct: 246 N 246


>gi|329120278|ref|ZP_08248946.1| recombination protein O [Neisseria bacilliformis ATCC BAA-1200]
 gi|327462619|gb|EGF08942.1| recombination protein O [Neisseria bacilliformis ATCC BAA-1200]
          Length = 256

 Score = 94.1 bits (232), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 36/218 (16%), Positives = 68/218 (31%), Gaps = 8/218 (3%)

Query: 2   YWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWR 59
              + A +L    + E ++ LE+ +R+YGR     R+ +  +   + +L     V V+W 
Sbjct: 8   INHEPAFLLAAAPWRESSLRLEMYSRRYGRVSLLARSARKRQSELRGVLVPFVPVSVSWY 67

Query: 60  SRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLN 119
                                       L GL     + +  P  +    +YD L   L 
Sbjct: 68  GGAETKTLH---RAEWLGGWPQPQGRALLSGLYLNELVLKLTPREDAQPAVYDALAQALK 124

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
                +       + E  LL  +G+  DL         +        +        G   
Sbjct: 125 SVCTETAHAAALRRFEWRLLTELGYAPDLQSDADGNPVRAGTRYLIAAEQPPQPYAGGSV 184

Query: 180 AEKMLVLPSFLWK---EEQTIDADSLKSAFQLTDYFLN 214
            +  L     + +   E +    +SL  A ++T   L+
Sbjct: 185 PQDALTADGGILRQLHEGRFEGGESLHEALKITRLLLD 222


>gi|239941031|ref|ZP_04692968.1| DNA repair protein RecO [Streptomyces roseosporus NRRL 15998]
 gi|239987510|ref|ZP_04708174.1| DNA repair protein RecO [Streptomyces roseosporus NRRL 11379]
 gi|291444471|ref|ZP_06583861.1| DNA repair protein recO [Streptomyces roseosporus NRRL 15998]
 gi|291347418|gb|EFE74322.1| DNA repair protein recO [Streptomyces roseosporus NRRL 15998]
          Length = 248

 Score = 94.1 bits (232), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 32/190 (16%), Positives = 76/190 (40%), Gaps = 14/190 (7%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQ--PILQAGNLVRVNWRS 60
           ++DD I+L  +  GE + I+ ++TR +GR     R  +  + +    L+  + V V + +
Sbjct: 4   FRDDGIVLRTQKLGEADRIITILTRGHGRVRAVARGVRRTKSKFGARLEPFSHVDVQFFA 63

Query: 61  RLAQNLG-----EFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLEL--YDM 113
           R ++ +G       + E +  +   +++         +++       + E    +  Y +
Sbjct: 64  RGSELVGRGLPLCTQSETIAPYGGGIVADYARYTAGTAMLETAERFTDHEGEPAVQQYLL 123

Query: 114 LNIFLNCHKIPSVIGKIFVQIELMLLKNI---GFGLDLTKCVVTGVTQDLLWVSPKSGGA 170
           L   L           +   ++  LL+++   G+      C   G+     + S  +GG 
Sbjct: 124 LVGGLRTLARGEHAPHL--ILDAFLLRSLAVNGYAPSFEDCAKCGMPGPNRFFSVAAGGV 181

Query: 171 VCRSVGLPYA 180
           +C    +P +
Sbjct: 182 ICGDCRVPGS 191


>gi|226940391|ref|YP_002795465.1| DNA repair protein RecO [Laribacter hongkongensis HLHK9]
 gi|254764636|sp|C1D7L6|RECO_LARHH RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|226715318|gb|ACO74456.1| RecO [Laribacter hongkongensis HLHK9]
          Length = 242

 Score = 93.7 bits (231), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 36/218 (16%), Positives = 72/218 (33%), Gaps = 11/218 (5%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNWRSRLA 63
            A +L  + Y E ++++E+ TR++GR     R  +  R  ++ +L   + + V W  +  
Sbjct: 11  QAFVLHAQPYKETSLLVEMFTREHGRVGLVARGARRPRAGIRALLLPFSPLEVGWFGKSD 70

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKI 123
                   ++        L+ +  + G      + + +   +P   L+D     +     
Sbjct: 71  ---IRTLSDIDWQGGLPQLAGTPLVTGFYVNELIMKLVARDDPHEGLFDDYRTLIAHLAR 127

Query: 124 -PSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEK 182
               I  +  + EL LL   G+   L + +     +         G              
Sbjct: 128 GSVAIAPVLRRFELQLLAATGYAPTLDRDLAGEPVRADAVYGFVPGEGARPGAERGCEVS 187

Query: 183 MLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQH 220
              L +          A  L+ A      FLN+  L H
Sbjct: 188 GQTLLALDHGALDQASAAVLREA-----RFLNRALLTH 220


>gi|261401395|ref|ZP_05987520.1| DNA repair protein RecO [Neisseria lactamica ATCC 23970]
 gi|269208616|gb|EEZ75071.1| DNA repair protein RecO [Neisseria lactamica ATCC 23970]
          Length = 263

 Score = 93.7 bits (231), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 40/234 (17%), Positives = 70/234 (29%), Gaps = 16/234 (6%)

Query: 8   IILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLAQN 65
            +L    + E ++ +E  +R+YGR     R+ +  +   + +L     V V+W       
Sbjct: 12  FLLASSPWRESSLRVEAFSRRYGRVALLARSARKRQSELRGVLVPFVPVSVSWYGSQELK 71

Query: 66  LGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPS 125
                  V                GL     + +     +P  ELYD L   +      +
Sbjct: 72  TLHRAEWVGGWRQP---QGRALFGGLYVNELVLKLTAREDPVPELYDALAEVMEAVCCKA 128

Query: 126 VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGL----PYAE 181
                  + E  LL  +G   DL +    G          +   AV          P+A 
Sbjct: 129 AYIGDLRRFEWRLLNLLGVAPDLNRDGDGGTIAAGGTYLVRPETAVFPVGKGFAVPPHAA 188

Query: 182 KMLVLPSFLWK--EEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFL 233
            +      L            SL+ A ++T  F+    L    +     R+   
Sbjct: 189 GVTAPGQSLIDLRAGSFGSGQSLQDALKITRLFI--RHLLPEGL---KSRQVLE 237


>gi|297199546|ref|ZP_06916943.1| DNA repair protein RecO [Streptomyces sviceus ATCC 29083]
 gi|197713528|gb|EDY57562.1| DNA repair protein RecO [Streptomyces sviceus ATCC 29083]
          Length = 250

 Score = 93.7 bits (231), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 34/190 (17%), Positives = 79/190 (41%), Gaps = 14/190 (7%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQ--PILQAGNLVRVNWRS 60
           ++DD ++L  +  GE + I+ ++TR +GR     R  +  + +    L+  + V V + +
Sbjct: 4   FRDDGVVLRTQKLGEADRIITLLTRGHGRVRAVARGVRRTKSKFGARLEPFSHVDVQFFA 63

Query: 61  RLAQNLG-----EFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLEL--YDM 113
           R ++ +G       + E +  +   ++S         +++       + E    +  Y +
Sbjct: 64  RGSELVGRGLPLCTQSETIAPYGGGIVSDYARYTAGTAMLETAERFTDHEGEPAVQQYLL 123

Query: 114 LNIFLNCHKIPSVIGKIFVQIELMLLKNI---GFGLDLTKCVVTGVTQDLLWVSPKSGGA 170
           L   L           +   ++  LL+++   G+    + C   G+T    + S  +GG+
Sbjct: 124 LVGALRTLARGEHAPHLV--LDAFLLRSLAVNGYAPSFSDCARCGMTGPNRFFSVAAGGS 181

Query: 171 VCRSVGLPYA 180
           VC    +P +
Sbjct: 182 VCVDCRVPGS 191


>gi|83311360|ref|YP_421624.1| recombinational DNA repair protein [Magnetospirillum magneticum
          AMB-1]
 gi|82946201|dbj|BAE51065.1| Recombinational DNA repair protein [Magnetospirillum magneticum
          AMB-1]
          Length = 206

 Score = 93.7 bits (231), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 42/95 (44%), Positives = 54/95 (56%)

Query: 1  MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
          M W DD ++L VR +GE   +  ++TR +GRH G V  GQ    +PILQ GNLVR  W  
Sbjct: 1  MEWDDDGVVLAVRRHGETGAVASLLTRSHGRHAGLVHGGQGRANRPILQPGNLVRARWTG 60

Query: 61 RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIV 95
          RL + LG FR E+L +H A  L  +  L  L S  
Sbjct: 61 RLPEQLGNFRLEMLHAHAAAFLDDAARLAALGSAC 95


>gi|34497524|ref|NP_901739.1| DNA repair protein RecO [Chromobacterium violaceum ATCC 12472]
 gi|42559446|sp|Q7NWC1|RECO_CHRVO RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|34103379|gb|AAQ59741.1| DNA repair protein [Chromobacterium violaceum ATCC 12472]
          Length = 245

 Score = 93.7 bits (231), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 22/160 (13%), Positives = 54/160 (33%), Gaps = 5/160 (3%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLA 63
              IL  + Y E +++LEV++R +GR     R+ +  R   + +L     + ++W  +  
Sbjct: 11  PGYILHTQPYRETSLLLEVLSRDHGRFSLVARSARRPRSDLRGVLLPFQPLTLSWFGKGE 70

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKI 123
                             L+    + G      + +     +P    + + +  +     
Sbjct: 71  LRTLHAADWDGGVRA---LTGLPLVCGFYLNELMMKLTARDDPEPRAFSVYDRAVRELAG 127

Query: 124 PSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWV 163
            + +     + EL L + +G+   L++             
Sbjct: 128 GAPLSTALRRYELRLAQVLGYAPALSRDSRGEAIAADRHY 167


>gi|182438807|ref|YP_001826526.1| DNA repair protein RecO [Streptomyces griseus subsp. griseus NBRC
           13350]
 gi|326779462|ref|ZP_08238727.1| DNA repair protein recO [Streptomyces cf. griseus XylebKG-1]
 gi|238689003|sp|B1VY58|RECO_STRGG RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|178467323|dbj|BAG21843.1| putative DNA recombination and repair protein RecO [Streptomyces
           griseus subsp. griseus NBRC 13350]
 gi|326659795|gb|EGE44641.1| DNA repair protein recO [Streptomyces cf. griseus XylebKG-1]
          Length = 248

 Score = 93.7 bits (231), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 32/190 (16%), Positives = 75/190 (39%), Gaps = 14/190 (7%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQ--PILQAGNLVRVNWRS 60
           ++DD I+L  +  GE + I+ ++TR +GR     R  +  + +    L+  + V V + +
Sbjct: 4   FRDDGIVLRTQKLGEADRIITILTRGHGRVRAVARGVRRTKSKFGARLEPFSHVDVQFFA 63

Query: 61  RLAQNLG-----EFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLEL--YDM 113
           R  + +G       + E +  +   +++         +++       + E    +  Y +
Sbjct: 64  RGGELVGRGLPLCTQSETIAPYGGGIVADYARYTAGTAMLETAERFTDHEGEPAVQQYLL 123

Query: 114 LNIFLNCHKIPSVIGKIFVQIELMLLKNI---GFGLDLTKCVVTGVTQDLLWVSPKSGGA 170
           L   L           +   ++  LL+++   G+      C   G+     + S  +GG 
Sbjct: 124 LVGGLRTLARGEHAPHL--ILDAFLLRSLAVNGYAPSFEDCAKCGMPGPNRFFSVAAGGV 181

Query: 171 VCRSVGLPYA 180
           +C    +P +
Sbjct: 182 ICGDCRVPGS 191


>gi|256787868|ref|ZP_05526299.1| DNA repair protein RecO [Streptomyces lividans TK24]
 gi|289771752|ref|ZP_06531130.1| DNA repair protein RecO [Streptomyces lividans TK24]
 gi|289701951|gb|EFD69380.1| DNA repair protein RecO [Streptomyces lividans TK24]
          Length = 251

 Score = 93.7 bits (231), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 37/211 (17%), Positives = 81/211 (38%), Gaps = 14/211 (6%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQ--PILQAGNLVRVNWRS 60
           ++DD I+L  +  GE + I+ ++TR +GR     R  +  + +    L+  + V V + S
Sbjct: 7   FRDDGIVLRTQKLGEADRIITLLTRGHGRVRAVARGVRRTKSKFGARLEPFSHVDVQFFS 66

Query: 61  RLAQNLG-----EFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLEL--YDM 113
           + ++ +G       + E +  +   +++         +++       + E    +  Y +
Sbjct: 67  KGSELVGRGLPLCTQSETIAPYGGGIVTDYARYTAGTAMLETAERFTDHEGEPAVQQYLL 126

Query: 114 LNIFLNCHKIPSVIGKIFVQIELMLLKNI---GFGLDLTKCVVTGVTQDLLWVSPKSGGA 170
           L   L           +   ++  LL+++   G+      C   G+     + S  SGG+
Sbjct: 127 LVGALRTLARGEHAPNLV--LDAFLLRSLAVNGYAPTFGDCAKCGMPGPNRFFSVGSGGS 184

Query: 171 VCRSVGLPYAEKMLVLPSFLWKEEQTIDADS 201
           VC    +P +         L     T D  +
Sbjct: 185 VCVDCRVPGSVVPSPQALELLGALLTGDWGT 215


>gi|302518924|ref|ZP_07271266.1| DNA repair protein RecO [Streptomyces sp. SPB78]
 gi|318059906|ref|ZP_07978629.1| DNA repair protein RecO [Streptomyces sp. SA3_actG]
 gi|318076741|ref|ZP_07984073.1| DNA repair protein RecO [Streptomyces sp. SA3_actF]
 gi|333027247|ref|ZP_08455311.1| putative DNA repair protein RecO [Streptomyces sp. Tu6071]
 gi|302427819|gb|EFK99634.1| DNA repair protein RecO [Streptomyces sp. SPB78]
 gi|332747099|gb|EGJ77540.1| putative DNA repair protein RecO [Streptomyces sp. Tu6071]
          Length = 249

 Score = 93.7 bits (231), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 36/190 (18%), Positives = 76/190 (40%), Gaps = 14/190 (7%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQ--PILQAGNLVRVNWRS 60
           ++DD I+L  +  GE + I+ ++TR  GR     R  +  + +    L+  + V V + +
Sbjct: 4   FRDDGIVLRTQKLGEADRIITLLTRGQGRVRAVARGVRRTKSKFGARLEPFSHVDVQFFA 63

Query: 61  RLAQNLG-----EFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLEL--YDM 113
           R ++ +G       + E +  +   +++         +++         E    +  Y +
Sbjct: 64  RGSELIGRGLPLCTQSETIAPYGRHIVTDYSRYTAGTAMLETAERFTANEGEPAIQQYLL 123

Query: 114 LNIFLNCHKIPSVIGKIFVQIELMLLKNI---GFGLDLTKCVVTGVTQDLLWVSPKSGGA 170
           L   L      S    +   ++  LL+++   G+      C   G+     + S  SGGA
Sbjct: 124 LVGGLRTLAEGSHAPALV--MDAFLLRSLAVNGYAPSFDACARCGLPGPNRFFSVSSGGA 181

Query: 171 VCRSVGLPYA 180
           VC    +P +
Sbjct: 182 VCGDCRVPGS 191


>gi|261855984|ref|YP_003263267.1| DNA repair protein RecO [Halothiobacillus neapolitanus c2]
 gi|261836453|gb|ACX96220.1| DNA repair protein RecO [Halothiobacillus neapolitanus c2]
          Length = 241

 Score = 93.7 bits (231), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 39/229 (17%), Positives = 74/229 (32%), Gaps = 8/229 (3%)

Query: 5   DDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQ 64
             A +L  R + + ++++E  T  +GR   + R  ++   +  L+      ++    + +
Sbjct: 2   TRAYVLHTRPWRDTSLLVEWFTEDFGRLTTYQRGARNRGKKSPLRPMAFQCLHMML-VGR 60

Query: 65  NLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIP 124
              +   ++  +  A LL       G      L R L  +EP   L+D+    L     P
Sbjct: 61  GDMKTATQIESAGRAHLLQGQSLAVGFYLNELLMRALHRQEPAPVLFDIYARHLAELAGP 120

Query: 125 SVIGKIFVQ-IELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKM 183
           SV     V+  E  LL  +G G+D      T    D       +                
Sbjct: 121 SVDFGTVVRGFERDLLAELGVGIDWQSTADTQEPIDQQAQYWLAPEEGILQHRGRGYPVA 180

Query: 184 LVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLREN 231
             +   +   +   DA   + A       L +  L  ++       R  
Sbjct: 181 GNILKAIADNQTLADAGDRRQARN-----LLQSLLAPHVGSAPFNSRAL 224


>gi|121635410|ref|YP_975655.1| DNA repair protein (recombination protein o) [Neisseria
           meningitidis FAM18]
 gi|120867116|emb|CAM10883.1| DNA repair protein (recombination protein o) [Neisseria
           meningitidis FAM18]
 gi|254671054|emb|CBA07920.1| DNA repair protein RecO [Neisseria meningitidis alpha153]
 gi|319411027|emb|CBY91426.1| DNA repair protein RecO (recombination protein O) [Neisseria
           meningitidis WUE 2594]
 gi|325132871|gb|EGC55549.1| DNA repair protein RecO [Neisseria meningitidis M6190]
 gi|325138816|gb|EGC61367.1| DNA repair protein RecO [Neisseria meningitidis ES14902]
          Length = 264

 Score = 93.7 bits (231), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 40/234 (17%), Positives = 70/234 (29%), Gaps = 16/234 (6%)

Query: 8   IILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLAQN 65
            +L    + E ++ +E  +R+YGR     R+ +  +   + +L     V  +W       
Sbjct: 13  FLLASSPWRESSLRVEAFSRRYGRVALLARSARKRQSELRGVLVPFVPVSASWYGSQELK 72

Query: 66  LGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPS 125
                                   GL     + +     +P  ELYD L   +      +
Sbjct: 73  TLH---RAEWIGGWPQPQGRALFSGLYVNELMLKLTVREDPLPELYDALAEVMEAVCCKA 129

Query: 126 VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAV----CRSVGLPYAE 181
                  + E  LL  +G   DL      G              AV      +  L +  
Sbjct: 130 AYIDDLRRFEWRLLNLLGVAPDLHADGTGGDILADKTYRLMPEEAVMPVCEDADALSHEA 189

Query: 182 KMLVLPSFLWK--EEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFL 233
             +V    L    E     A+SL+ A ++T  F+    L    +     R+   
Sbjct: 190 GAIVEGQSLIDLREGSFRTAESLQQALKITRLFI--RHLLPEGL---KSRQVLE 238


>gi|171704547|sp|A1KVH9|RECO_NEIMF RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|6449094|gb|AAF08823.1|AF194079_10 recO [Neisseria meningitidis]
          Length = 263

 Score = 93.7 bits (231), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 40/234 (17%), Positives = 70/234 (29%), Gaps = 16/234 (6%)

Query: 8   IILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLAQN 65
            +L    + E ++ +E  +R+YGR     R+ +  +   + +L     V  +W       
Sbjct: 12  FLLASSPWRESSLRVEAFSRRYGRVALLARSARKRQSELRGVLVPFVPVSASWYGSQELK 71

Query: 66  LGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPS 125
                                   GL     + +     +P  ELYD L   +      +
Sbjct: 72  TLH---RAEWIGGWPQPQGRALFSGLYVNELMLKLTVREDPLPELYDALAEVMEAVCCKA 128

Query: 126 VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAV----CRSVGLPYAE 181
                  + E  LL  +G   DL      G              AV      +  L +  
Sbjct: 129 AYIDDLRRFEWRLLNLLGVAPDLHADGTGGDILADKTYRLMPEEAVMPVCEDADALSHEA 188

Query: 182 KMLVLPSFLWK--EEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFL 233
             +V    L    E     A+SL+ A ++T  F+    L    +     R+   
Sbjct: 189 GAIVEGQSLIDLREGSFRTAESLQQALKITRLFI--RHLLPEGL---KSRQVLE 237


>gi|189425855|ref|YP_001953032.1| DNA repair protein RecO [Geobacter lovleyi SZ]
 gi|189422114|gb|ACD96512.1| DNA repair protein RecO [Geobacter lovleyi SZ]
          Length = 209

 Score = 93.7 bits (231), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 34/160 (21%), Positives = 57/160 (35%), Gaps = 2/160 (1%)

Query: 4   QDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQ--SHRMQPILQAGNLVRVNWRSR 61
           Q  AIIL   +YGE + I+ + T ++GR  GF ++ +    R    L+  N + V    R
Sbjct: 5   QCQAIILSTLNYGESDRIVSLFTLEHGRLRGFAKSARASRKRFGGQLEPANRLAVTLSLR 64

Query: 62  LAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCH 121
                   R E    +             L +   +    PE  P   L+ +L+      
Sbjct: 65  EDGLSRIERVEQSNCYPELRERLESLALALYACELVEALTPEGHPLPRLFRLLSTLFEHL 124

Query: 122 KIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLL 161
              S         E+ LL  +G+   L    +  ++  L 
Sbjct: 125 AGQSGSPTDRRFFEMNLLNILGYRPALDTAALQPLSDCLK 164


>gi|20807456|ref|NP_622627.1| recombinational DNA repair protein [Thermoanaerobacter
           tengcongensis MB4]
 gi|20515981|gb|AAM24231.1| Recombinational DNA repair protein [Thermoanaerobacter
           tengcongensis MB4]
          Length = 257

 Score = 93.7 bits (231), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 38/193 (19%), Positives = 74/193 (38%), Gaps = 3/193 (1%)

Query: 1   MYW-QDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNW- 58
           M + + +AI+L      EK+ I  + TR YG+     +  +  + + +      +  N+ 
Sbjct: 11  MRFLKTEAIVLKSNLISEKDKIATLFTRDYGKLQAVAKGARRSKSRFVNAVRPFIVANYV 70

Query: 59  RSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFL 118
                      ++E++++          F         + R L E++   +LY      L
Sbjct: 71  IFEGQNYYYIDQWELVKNFENIEKDLKKFALASYISETISRVLEEKQKNTKLYFFTKHSL 130

Query: 119 NCHKIPSVIGKIFVQ-IELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGL 177
              +  +V   IF+    L L+  +G+   L  C V G  ++L + S   GGAVC+    
Sbjct: 131 EAVESLNVETSIFLFSYTLKLISLLGYMPVLDSCAVCGKKENLSYFSSSCGGAVCKDCNE 190

Query: 178 PYAEKMLVLPSFL 190
              +   +    L
Sbjct: 191 TCKDAKFLNKKVL 203


>gi|114048419|ref|YP_738969.1| DNA repair protein RecO [Shewanella sp. MR-7]
 gi|113889861|gb|ABI43912.1| DNA repair protein RecO [Shewanella sp. MR-7]
          Length = 233

 Score = 93.7 bits (231), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 33/232 (14%), Positives = 67/232 (28%), Gaps = 12/232 (5%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVR-NGQSHRMQPILQAGNLVRVNWRSRLAQ 64
              +L  R Y E + ++ ++    GR     R       ++ ILQ    +   +  +   
Sbjct: 3   RGYVLHHRPYRESSALVNLLVDGIGRVDAVARVGSGKRSIKSILQPFQPLIFEFSGKSEL 62

Query: 65  NLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIP 124
                  ++  +  A  LS      G+     L R L        L+ + +  L      
Sbjct: 63  KN---ISQIEAAAPAVPLSGYSLYAGMYINELLMRTLSVHHNAEALFLIYHQALVGLA-A 118

Query: 125 SVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKML 184
                    +EL LL+ +G    L +           +            +    A+   
Sbjct: 119 QFCESKLRYLELALLRELGAMPSLIRDTQGEPLIPEHYYQLVPELGFQFVLN-SRAKHTY 177

Query: 185 VLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHL-LRENFLGK 235
                    +  +  +    A +     L +  LQ  + +  L  R+ F+  
Sbjct: 178 QGAMLTALNDNQLLQEQFLEAKR-----LMRSMLQPLLGNKPLVSRQLFIQA 224


>gi|119370513|sp|Q9L2H3|RECO_STRCO RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
          Length = 248

 Score = 93.7 bits (231), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 37/211 (17%), Positives = 81/211 (38%), Gaps = 14/211 (6%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQ--PILQAGNLVRVNWRS 60
           ++DD I+L  +  GE + I+ ++TR +GR     R  +  + +    L+  + V V + S
Sbjct: 4   FRDDGIVLRTQKLGEADRIITLLTRGHGRVRAVARGVRRTKSKFGARLEPFSHVDVQFFS 63

Query: 61  RLAQNLG-----EFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLEL--YDM 113
           + ++ +G       + E +  +   +++         +++       + E    +  Y +
Sbjct: 64  KGSELVGRGLPLCTQSETIAPYGGGIVTDYARYTAGTAMLETAERFTDHEGEPAVQQYLL 123

Query: 114 LNIFLNCHKIPSVIGKIFVQIELMLLKNI---GFGLDLTKCVVTGVTQDLLWVSPKSGGA 170
           L   L           +   ++  LL+++   G+      C   G+     + S  SGG+
Sbjct: 124 LVGALRTLARGEHAPTLV--LDAFLLRSLAVNGYAPTFGDCAKCGMPGPNRFFSVGSGGS 181

Query: 171 VCRSVGLPYAEKMLVLPSFLWKEEQTIDADS 201
           VC    +P +         L     T D  +
Sbjct: 182 VCVDCRVPGSVVPSPQALELLGALLTGDWGT 212


>gi|21220971|ref|NP_626750.1| DNA repair protein RecO [Streptomyces coelicolor A3(2)]
 gi|6752353|emb|CAB69731.1| conserved hypothetical protein SCC121.13c [Streptomyces coelicolor
           A3(2)]
          Length = 251

 Score = 93.7 bits (231), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 37/211 (17%), Positives = 81/211 (38%), Gaps = 14/211 (6%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQ--PILQAGNLVRVNWRS 60
           ++DD I+L  +  GE + I+ ++TR +GR     R  +  + +    L+  + V V + S
Sbjct: 7   FRDDGIVLRTQKLGEADRIITLLTRGHGRVRAVARGVRRTKSKFGARLEPFSHVDVQFFS 66

Query: 61  RLAQNLG-----EFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLEL--YDM 113
           + ++ +G       + E +  +   +++         +++       + E    +  Y +
Sbjct: 67  KGSELVGRGLPLCTQSETIAPYGGGIVTDYARYTAGTAMLETAERFTDHEGEPAVQQYLL 126

Query: 114 LNIFLNCHKIPSVIGKIFVQIELMLLKNI---GFGLDLTKCVVTGVTQDLLWVSPKSGGA 170
           L   L           +   ++  LL+++   G+      C   G+     + S  SGG+
Sbjct: 127 LVGALRTLARGEHAPTLV--LDAFLLRSLAVNGYAPTFGDCAKCGMPGPNRFFSVGSGGS 184

Query: 171 VCRSVGLPYAEKMLVLPSFLWKEEQTIDADS 201
           VC    +P +         L     T D  +
Sbjct: 185 VCVDCRVPGSVVPSPQALELLGALLTGDWGT 215


>gi|313667834|ref|YP_004048118.1| DNA repair protein (recombination protein o) [Neisseria lactamica
           ST-640]
 gi|313005296|emb|CBN86729.1| DNA repair protein (recombination protein o) [Neisseria lactamica
           020-06]
          Length = 263

 Score = 93.3 bits (230), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 39/234 (16%), Positives = 70/234 (29%), Gaps = 16/234 (6%)

Query: 8   IILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLAQN 65
            +L    + E ++ +E  +R+YGR     R+ +  +   + +L     V  +W       
Sbjct: 12  FMLASSPWRESSLWVEAFSRRYGRVALLARSARKRQSELRGVLVPFVPVSASWYGSQELK 71

Query: 66  LGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPS 125
                  V                GL     + +     +P  ELYD L   +      +
Sbjct: 72  TLHRAEWVGGWRQP---QGRALFGGLYVNELVLKLTAREDPVPELYDALAEVMEAVCCKA 128

Query: 126 VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGL----PYAE 181
                  + E  LL  +G   DL +    G          +   AV          P+A 
Sbjct: 129 AYIDDLRRFEWRLLNLLGVAPDLNRDGDGGTIAAGGTYLVRPETAVFPVGKGFAVPPHAA 188

Query: 182 KMLVLPSFLWK--EEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFL 233
            ++     L            SL+ A ++T  F+    L    +     R+   
Sbjct: 189 GVVAPGQSLIDLRAGSFGSGQSLQDALKITRLFI--RHLLPEGL---KSRQVLE 237


>gi|113971181|ref|YP_734974.1| DNA repair protein RecO [Shewanella sp. MR-4]
 gi|113885865|gb|ABI39917.1| DNA repair protein RecO [Shewanella sp. MR-4]
          Length = 233

 Score = 93.3 bits (230), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 33/232 (14%), Positives = 67/232 (28%), Gaps = 12/232 (5%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVR-NGQSHRMQPILQAGNLVRVNWRSRLAQ 64
              +L  R Y E + ++ ++    GR     R       ++ ILQ    +   +  +   
Sbjct: 3   RGYVLHHRPYRESSALVNLLVDGIGRVDAIARVGSGKRSIKSILQPFQPLIFEFSGKSEL 62

Query: 65  NLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIP 124
                  ++  +  A  LS      G+     L R L        L+ + +  L      
Sbjct: 63  KN---ISQIEAAAPAVPLSGYSLYAGMYINELLMRTLSVHHNAEALFLIYHQALVGLA-A 118

Query: 125 SVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKML 184
                    +EL LL+ +G    L +           +            +    A+   
Sbjct: 119 QFCESKLRYLELALLRELGAMPSLIRDTQGEPLIPEHYYQLVPELGFQFVLN-SRAKHTY 177

Query: 185 VLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHL-LRENFLGK 235
                    +  +  +    A +     L +  LQ  + +  L  R+ F+  
Sbjct: 178 QGAMLTALNDNQLLQEQFLEAKR-----LMRSMLQPLLGNKPLVSRQLFIQA 224


>gi|83644634|ref|YP_433069.1| DNA repair protein RecO [Hahella chejuensis KCTC 2396]
 gi|123534040|sp|Q2SL30|RECO_HAHCH RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|83632677|gb|ABC28644.1| DNA repair protein RecO [Hahella chejuensis KCTC 2396]
          Length = 238

 Score = 93.3 bits (230), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 44/236 (18%), Positives = 79/236 (33%), Gaps = 15/236 (6%)

Query: 7   AIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM-QPILQAGNLVRVNWRSRLAQN 65
           A +L  R Y E + I++++T   G+    ++ G   +     LQ    + V    R    
Sbjct: 9   AYVLHSRPYRESSYIVDLITEADGKASAVLKGGGRRKGVPGTLQPFTELEVELGGRGELK 68

Query: 66  LGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPS 125
                      +    L+ +    GL     L + L   E C +++D     L    +P 
Sbjct: 69  SLIRYETTNIRYP---LAGAALYAGLYLNELLVKLLQPLEGCRKVFDAYKSSLTFLSLPQ 125

Query: 126 VI-GKIFVQIELMLLKNIGFGLDLTKCVVT---GVTQDLLWVSPKSGGAVCRSVGLPYAE 181
                   ++E  LL  +GFG+D   CV +    + ++ +         V R+   P + 
Sbjct: 126 PNLEPGIRELEFALLNELGFGVDF--CVESATGDIVKNNIAYYFSLTEGVSRTP-EPCSV 182

Query: 182 KMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGKLL 237
            +                 SL +A +LT   L+    +         RE     L 
Sbjct: 183 VIEGHHLIAIAGRDWSVPGSLSAAKRLTRRCLD----ELLGGRPLHSRELMRSYLK 234


>gi|24372928|ref|NP_716970.1| DNA repair protein RecO [Shewanella oneidensis MR-1]
 gi|24347064|gb|AAN54415.1|AE015579_4 DNA repair protein RecO [Shewanella oneidensis MR-1]
          Length = 233

 Score = 93.3 bits (230), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 33/232 (14%), Positives = 67/232 (28%), Gaps = 12/232 (5%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVR-NGQSHRMQPILQAGNLVRVNWRSRLAQ 64
              +L  R Y E + ++ ++    GR     R       ++ ILQ    +   +  +   
Sbjct: 3   RGYVLHHRPYRESSALVNLLVDGIGRVDAVARVGSGKRSIKSILQPFQPLIFEFSGKSEL 62

Query: 65  NLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIP 124
                  ++  +  A  LS      G+     L R L  +     L+ + +  L      
Sbjct: 63  KN---ISQIEAAAPAVPLSGYSLYAGMYINELLMRTLSVQHNAEALFFIYHQALVGLA-A 118

Query: 125 SVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKML 184
                    +EL LL+ +G    L +                        +    A+   
Sbjct: 119 QFCESKLRYLELALLRELGAMPSLIRDTQGEPLIPEHCYQLVPELGFQFVLN-SRAKHTY 177

Query: 185 VLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHL-LRENFLGK 235
                    +  +  +    A +     L +  LQ  + +  L  R+ F+  
Sbjct: 178 QGAMLTALNDNQLLQEQFLEAKR-----LMRSMLQPLLGNKPLVSRQLFIQA 224


>gi|270283981|ref|ZP_05965342.2| DNA repair protein RecO [Bifidobacterium gallicum DSM 20093]
 gi|270277851|gb|EFA23705.1| DNA repair protein RecO [Bifidobacterium gallicum DSM 20093]
          Length = 258

 Score = 93.3 bits (230), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 33/205 (16%), Positives = 71/205 (34%), Gaps = 6/205 (2%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQ--PILQAGNLVRVNWRS 60
           ++D+ I+L     GE + ++ ++TR +G+     +  +  + +    L+    V +    
Sbjct: 22  YRDEGIVLRTMKLGEADRVITLLTRDHGKVRAVAKGVRRTKSRFGARLEPFMRVDLLLNE 81

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
                    + E +  +   + +          IV +   L   E          +    
Sbjct: 82  -GRTFDAIRQAESVSVYAGAITADYDRYRAATIIVEVINDLASTEHEPVGAQYPLLAGAL 140

Query: 121 HKIPSVIGKIFVQIELMLLKNI---GFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGL 177
           + + +   +  +     +L+ I   G+   L  CVV G    L   S +SGG +C +   
Sbjct: 141 NALATARHEPELISNSYVLRAIAMAGWTPRLDSCVVCGRVDQLTHFSARSGGVMCATDRT 200

Query: 178 PYAEKMLVLPSFLWKEEQTIDADSL 202
           P A ++              D  +L
Sbjct: 201 PDAIRIQPAERLQLIALLAGDWAAL 225


>gi|257869128|ref|ZP_05648781.1| DNA repair protein recO [Enterococcus gallinarum EG2]
 gi|257803292|gb|EEV32114.1| DNA repair protein recO [Enterococcus gallinarum EG2]
          Length = 260

 Score = 93.3 bits (230), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 33/193 (17%), Positives = 60/193 (31%), Gaps = 3/193 (1%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWR 59
           M   +   I+L  R + EK+ ++++ T   G+ + +V+              +     + 
Sbjct: 3   MNLVETKGILLFTRDHKEKDKLVKIFTESAGKQMFYVKGAHRKNNPLTPALLSYTEATYI 62

Query: 60  S--RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIF 117
              R          + + S         L  Y    +      + +R     LY  L+  
Sbjct: 63  GNIRSEGLSFLNNAKDIHSFRKIQGDIFLAGYATYLLNLADSAIDDRVYDPNLYHFLHEA 122

Query: 118 LNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGL 177
           L      +    I    E+ LL+  G     T C V G T+     S K  G +C     
Sbjct: 123 LQLMDTDNDAEIITNIFEIQLLQRFGVSPIWTHCAVCGQTEGRFDYSSKYNGVICEKHWA 182

Query: 178 PYAEKMLVLPSFL 190
               +    P  +
Sbjct: 183 LDDHRYHGDPRAI 195


>gi|90416442|ref|ZP_01224373.1| DNA repair protein recO (Recombination protein O) [marine gamma
           proteobacterium HTCC2207]
 gi|90331641|gb|EAS46869.1| DNA repair protein recO (Recombination protein O) [marine gamma
           proteobacterium HTCC2207]
          Length = 242

 Score = 93.3 bits (230), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 27/153 (17%), Positives = 53/153 (34%), Gaps = 7/153 (4%)

Query: 1   MYWQDD-AIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPI---LQAGNLVRV 56
           M  + +   +L    Y + ++++++ T  +GR     +  +    Q I   +        
Sbjct: 1   MRIEAEPGFLLHSTPYRDTSLLVDLYTANHGRVRCVAKGFRKPNKQGINRSIFPYTEHHF 60

Query: 57  NWRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNI 116
           +W+ R          +         L       GL      +R L E++    LY     
Sbjct: 61  SWQGRGELKT---LTKADVVQAPVFLKQECLFTGLYINELFYRLLQEQDIHQYLYQQYQQ 117

Query: 117 FLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLT 149
           F+              Q+E+ LL+ +G+GL L 
Sbjct: 118 FMAILCGAQPDEVHLRQLEMTLLEELGYGLVLD 150


>gi|117921463|ref|YP_870655.1| DNA repair protein RecO [Shewanella sp. ANA-3]
 gi|117613795|gb|ABK49249.1| DNA repair protein RecO [Shewanella sp. ANA-3]
          Length = 233

 Score = 93.0 bits (229), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 33/232 (14%), Positives = 67/232 (28%), Gaps = 12/232 (5%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVR-NGQSHRMQPILQAGNLVRVNWRSRLAQ 64
              +L  R Y E + ++ ++    GR     R       ++ ILQ    +   +  +   
Sbjct: 3   RGYVLHHRPYRESSALVNLLVDGIGRVDAVARVGSGKRSIKSILQPFQPLIFEFSGKSEL 62

Query: 65  NLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIP 124
                  ++  +  A  LS      G+     L R L        L+ + +  L      
Sbjct: 63  KN---ISQIEAAAPAVPLSGYSLYAGMYINELLMRILSVHHNAEALFLIYHQALVGLA-A 118

Query: 125 SVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKML 184
                    +EL LL+ +G    L +           +            +    A+   
Sbjct: 119 QFCESKLRYLELALLRELGAMPSLIRDTQGEPLIPEHYYQLVPELGFQFVLN-SRAKHTY 177

Query: 185 VLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHL-LRENFLGK 235
                    +  +  +    A +     L +  LQ  + +  L  R+ F+  
Sbjct: 178 QGAMLTALNDNQLLQEQFLEAKR-----LMRSMLQPLLGNKPLVSRQLFIQA 224


>gi|253996998|ref|YP_003049062.1| DNA repair protein RecO [Methylotenera mobilis JLW8]
 gi|253983677|gb|ACT48535.1| DNA repair protein RecO [Methylotenera mobilis JLW8]
          Length = 248

 Score = 93.0 bits (229), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 41/239 (17%), Positives = 77/239 (32%), Gaps = 19/239 (7%)

Query: 8   IILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLAQN 65
            +L    + E ++++E+ +R++GR     +  +  R   + +LQA   +   W  +L   
Sbjct: 15  YVLHTYPFKETSLVVELFSREFGRVATTAKGARRPRSAMRGMLQAFQPMLATWSGKLELK 74

Query: 66  LGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPS 125
                  +  + C  LL     + G      L R LP  +P   L+      L       
Sbjct: 75  TLH---GLEWNGCLLLLQGEALMCGFYLNELLLRLLPREDPHEALFAYYAETLKALASEQ 131

Query: 126 VIGKIFVQIELMLLKNIGFG--LDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKM 183
            +     + EL  L+ +G+   L L       V Q       + G    R     Y  + 
Sbjct: 132 HLATTLRRFELKFLQELGYAIPLQLDVNNTPIVMQQAYRYEAEHGAYPIRCASARYETRY 191

Query: 184 LVL------PSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCH-LLRENFLGK 235
                           +   D  + + + Q     L +Y L H +       R+  +  
Sbjct: 192 ENGVQLSGKTLIDMLHDDYSDEQTQQQSKQ-----LMRYLLAHYLGDKPLHTRQLLIEL 245


>gi|85860059|ref|YP_462261.1| DNA repair protein [Syntrophus aciditrophicus SB]
 gi|85723150|gb|ABC78093.1| DNA repair protein [Syntrophus aciditrophicus SB]
          Length = 277

 Score = 93.0 bits (229), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 28/159 (17%), Positives = 61/159 (38%), Gaps = 3/159 (1%)

Query: 4   QDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQ--PILQAGNLVRVNWRSR 61
           + +  +L   SY + ++I+   TR +G+     R  +  R +   +L+      + +  +
Sbjct: 26  KTEGFVLKTLSYSDSDLIVTFYTRNFGKLTAIARGARKSRKRFVNVLEPFCCSSLLFSRK 85

Query: 62  LAQNLGEFRFEVLESHCAKLL-SSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
               L       + +   ++  S    L     I  +  F  E +P  EL+++L  FL  
Sbjct: 86  QRDQLAWLESCQVINEFPEIRKSLDRTLLASYLIDLVDHFSIEEKPGRELFELLRSFLLL 145

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQD 159
            +      ++    E+  LK  G+   L  C++     +
Sbjct: 146 IEEGDTSERLLRFFEIRHLKLTGYAPALDCCMICKAPLN 184


>gi|257886867|ref|ZP_05666520.1| recombination protein O [Enterococcus faecium 1,141,733]
 gi|293568653|ref|ZP_06679968.1| DNA repair protein RecO [Enterococcus faecium E1071]
 gi|293571623|ref|ZP_06682644.1| DNA repair protein RecO [Enterococcus faecium E980]
 gi|257822921|gb|EEV49853.1| recombination protein O [Enterococcus faecium 1,141,733]
 gi|291588613|gb|EFF20446.1| DNA repair protein RecO [Enterococcus faecium E1071]
 gi|291608293|gb|EFF37594.1| DNA repair protein RecO [Enterococcus faecium E980]
          Length = 272

 Score = 93.0 bits (229), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 32/186 (17%), Positives = 61/186 (32%), Gaps = 2/186 (1%)

Query: 4   QDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNWRSR 61
           +   +IL  R+Y EK+ ++++ T   G+ + +++        + P L            R
Sbjct: 6   ESKGLILSSRNYKEKDKLVKIFTESSGKMMFYIKGIHRQNQPLAPALLPFTEAVYIGNFR 65

Query: 62  LAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCH 121
                     + + +         L  YG   +  +   + + +    L+      L   
Sbjct: 66  SEGLSFLSSVKDVHAFRHIQEDIFLSGYGTYLLNLVDAAIEDHQYDPHLFQFTQQALQRM 125

Query: 122 KIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAE 181
                   I    E+ +L+  G     T CVV G T+     S K GG +C         
Sbjct: 126 DQGDDAEIITNIFEVQILQRFGIAPIWTHCVVCGETKGKFDYSSKYGGVICERHWSMDDH 185

Query: 182 KMLVLP 187
           +    P
Sbjct: 186 RYHADP 191


>gi|56478592|ref|YP_160181.1| DNA repair protein RecO [Aromatoleum aromaticum EbN1]
 gi|62287380|sp|Q5P084|RECO_AZOSE RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|56314635|emb|CAI09280.1| DNA repair protein recO (Recombination protein O) [Aromatoleum
           aromaticum EbN1]
          Length = 239

 Score = 93.0 bits (229), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 26/148 (17%), Positives = 55/148 (37%), Gaps = 6/148 (4%)

Query: 4   QDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQS--HRMQPILQAGNLVRVNWRSR 61
           Q  A +L    + E ++++E+ +R +GR     +  +     ++ ++ A   + ++W   
Sbjct: 9   QQPAFVLHTYPWRETSLVVEIFSRDHGRVALVAKGARRPMSALRGVIMAFQPLLMDWSGG 68

Query: 62  LAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCH 121
                              LL+    + G      L R     +    L++     L+  
Sbjct: 69  GEVKT---LVRAEWRGGQPLLTGRALMCGYYLNELLVRLTAREDAHPALFEAYADALSQL 125

Query: 122 KIPSVIGKIFVQIELMLLKNIGFGLDLT 149
               V   I  + EL LL+ +G+G+ L 
Sbjct: 126 GRGDVAP-ILRRFELTLLRELGYGIGLD 152


>gi|269218573|ref|ZP_06162427.1| DNA repair protein RecO [Actinomyces sp. oral taxon 848 str. F0332]
 gi|269211684|gb|EEZ78024.1| DNA repair protein RecO [Actinomyces sp. oral taxon 848 str. F0332]
          Length = 243

 Score = 93.0 bits (229), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 36/228 (15%), Positives = 79/228 (34%), Gaps = 14/228 (6%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQ--PILQAGNLVRVNWRS 60
           ++D+AI+L     GE + I+   +R++G+  G  +  +  + +    L+  ++V +    
Sbjct: 4   YRDEAIVLRTHDLGEADRIITFFSRRHGKMRGVAKGVRRTKSRFGARLEPFSMVDLQLYE 63

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
               ++       L  +   +            I  +   L   E   +    L +    
Sbjct: 64  GRTLDV-VTEAATLNPYGRSIGRDYDAYTCACVIAEVADKLAAIEEEPDQAHYLLLHGAI 122

Query: 121 HKIPSVIGKIFVQIELMLLKNI---GFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGL 177
           H + +   +  + ++  +L+ +   G+GL L +C V G  + L     +SGG VC     
Sbjct: 123 HALATGAHRPALVVDSYILRAMALHGWGLSLYECAVCGRGEGLAAFHLQSGGVVCSDCAP 182

Query: 178 PYAEKMLVLPSFLWKE--------EQTIDADSLKSAFQLTDYFLNKYA 217
             A         L                    ++A  +   +L  + 
Sbjct: 183 RAAAYPAPETIELLGSLVSGRWDVADAAAEHDRRAASAIVGAYLQWHV 230


>gi|257898047|ref|ZP_05677700.1| recombination protein O [Enterococcus faecium Com15]
 gi|257835959|gb|EEV61033.1| recombination protein O [Enterococcus faecium Com15]
          Length = 270

 Score = 93.0 bits (229), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 32/186 (17%), Positives = 61/186 (32%), Gaps = 2/186 (1%)

Query: 4   QDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNWRSR 61
           +   +IL  R+Y EK+ ++++ T   G+ + +++        + P L            R
Sbjct: 6   ESKGLILSSRNYKEKDKLVKIFTESSGKMMFYIKGIHRQNQPLAPALLPFTEAVYIGNFR 65

Query: 62  LAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCH 121
                     + + +         L  YG   +  +   + + +    L+      L   
Sbjct: 66  SEGLSFLSSVKDVHAFRHIQEDIFLSGYGTYLLNLVDAAIEDHQYDPHLFQFTQQALQRM 125

Query: 122 KIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAE 181
                   I    E+ +L+  G     T CVV G T+     S K GG +C         
Sbjct: 126 DQGDDAEIITNIFEVQILQRFGIAPIWTHCVVCGETKGKFDYSSKYGGVICERHWSMDDH 185

Query: 182 KMLVLP 187
           +    P
Sbjct: 186 RYHADP 191


>gi|308069927|ref|YP_003871532.1| DNA repair protein RecO [Paenibacillus polymyxa E681]
 gi|305859206|gb|ADM70994.1| DNA repair protein recO (Recombination protein O) [Paenibacillus
           polymyxa E681]
          Length = 250

 Score = 93.0 bits (229), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 33/191 (17%), Positives = 62/191 (32%), Gaps = 4/191 (2%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQ--PILQAGNLVRVNW 58
           M ++ + I++    YGE N I+ + T   G+    VR  +  + +   + Q        +
Sbjct: 1   MLYRVEGIVIRSMDYGEGNKIITLCTESGGKAGVLVRGAKKSKSRHAALTQPFTYGEFVF 60

Query: 59  RSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFL 118
             R          E+++SH       +   Y   +   L R L + E     +  L   L
Sbjct: 61  F-RNTGLGTLNAGEIIQSHHTLREDITKAAYASYACELLDRVLQDEETGAFWFKQLKACL 119

Query: 119 NCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVT-QDLLWVSPKSGGAVCRSVGL 177
              +       +    E  +L+  G+   L  C+ +G    D         G V      
Sbjct: 120 EALESGKDPLIVMSIYEFKILQAAGYAPQLDACISSGQQCADEDMFVSPRLGGVLCRSYK 179

Query: 178 PYAEKMLVLPS 188
            +    L +  
Sbjct: 180 HFDPAALSVTP 190


>gi|294787447|ref|ZP_06752700.1| DNA repair protein RecO [Parascardovia denticolens F0305]
 gi|315226983|ref|ZP_07868770.1| recombinational DNA repair protein (RecF pathway) [Parascardovia
           denticolens DSM 10105]
 gi|294484803|gb|EFG32438.1| DNA repair protein RecO [Parascardovia denticolens F0305]
 gi|315119433|gb|EFT82566.1| recombinational DNA repair protein (RecF pathway) [Parascardovia
           denticolens DSM 10105]
          Length = 248

 Score = 92.6 bits (228), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 32/210 (15%), Positives = 76/210 (36%), Gaps = 8/210 (3%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQ--PILQAGNLVRVNWRS 60
           ++D  ++L     GE + I+ ++T ++G+     R  +  R +    L+      +    
Sbjct: 4   YRDQGLVLRAIKLGETDRIITILTSRHGKIRAVARGVRRTRSRFGSRLEPFMRDDLLIAQ 63

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPC--LELYDMLNIFL 118
              +     +  V+ ++  K+++          IV     +           +    + +
Sbjct: 64  GRKELDTVSQAVVISAYAPKIVADYEAYLSASVIVEAVDKVVSDLREGSESAHRQYLLAV 123

Query: 119 NCHKIPSVIGKIFVQIELMLL----KNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRS 174
                 +   +    +E   L       G+   L  C+V G   DL + S +SGG +C+ 
Sbjct: 124 GALAALAAGKRPPALVENSFLLRSVSLAGWTPRLDSCLVCGRQTDLTYFSVESGGVMCKD 183

Query: 175 VGLPYAEKMLVLPSFLWKEEQTIDADSLKS 204
             +P + ++     F  +     D  +L++
Sbjct: 184 DHVPGSRRLSPQALFQLRALLMGDWKALEA 213


>gi|325136835|gb|EGC59433.1| DNA repair protein RecO [Neisseria meningitidis M0579]
          Length = 248

 Score = 92.6 bits (228), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 41/234 (17%), Positives = 71/234 (30%), Gaps = 16/234 (6%)

Query: 8   IILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLAQN 65
            +L    + E ++ +E  +R+YGR     R+ +  +   + +L     V V+W       
Sbjct: 13  FLLASSPWRESSLRVEAFSRRYGRVALLARSARKRQSELRGVLVPFVPVSVSWYGSQELK 72

Query: 66  LGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPS 125
                                   GL     + +     +P  ELYD L   +      +
Sbjct: 73  TLH---RAEWIGGWPQPQGRALFSGLYVNELVLKLTAREDPMPELYDALAKVMEAVCREA 129

Query: 126 VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAV----CRSVGLPYAE 181
                  + E  LL  +G   DL      G              AV      +  L +  
Sbjct: 130 NHIADLRRFEWKLLNALGVAPDLHADGTGGDILADKTYRLMPEEAVMPVCEDADALSHEA 189

Query: 182 KMLVLPSFLWK--EEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFL 233
             +V    L    E     A+SL+ A ++T  F+    L    +     R+   
Sbjct: 190 GAIVEGQSLIDLREGSFRTAESLQQALKITRLFI--RHLLPEGL---KSRQVLE 238


>gi|126667177|ref|ZP_01738151.1| DNA repair protein RecO [Marinobacter sp. ELB17]
 gi|126628333|gb|EAZ98956.1| DNA repair protein RecO [Marinobacter sp. ELB17]
          Length = 239

 Score = 92.6 bits (228), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 39/239 (16%), Positives = 72/239 (30%), Gaps = 15/239 (6%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRS 60
            Q+   ++  R + E ++ ++V T  YGR     R   + +   +  LQ+   + ++W  
Sbjct: 6   IQEPGYVIHRRPWRETSLQVDVFTLNYGRVDLIARGASTSKSPLKAQLQSFQPLLLDWVG 65

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
           R               H   L  S     G      L R LP  +P   L+      +  
Sbjct: 66  RGGLKTLTQVDVR---HAPVLAQSQALFSGFYLNELLQRILPAADPYPLLFAAYLDAMAE 122

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDL----TKCVVTGVTQDLLWVSPKSGGAVCRSVG 176
               + +  +  + E  L   +G+          C      Q   +        +    G
Sbjct: 123 LAAAAELEPVLRRFERSLALALGYDFAWDLATDSCA---PVQSGWFYGYHPQQGIVERPG 179

Query: 177 LPYAEKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFLGK 235
                K L   + L            + + +     L  Y LQ   +H    R+ F+  
Sbjct: 180 ADVRVKKLRGDALLALAANDYSEIEARRSAKRVMRALVDYLLQGRPLH---SRQLFIQS 235


>gi|23099405|ref|NP_692871.1| DNA repair protein RecO [Oceanobacillus iheyensis HTE831]
 gi|42559473|sp|Q8CXD4|RECO_OCEIH RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|22777634|dbj|BAC13906.1| DNA repair protein (recombination protein O) [Oceanobacillus
           iheyensis HTE831]
          Length = 258

 Score = 92.6 bits (228), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 32/177 (18%), Positives = 61/177 (34%), Gaps = 1/177 (0%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRS 60
           M  + D II+  + YGE + ++ + + + G+     +  +  + +        +   +  
Sbjct: 1   MLEKIDGIIIKTKDYGETHKLVTIFSNKIGKFNALAKGAKKPKSRMAAVTQPFINARFFV 60

Query: 61  R-LAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLN 119
              +      + EVL+S            Y         + L  +E    LY+     L 
Sbjct: 61  YIGSGLSTIQQGEVLDSFRIIREDIFKTAYVSYMAELTDKLLDAKENDPFLYEQFYQTLL 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVG 176
                  +    +  EL L K  GF   L +C   G  + L   S + GG +C+   
Sbjct: 121 WINNQDEVDIPVIMYELKLYKKAGFAPVLHQCSRCGNQEGLSKFSIREGGMLCQQCA 177


>gi|148549492|ref|YP_001269594.1| DNA repair protein RecO [Pseudomonas putida F1]
 gi|166221906|sp|A5W8F0|RECO_PSEP1 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|148513550|gb|ABQ80410.1| DNA replication and repair protein RecO [Pseudomonas putida F1]
          Length = 227

 Score = 92.6 bits (228), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 42/231 (18%), Positives = 76/231 (32%), Gaps = 12/231 (5%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQN 65
            A +L  R+Y E + +++  T   GR    +R  +  +   +++   L+ +  R R    
Sbjct: 8   PAYVLHSRAYKETSALVDFFTP-QGRMRAVLRRARG-KGGSLVRPFVLLELELRGRGELK 65

Query: 66  LGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPS 125
                  +  S  A  L       GL     L R LP   P   +++   + L       
Sbjct: 66  N---VGRMDSSGIAAWLHGDALFSGLYLNELLMRLLPAEAPFPAIFEHYTLTLQALAEGR 122

Query: 126 VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKMLV 185
            +  +    E  LL  +G+   L++ V             +   A    V L        
Sbjct: 123 PLEPLLRSFEWRLLDELGYAFSLSQDVNDQPIAADGLYRLR-VDAGLERVELLQPGLFRG 181

Query: 186 LPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHL-LRENFLGK 235
           +      E       +L +A +     L + AL  ++    L  RE F  +
Sbjct: 182 IELLALAEADWDAPGALLAAKR-----LMRQALAVHLGAKPLVSRELFRKR 227


>gi|119361493|sp|Q2LVI1|RECO_SYNAS RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
          Length = 259

 Score = 92.6 bits (228), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 28/159 (17%), Positives = 61/159 (38%), Gaps = 3/159 (1%)

Query: 4   QDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQ--PILQAGNLVRVNWRSR 61
           + +  +L   SY + ++I+   TR +G+     R  +  R +   +L+      + +  +
Sbjct: 8   KTEGFVLKTLSYSDSDLIVTFYTRNFGKLTAIARGARKSRKRFVNVLEPFCCSSLLFSRK 67

Query: 62  LAQNLGEFRFEVLESHCAKLL-SSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
               L       + +   ++  S    L     I  +  F  E +P  EL+++L  FL  
Sbjct: 68  QRDQLAWLESCQVINEFPEIRKSLDRTLLASYLIDLVDHFSIEEKPGRELFELLRSFLLL 127

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQD 159
            +      ++    E+  LK  G+   L  C++     +
Sbjct: 128 IEEGDTSERLLRFFEIRHLKLTGYAPALDCCMICKAPLN 166


>gi|26988168|ref|NP_743593.1| DNA repair protein RecO [Pseudomonas putida KT2440]
 gi|38258497|sp|Q88MY3|RECO_PSEPK RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|24982902|gb|AAN67057.1|AE016334_6 DNA repair protein RecO [Pseudomonas putida KT2440]
          Length = 227

 Score = 92.6 bits (228), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 42/231 (18%), Positives = 75/231 (32%), Gaps = 12/231 (5%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQN 65
            A +L  R+Y E + +++  T   GR    +R  +S +   +++    + V  R R    
Sbjct: 8   PAYVLHSRAYKETSALVDFFTP-QGRMRAVLRRARS-KGGSLVRPFVSLEVELRGRGELK 65

Query: 66  LGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPS 125
                  +  +  A  L       GL     L R LP   P   +++   + L       
Sbjct: 66  N---VSRMDSTGIAAWLHGDALFSGLYLNELLMRLLPAEAPFPTIFEHYTLTLQALAEGR 122

Query: 126 VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKMLV 185
            +  +    E  LL  +G+   L + V             +   A    V L        
Sbjct: 123 PLEPLLRSFEWRLLDELGYAFSLNQDVNDQPIAADGLYRLR-VDAGLERVELLQPGLFRG 181

Query: 186 LPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHL-LRENFLGK 235
           +      E       +L +A +     L + AL  ++    L  RE F  +
Sbjct: 182 IELLALAEADWDAPGALLAAKR-----LMRQALAVHLGAKPLVSRELFRKR 227


>gi|254805524|ref|YP_003083745.1| DNA repair protein RecO [Neisseria meningitidis alpha14]
 gi|254669066|emb|CBA07573.1| DNA repair protein RecO [Neisseria meningitidis alpha14]
          Length = 248

 Score = 92.6 bits (228), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 40/234 (17%), Positives = 71/234 (30%), Gaps = 16/234 (6%)

Query: 8   IILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLAQN 65
            +L    + E ++ +E  +R+YGR     R+ +  +   + +L     V  +W       
Sbjct: 13  FLLASSPWRESSLRVEAFSRRYGRVALLARSARKRQSELRGVLVPFVPVSASWYGSQELK 72

Query: 66  LGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPS 125
                  +                GL     + +     +P  ELYD L   +      +
Sbjct: 73  TLHRAEWIGGWRQP---QGRALFSGLYVNELVLKLTAREDPMPELYDALAKVMEAVCREA 129

Query: 126 VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAV----CRSVGLPYAE 181
                  + E  LL  +G   DL      G              AV      +  L +  
Sbjct: 130 NHIADLRRFEWKLLNALGVAPDLHADGTGGDILADKTYRLMPEEAVMPVCEDADALSHEA 189

Query: 182 KMLVLPSFLWK--EEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFL 233
             +V    L    E     A+SL+ A ++T  F+    L    +     R+   
Sbjct: 190 GAIVEGQSLIDLREGSFRTAESLQQALKITRLFI--RHLLPEGL---KSRQVLE 238


>gi|254392569|ref|ZP_05007746.1| DNA repair protein recO [Streptomyces clavuligerus ATCC 27064]
 gi|294812537|ref|ZP_06771180.1| DNA repair protein recO [Streptomyces clavuligerus ATCC 27064]
 gi|326441010|ref|ZP_08215744.1| DNA repair protein RecO [Streptomyces clavuligerus ATCC 27064]
 gi|197706233|gb|EDY52045.1| DNA repair protein recO [Streptomyces clavuligerus ATCC 27064]
 gi|294325136|gb|EFG06779.1| DNA repair protein recO [Streptomyces clavuligerus ATCC 27064]
          Length = 248

 Score = 92.6 bits (228), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 31/190 (16%), Positives = 76/190 (40%), Gaps = 14/190 (7%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQ--PILQAGNLVRVNWRS 60
           ++DD ++L  +  GE + I+ ++TR +GR     R  +  + +    L+  + V V + +
Sbjct: 4   FRDDGVVLRTQKLGEADRIITLLTRGHGRVRAVARGVRRTKSRFGARLEPFSHVDVQFFA 63

Query: 61  RLAQNLG-----EFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLEL--YDM 113
           R ++ +G       + E +  +   +++         +++       + E    +  Y +
Sbjct: 64  RGSELVGRGLPLCTQSETIAPYGGGIVTDYARYTAGTAMLETAERFTDHEGEPAVQQYLL 123

Query: 114 LNIFLNCHKIPSVIGKIFVQIELMLLKNI---GFGLDLTKCVVTGVTQDLLWVSPKSGGA 170
           L   L           +   ++  LL+++   G+      C   G+     + S  +GG 
Sbjct: 124 LVGGLRALSRGEHAPHLV--LDAFLLRSLAVNGYAPSFDACARCGLPGPNRFFSVAAGGV 181

Query: 171 VCRSVGLPYA 180
           +C    +P +
Sbjct: 182 ICGDCRVPGS 191


>gi|284990196|ref|YP_003408750.1| DNA repair protein RecO [Geodermatophilus obscurus DSM 43160]
 gi|284063441|gb|ADB74379.1| DNA repair protein RecO [Geodermatophilus obscurus DSM 43160]
          Length = 263

 Score = 92.6 bits (228), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 31/203 (15%), Positives = 72/203 (35%), Gaps = 6/203 (2%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQ--PILQAGNLVRVNWRS 60
           ++D+ I+L  +  GE + I+ V+TR++G+     +  +  + +    L+  + V + + +
Sbjct: 9   YRDEGIVLRTQKLGEADRIVTVLTRRHGKVRAVAKGVRRTKSKFGARLEPFSHVDLQFYT 68

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
               ++       + ++   +++         +++     L   E    L   L +    
Sbjct: 69  GRTLDIVSQAES-IRAYGQSIVTDYPAYTAGTAVLETADRLTAEEKEPSLRLFLLVIGAL 127

Query: 121 HKIPSVIGKIFVQIELMLLKNI---GFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGL 177
             +        + ++  LL+ +   G+   L  C   G        S  +GG VC     
Sbjct: 128 RALSERTHPAGLVLDAFLLRAMSVAGWEPALGGCARCGEEGPHRHFSVPAGGMVCPPCRP 187

Query: 178 PYAEKMLVLPSFLWKEEQTIDAD 200
             +         L     T D D
Sbjct: 188 TGSAMPNPATVELLDALLTGDWD 210


>gi|227551967|ref|ZP_03982016.1| recombination protein RecO [Enterococcus faecium TX1330]
 gi|257895441|ref|ZP_05675094.1| recombination protein O [Enterococcus faecium Com12]
 gi|293378308|ref|ZP_06624477.1| DNA repair protein RecO [Enterococcus faecium PC4.1]
 gi|227178872|gb|EEI59844.1| recombination protein RecO [Enterococcus faecium TX1330]
 gi|257832006|gb|EEV58427.1| recombination protein O [Enterococcus faecium Com12]
 gi|292643172|gb|EFF61313.1| DNA repair protein RecO [Enterococcus faecium PC4.1]
          Length = 272

 Score = 92.6 bits (228), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 32/186 (17%), Positives = 61/186 (32%), Gaps = 2/186 (1%)

Query: 4   QDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNWRSR 61
           +   +IL  R+Y EK+ ++++ T   G+ + +++        + P L            R
Sbjct: 6   ESKGLILSSRNYKEKDKLVKIFTESSGKMMFYIKGIHRQNQPLAPALLPFTEAVYIGNFR 65

Query: 62  LAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCH 121
                     + + +         L  YG   +  +   + + +    L+      L   
Sbjct: 66  SEGLSFLSSVKDVHAFRHIQEDIFLSGYGTYLLNLVDAAIEDHQYDPHLFQFTQQALQRM 125

Query: 122 KIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAE 181
                   I    E+ +L+  G     T CVV G T+     S K GG +C         
Sbjct: 126 DQGDDAEIITNIFEVQILQRFGITPIWTHCVVCGETKGKFDYSSKYGGVICERHWSMDDH 185

Query: 182 KMLVLP 187
           +    P
Sbjct: 186 RYHADP 191


>gi|90407381|ref|ZP_01215566.1| DNA repair protein RecO [Psychromonas sp. CNPT3]
 gi|90311532|gb|EAS39632.1| DNA repair protein RecO [Psychromonas sp. CNPT3]
          Length = 240

 Score = 92.6 bits (228), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 36/234 (15%), Positives = 73/234 (31%), Gaps = 16/234 (6%)

Query: 7   AIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNWRSRLAQ 64
           A IL  R Y E +++L++  +  G+     + G+S     +   Q   L++  +  R + 
Sbjct: 8   AFILHRRPYRETSLLLDLFCQDIGKVSLIYKGGRSSTRLRRGCAQPFTLLQATYFGRSSL 67

Query: 65  NLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCH--- 121
              +      +      L        +     L+R L     C  L+      L      
Sbjct: 68  KTVKSIEAKTQVVP---LVGERLYMAMYVNELLYRLLQAETACDGLFSCYQDTLLALAGA 124

Query: 122 KIPSVIGKIFVQIELMLLKNIGFGLDLTKCVV-TGVTQDLLWVSPKSGGAVCRSVGLPYA 180
           K            EL LL+++G+G++ T+ +    + +                  +   
Sbjct: 125 KDNQHAQIALRNFELTLLESLGYGVNFTQDIYSDELIEPGFDYQYLQQQGFFAKQAIHQK 184

Query: 181 EKMLVLPSFLWKEEQTIDADSLKS-AFQLTDYFLNKYALQHNIIHCH-LLRENF 232
           + +          E+        S A +       + AL H + +     R  F
Sbjct: 185 QHVYSGLQIQALAERNFSNAEFLSPAKRFC-----RQALAHLLGNKPLHSRRLF 233


>gi|257882781|ref|ZP_05662434.1| recombination protein O [Enterococcus faecium 1,231,502]
 gi|257884089|ref|ZP_05663742.1| recombination protein O [Enterococcus faecium 1,231,501]
 gi|294622999|ref|ZP_06701888.1| DNA repair protein RecO [Enterococcus faecium U0317]
 gi|257818439|gb|EEV45767.1| recombination protein O [Enterococcus faecium 1,231,502]
 gi|257819927|gb|EEV47075.1| recombination protein O [Enterococcus faecium 1,231,501]
 gi|291597555|gb|EFF28717.1| DNA repair protein RecO [Enterococcus faecium U0317]
          Length = 270

 Score = 92.6 bits (228), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 32/186 (17%), Positives = 61/186 (32%), Gaps = 2/186 (1%)

Query: 4   QDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNWRSR 61
           +   +IL  R+Y EK+ ++++ T   G+ + +++        + P L            R
Sbjct: 6   ESKGLILSSRNYKEKDKLVKIFTESSGKMMFYIKGIHRQNQPLAPALLPFTEAVYIGNFR 65

Query: 62  LAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCH 121
                     + + +         L  YG   +  +   + + +    L+      L   
Sbjct: 66  SEGLSFLSSVKDVHAFRNIQEDIFLSGYGTYLLNLVDAAIEDHQYDPHLFQFTQQALQRM 125

Query: 122 KIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAE 181
                   I    E+ +L+  G     T CVV G T+     S K GG +C         
Sbjct: 126 DQGDDAEIITNIFEVQILQRFGIAPIWTHCVVCGETKGKFDYSSKYGGVICERHWSMDDH 185

Query: 182 KMLVLP 187
           +    P
Sbjct: 186 RYHADP 191


>gi|74318102|ref|YP_315842.1| DNA repair protein RecO [Thiobacillus denitrificans ATCC 25259]
 gi|90103526|sp|Q3SH52|RECO_THIDA RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|74057597|gb|AAZ98037.1| Recombination protein O, RecO [Thiobacillus denitrificans ATCC
           25259]
          Length = 256

 Score = 92.6 bits (228), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 30/186 (16%), Positives = 56/186 (30%), Gaps = 14/186 (7%)

Query: 4   QDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSR 61
            +   IL    + E +++ EV TR +GR     R  +      + ++Q  + + ++W  +
Sbjct: 17  NESGFILHTYPFKETSVVAEVFTRAHGRVALIARGARRPASALRGLMQPFSPLLLSWFGK 76

Query: 62  LAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCH 121
                                     + G      L R L   +    LYD     L+  
Sbjct: 77  ADLKTLHAAEWQGGLVAP---QGRALMCGFYLNELLLRLLARGDAHERLYDRYVETLDQL 133

Query: 122 ---------KIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVC 172
                    +  +   +I  + E  LL  IG+G            +       +      
Sbjct: 134 ARSAAASDAERATAFERILRRFEKNLLSEIGYGATFDVEAGGAAIEPGAAYVFQPERGAL 193

Query: 173 RSVGLP 178
           R+ G P
Sbjct: 194 RAAGQP 199


>gi|297194472|ref|ZP_06911870.1| DNA repair protein recO [Streptomyces pristinaespiralis ATCC 25486]
 gi|197718717|gb|EDY62625.1| DNA repair protein recO [Streptomyces pristinaespiralis ATCC 25486]
          Length = 248

 Score = 92.6 bits (228), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 31/190 (16%), Positives = 76/190 (40%), Gaps = 14/190 (7%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQ--PILQAGNLVRVNWRS 60
           ++DD ++L  +  GE + I+ ++TR +GR     R  +  + +    L+  + V V + +
Sbjct: 4   FRDDGVVLRTQKLGEADRIITLLTRGHGRVRAVARGVRRTKSKFGARLEPFSHVDVQFFA 63

Query: 61  RLAQNLG-----EFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLEL--YDM 113
           R ++ +G       + E +  +   +++         +++       + E    +  Y +
Sbjct: 64  RGSELVGRGLPLCTQSETIAPYGGGIVTDYARYTAGTAMLETAERFADHEGEPAVQQYLL 123

Query: 114 LNIFLNCHKIPSVIGKIFVQIELMLLKNI---GFGLDLTKCVVTGVTQDLLWVSPKSGGA 170
           L   L           +   ++  LL+++   G+      C   G+     + S  +GG 
Sbjct: 124 LVGGLRSLSRGEHAPHLV--LDAFLLRSLAVNGYAPSFDDCARCGLPGPNRFFSVAAGGV 181

Query: 171 VCRSVGLPYA 180
           +C    +P +
Sbjct: 182 ICGDCRVPGS 191


>gi|325128807|gb|EGC51667.1| DNA repair protein RecO [Neisseria meningitidis N1568]
          Length = 264

 Score = 92.2 bits (227), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 40/234 (17%), Positives = 70/234 (29%), Gaps = 16/234 (6%)

Query: 8   IILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLAQN 65
            +L    + E ++ +E  +R+YGR     R+ +  +   + +L     V  +W       
Sbjct: 13  FLLASSPWRESSLRVEAFSRRYGRVALLARSARKRQSELRGVLVPFVPVSASWYGSQELK 72

Query: 66  LGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPS 125
                                   GL     + +     +P  ELYD L   +      +
Sbjct: 73  TLHRAEWGGGWRQP---QGRALFSGLYVNELVLKLTAREDPMPELYDALAKVMEAVCREA 129

Query: 126 VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAV----CRSVGLPYAE 181
                  + E  LL  +G   DL      G              AV      +  L +  
Sbjct: 130 NHIADLRRFEWKLLNALGVAPDLHADGTGGDILADKTYRLMPEEAVMPVCEDADALSHEA 189

Query: 182 KMLVLPSFLWK--EEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFL 233
             +V    L    E     A+SL+ A ++T  F+    L    +     R+   
Sbjct: 190 GAIVEGQSLIDLREGSFRTAESLQQALKITRLFI--RHLLPEGL---KSRQVLE 238


>gi|325134814|gb|EGC57450.1| DNA repair protein RecO [Neisseria meningitidis M13399]
 gi|325144985|gb|EGC67268.1| DNA repair protein RecO [Neisseria meningitidis M01-240013]
 gi|325205513|gb|ADZ00966.1| DNA repair protein RecO [Neisseria meningitidis M04-240196]
          Length = 264

 Score = 92.2 bits (227), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 40/234 (17%), Positives = 70/234 (29%), Gaps = 16/234 (6%)

Query: 8   IILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLAQN 65
            +L    + E ++ +E  +R+YGR     R+ +  +   + +L     V  +W       
Sbjct: 13  FLLASSPWRESSLRVEAFSRRYGRVALLARSARKRQSELRGVLVPFVPVSASWYGSQELK 72

Query: 66  LGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPS 125
                                   GL     + +     +P  ELYD L   +      +
Sbjct: 73  TLH---RAEWIGGWPQPQGRALFSGLYVNELMLKLTVREDPLPELYDALAEVMEAVCREA 129

Query: 126 VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAV----CRSVGLPYAE 181
                  + E  LL  +G   DL      G              AV      +  L +  
Sbjct: 130 NHIADLRRFEWKLLNALGVAPDLHADGTGGDILADKTYRLMPEEAVMPVCEDADALSHEA 189

Query: 182 KMLVLPSFLWK--EEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLLRENFL 233
             +V    L    E     A+SL+ A ++T  F+    L    +     R+   
Sbjct: 190 GAIVEGQSLIDLREGSFRTAESLQQALKITRLFI--RHLLPEGL---KSRQVLE 238


>gi|239979354|ref|ZP_04701878.1| DNA repair protein RecO [Streptomyces albus J1074]
 gi|291451229|ref|ZP_06590619.1| DNA repair protein RecO [Streptomyces albus J1074]
 gi|291354178|gb|EFE81080.1| DNA repair protein RecO [Streptomyces albus J1074]
          Length = 248

 Score = 92.2 bits (227), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 35/190 (18%), Positives = 81/190 (42%), Gaps = 14/190 (7%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQ--PILQAGNLVRVNWRS 60
           ++DD I+L  +  GE + I+  +TR+YGR     R  +  + +    L+  + V V + +
Sbjct: 4   FRDDGIVLRTQKLGEADRIITFLTRRYGRVRAVARGVRRTKSKFGARLEPFSHVDVQYFA 63

Query: 61  RLAQNLG-----EFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLEL--YDM 113
           R ++ +G       + E + ++ + +++         +++       + E    +  Y +
Sbjct: 64  RGSELIGRGLPLCTQTETIAAYGSGIVTDYDRYTAGTAMLETAERFTDHEGQPAVQQYLL 123

Query: 114 LNIFLNCHKIPSVIGKIFVQIELMLLKNI---GFGLDLTKCVVTGVTQDLLWVSPKSGGA 170
           L   L          ++   ++  LL+++   G+   L  C   G+     + S  +GG+
Sbjct: 124 LVGGLRTLARGEHAPRLV--LDAFLLRSLAVNGYAPSLGDCARCGMPGPNRFFSVAAGGS 181

Query: 171 VCRSVGLPYA 180
           VC    +P +
Sbjct: 182 VCGECRVPGS 191


>gi|262281673|ref|ZP_06059442.1| DNA repair protein recO [Streptococcus sp. 2_1_36FAA]
 gi|262262127|gb|EEY80824.1| DNA repair protein recO [Streptococcus sp. 2_1_36FAA]
          Length = 259

 Score = 92.2 bits (227), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 35/205 (17%), Positives = 77/205 (37%), Gaps = 3/205 (1%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWR 59
           M      A++L  R++ E + ++++ T Q G+ + FV++  + ++ P++Q   L  +  +
Sbjct: 1   MQSITSKALVLYNRNFREDDKLVKIFTEQAGKRMFFVKHATNSKLSPVIQPLTLANLLMK 60

Query: 60  SRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLN 119
                      ++ ++          +  Y           +P+ +P   L+  L   L 
Sbjct: 61  VNDDGLSYIQDYQDVQPFTRINSDLFIMAYATYVAALADASIPDSQPDAALFAFLTKTLE 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
             +       +    E+ +L   G  L+  +CV    T      S K  G +C       
Sbjct: 121 LMEEGLDHEILTNIFEVQILSRFGVSLNFHECVFCHRTGLPFDFSFKFSGVLCPDHYRED 180

Query: 180 AEKMLVLP--SFLWKEEQTIDADSL 202
             +  + P   FL  + Q ++  +L
Sbjct: 181 DRRCHLHPNIPFLLDQFQAVEYSTL 205


>gi|294626961|ref|ZP_06705552.1| DNA repair protein RecO [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 11122]
 gi|292598821|gb|EFF42967.1| DNA repair protein RecO [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 11122]
          Length = 240

 Score = 92.2 bits (227), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 36/167 (21%), Positives = 59/167 (35%), Gaps = 7/167 (4%)

Query: 1   MYWQDD-AIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM---QPILQAGNLVRV 56
           M  + +   +L VR++ E ++++EV+T Q+GR     R  Q  R    +  LQ   L++ 
Sbjct: 1   MLIEHERGFVLHVRAWRETSLLVEVLTEQHGRVGLLARGVQGPRKQALRAALQPLQLIQF 60

Query: 57  NWRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNI 116
           +   R           +     A  L+    L G      L R  P  +P  ELY     
Sbjct: 61  SAVQRGELAQLRQAEALD---TAPRLAGDTMLAGFYISELLLRLAPRNDPVPELYACYAQ 117

Query: 117 FLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWV 163
             +       +     + E  +LK +GF  DL               
Sbjct: 118 VRSHLASDLPLAWGLRRFERDVLKGLGFAFDLQHDSDGQPIDPAARY 164


>gi|312959175|ref|ZP_07773694.1| DNA repair protein [Pseudomonas fluorescens WH6]
 gi|311286945|gb|EFQ65507.1| DNA repair protein [Pseudomonas fluorescens WH6]
          Length = 228

 Score = 92.2 bits (227), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 41/228 (17%), Positives = 77/228 (33%), Gaps = 12/228 (5%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQN 65
            A +L  R+Y E + +++ +T   GR    +R+ +  +   + +    + V +R +    
Sbjct: 9   PAYVLHSRAYRETSALVDFLTP-QGRLRAVLRSARG-KAGTLARPFVALDVEFRGKGELK 66

Query: 66  LGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPS 125
                  +     +  L+      GL     L R LP  +P   ++D     L       
Sbjct: 67  N---VGRLESVGTSAWLNGDALFSGLYLNELLIRLLPAEDPHPAVFDHYAATLLALAEGR 123

Query: 126 VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKMLV 185
            +  +    E  LL ++G+G +L   +             +    + R   L     +  
Sbjct: 124 PLEPLLRAFEWRLLDDLGYGFELANDLHGEPIAADGMYRLQVDAGLERVHLLQ--PGLFQ 181

Query: 186 LPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHL-LRENF 232
               L   E    A    SA +     L + AL  ++    L  RE F
Sbjct: 182 GTELLAMSEADWSAPGALSAAKR----LMRQALAVHLGGRPLVSRELF 225


>gi|229588603|ref|YP_002870722.1| DNA repair protein RecO [Pseudomonas fluorescens SBW25]
 gi|229360469|emb|CAY47326.1| DNA repair protein [Pseudomonas fluorescens SBW25]
          Length = 229

 Score = 92.2 bits (227), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 41/227 (18%), Positives = 77/227 (33%), Gaps = 12/227 (5%)

Query: 7   AIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQNL 66
           A +L  R+Y E + +++ +T   GR    +R+ +  +   + +    + V +R +     
Sbjct: 11  AYVLHSRAYRETSALVDFLTP-QGRLRAVLRSARG-KAGTLARPFVALDVEFRGKGELKN 68

Query: 67  GEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPSV 126
                 +     +  L+      GL     L R LP  +P   ++D     L        
Sbjct: 69  ---VGRLESVGTSAWLNGEALFSGLYLNELLIRLLPAEDPHPAVFDHYAATLIALAEGRP 125

Query: 127 IGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKMLVL 186
           +  +    E  LL ++G+G +L   +             +    + R   L     +   
Sbjct: 126 LEPLLRAFEWRLLDDLGYGFELNNDLHGDPIAADGMYRLQVDAGLERVYLLQ--PGLFQG 183

Query: 187 PSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHL-LRENF 232
              L   E    A    SA +     L + AL  ++    L  RE F
Sbjct: 184 TELLAMSEADWTAPGALSAAKR----LMRQALAVHLGGRPLVSRELF 226


>gi|157150562|ref|YP_001449353.1| DNA repair protein RecO [Streptococcus gordonii str. Challis
           substr. CH1]
 gi|189039774|sp|A8AU93|RECO_STRGC RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|157075356|gb|ABV10039.1| DNA repair protein RecO [Streptococcus gordonii str. Challis
           substr. CH1]
          Length = 260

 Score = 92.2 bits (227), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 35/205 (17%), Positives = 77/205 (37%), Gaps = 3/205 (1%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWR 59
           M      A++L  R++ E + ++++ T Q G+ + FV++  + ++ P++Q   L  +  +
Sbjct: 2   MQSITSKALVLYNRNFREDDKLVKIFTEQAGKRMFFVKHATNSKLSPVIQPLTLANLLMK 61

Query: 60  SRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLN 119
                      ++ ++          +  Y           +P+ +P   L+  L   L 
Sbjct: 62  VNDDGLSYIQDYQDVQPFTRINSDLFIMAYATYVAALADASIPDSQPDAALFAFLTKTLE 121

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
             +       +    E+ +L   G  L+  +CV    T      S K  G +C       
Sbjct: 122 LMEEGLDHEILTNIFEVQILSRFGVSLNFHECVFCHRTGLPFDFSFKFSGVLCPDHYRED 181

Query: 180 AEKMLVLP--SFLWKEEQTIDADSL 202
             +  + P   FL  + Q ++  +L
Sbjct: 182 DRRCHLHPNIPFLLDQFQAVEYSTL 206


>gi|78485081|ref|YP_391006.1| DNA repair protein RecO [Thiomicrospira crunogena XCL-2]
 gi|78363367|gb|ABB41332.1| DNA replication and repair protein RecO [Thiomicrospira crunogena
           XCL-2]
          Length = 246

 Score = 92.2 bits (227), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 36/245 (14%), Positives = 73/245 (29%), Gaps = 20/245 (8%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR-----MQPILQAGNLVRVN 57
            +  A +L  R Y E ++++   T ++G+    ++  +S        Q  LQ    + ++
Sbjct: 5   IEQQAFVLHRRPYRETSLLVTFFTPEFGKQNAVIKGVRSSSKTAQAKQAWLQPFQGLNIS 64

Query: 58  WRSRLAQNLGEFRFEVLESHCAKL-LSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNI 116
           WR +  ++        LE +  +  L     + GL     L+R L        L+     
Sbjct: 65  WRDKANRSSDLVSLRQLEPNHVRFPLGGEGSICGLYLNELLYRLLYPSLEVSGLFGEYQQ 124

Query: 117 FLNCH---KIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCR 173
            L      +       +  Q E  LL  +G+             Q            +  
Sbjct: 125 ALYDLALAEDRYQQAWVLRQFEFALLSELGYAFQTEVDYYQQPIQADKKYLFHLELGLFP 184

Query: 174 SVGLPYA-----EKMLVLPSFLWKEEQTIDADSLKSAFQLTDYFLNKYALQHNIIHCHLL 228
                 +       ++     L   ++      L    +L      +Y L   +    + 
Sbjct: 185 EPFSQISLDQNQGIVISGQCLLLFAQKAYCESCLTEWKRLF-----RYVLTPYLGQKPIQ 239

Query: 229 -RENF 232
            R  F
Sbjct: 240 TRSLF 244


>gi|121996842|ref|YP_001001629.1| DNA repair protein RecO [Halorhodospira halophila SL1]
 gi|171769496|sp|A1WT15|RECO_HALHL RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|121588247|gb|ABM60827.1| DNA replication and repair protein RecO [Halorhodospira halophila
           SL1]
          Length = 234

 Score = 92.2 bits (227), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 28/173 (16%), Positives = 57/173 (32%), Gaps = 4/173 (2%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQN 65
            A +L  R++ E + ++E+ +++YGR        +       L+    ++V+WR R    
Sbjct: 8   PAWVLHRRAFRESSTLVELFSQEYGRIGAVANGVRRRGWSGQLEPFIPLQVSWRGRGDLK 67

Query: 66  LGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPS 125
                 +    +    L       G      L       +P    ++   + ++C     
Sbjct: 68  TLTTVDQAGRGYA---LRGGALACGFYMAEVLLALTRREDPHPRTWERYAVAVDCLA-TD 123

Query: 126 VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
                  + EL LL+  G+GL+L + V                    R+    
Sbjct: 124 DAEPALRRFELALLEESGYGLELEQDVHGEPVVAQARYRYSPERGADRAGTGE 176


>gi|294629249|ref|ZP_06707809.1| DNA repair protein RecO [Streptomyces sp. e14]
 gi|292832582|gb|EFF90931.1| DNA repair protein RecO [Streptomyces sp. e14]
          Length = 248

 Score = 92.2 bits (227), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 33/190 (17%), Positives = 76/190 (40%), Gaps = 14/190 (7%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQ--PILQAGNLVRVNWRS 60
           ++DD ++L  +  GE + I+ ++TR +GR     R  +  + +    L+  + V V + +
Sbjct: 4   FRDDGVVLRTQKLGEADRIITLLTRGHGRVRAVARGVRRTKSKFGARLEPFSHVDVQFFA 63

Query: 61  RLAQNLG-----EFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLEL--YDM 113
           R ++ +G       + E +  +   +++         +++       + E    +  Y +
Sbjct: 64  RGSELIGRGLPLCTQSETIAPYGGGIVTDYARYTAGTAMLETAERFTDHEGEPAVQQYLL 123

Query: 114 LNIFLNCHKIPSVIGKIFVQIELMLLKNI---GFGLDLTKCVVTGVTQDLLWVSPKSGGA 170
           L   L           +   ++  LL+++   G+      C   G+     + S  SGG+
Sbjct: 124 LVGALRTLARGEHAPHLV--LDAFLLRSLAVNGYAPSFGDCARCGMPGPNRFFSVASGGS 181

Query: 171 VCRSVGLPYA 180
           VC     P +
Sbjct: 182 VCVDCRAPGS 191


>gi|257893052|ref|ZP_05672705.1| recombination protein O [Enterococcus faecium 1,231,408]
 gi|260559559|ref|ZP_05831739.1| recombination protein O [Enterococcus faecium C68]
 gi|293559429|ref|ZP_06675968.1| DNA repair protein RecO [Enterococcus faecium E1162]
 gi|314939539|ref|ZP_07846767.1| DNA repair protein RecO [Enterococcus faecium TX0133a04]
 gi|314942706|ref|ZP_07849532.1| DNA repair protein RecO [Enterococcus faecium TX0133C]
 gi|314948956|ref|ZP_07852322.1| DNA repair protein RecO [Enterococcus faecium TX0082]
 gi|314953303|ref|ZP_07856231.1| DNA repair protein RecO [Enterococcus faecium TX0133A]
 gi|314993383|ref|ZP_07858748.1| DNA repair protein RecO [Enterococcus faecium TX0133B]
 gi|314995733|ref|ZP_07860822.1| DNA repair protein RecO [Enterococcus faecium TX0133a01]
 gi|257829431|gb|EEV56038.1| recombination protein O [Enterococcus faecium 1,231,408]
 gi|260074227|gb|EEW62549.1| recombination protein O [Enterococcus faecium C68]
 gi|291606643|gb|EFF36038.1| DNA repair protein RecO [Enterococcus faecium E1162]
 gi|313590005|gb|EFR68850.1| DNA repair protein RecO [Enterococcus faecium TX0133a01]
 gi|313592048|gb|EFR70893.1| DNA repair protein RecO [Enterococcus faecium TX0133B]
 gi|313594646|gb|EFR73491.1| DNA repair protein RecO [Enterococcus faecium TX0133A]
 gi|313598571|gb|EFR77416.1| DNA repair protein RecO [Enterococcus faecium TX0133C]
 gi|313641175|gb|EFS05755.1| DNA repair protein RecO [Enterococcus faecium TX0133a04]
 gi|313644615|gb|EFS09195.1| DNA repair protein RecO [Enterococcus faecium TX0082]
          Length = 270

 Score = 92.2 bits (227), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 33/186 (17%), Positives = 62/186 (33%), Gaps = 2/186 (1%)

Query: 4   QDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNWRSR 61
           +   +IL  R+Y EK+ ++++ T   G+ + +++        + P L            R
Sbjct: 6   ESKGLILSSRNYKEKDKLVKIFTESSGKMMFYIKGIHRQNQPLAPALLPFTEAVYIGNFR 65

Query: 62  LAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCH 121
                     + + +         L  YG   +  +   + + +    L+      L   
Sbjct: 66  SEGLSFLSSVKDVHAFRNIQEDIFLSGYGTYLLNLVDAAIEDHQYDPHLFQFTQQALQRM 125

Query: 122 KIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAE 181
                   I    E+ +L+  G     T CVV G T+     S KSGG +C         
Sbjct: 126 DQGDDAEIITNIFEVQILQRFGIAPIWTHCVVCGETKGKFDYSSKSGGVICEKHWPMDEH 185

Query: 182 KMLVLP 187
           +    P
Sbjct: 186 RYHADP 191


>gi|256961297|ref|ZP_05565468.1| recombination protein O [Enterococcus faecalis Merz96]
 gi|293383581|ref|ZP_06629491.1| DNA repair protein RecO [Enterococcus faecalis R712]
 gi|293387306|ref|ZP_06631862.1| DNA repair protein RecO [Enterococcus faecalis S613]
 gi|312906131|ref|ZP_07765143.1| DNA repair protein RecO [Enterococcus faecalis DAPTO 512]
 gi|312909477|ref|ZP_07768332.1| DNA repair protein RecO [Enterococcus faecalis DAPTO 516]
 gi|256951793|gb|EEU68425.1| recombination protein O [Enterococcus faecalis Merz96]
 gi|291079093|gb|EFE16457.1| DNA repair protein RecO [Enterococcus faecalis R712]
 gi|291083204|gb|EFE20167.1| DNA repair protein RecO [Enterococcus faecalis S613]
 gi|310627777|gb|EFQ11060.1| DNA repair protein RecO [Enterococcus faecalis DAPTO 512]
 gi|311290150|gb|EFQ68706.1| DNA repair protein RecO [Enterococcus faecalis DAPTO 516]
          Length = 264

 Score = 91.8 bits (226), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 31/189 (16%), Positives = 63/189 (33%), Gaps = 2/189 (1%)

Query: 4   QDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQ--PILQAGNLVRVNWRSR 61
           +   IIL  + + EK+ ++++ T  YG+ + FV+          P +            R
Sbjct: 5   ETKGIILFTKDFKEKDKLVKIFTESYGKLMFFVKGAHRKNNPLLPAILPFTEAVYIGNFR 64

Query: 62  LAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCH 121
                     + ++          +  YG   +  +   + ++     L+   ++ L+  
Sbjct: 65  EEGLSFLNSSKEVQPFRNIQQDIFINAYGTYILNLVDAAIEDQHYDPNLFQFTHMALSAL 124

Query: 122 KIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAE 181
                   I    E+ LL+  G   +   CV  G TQ     S K  G +C        +
Sbjct: 125 NEQKDPEIITNIFEIQLLERFGVRPEWHHCVACGETQGKFDYSSKYSGVLCEKHWYLDEQ 184

Query: 182 KMLVLPSFL 190
           +    P  +
Sbjct: 185 RYHADPRAI 193


>gi|315150152|gb|EFT94168.1| DNA repair protein RecO [Enterococcus faecalis TX0012]
          Length = 264

 Score = 91.8 bits (226), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 31/189 (16%), Positives = 63/189 (33%), Gaps = 2/189 (1%)

Query: 4   QDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSR 61
           +   IIL  + + EK+ ++++ T  YG+ + FV+          P +            R
Sbjct: 5   ETKGIILFTKDFKEKDKLVKIFTESYGKLMFFVKGAHRKNNPLMPAILPFTEAVYIGNFR 64

Query: 62  LAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCH 121
                     + ++          +  YG   +  +   + ++     L+   ++ L+  
Sbjct: 65  EEGLSFLNSSKEVQPFRNIQQDIFINAYGTYILNLVDAAIEDQHYDPNLFQFTHMALSAL 124

Query: 122 KIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAE 181
                   I    E+ LL+  G   +   CV  G TQ     S K  G +C        +
Sbjct: 125 NEQKDPEIITNIFEIQLLERFGVRPEWHHCVACGETQGKFDYSSKYSGVLCEKHWHLDEQ 184

Query: 182 KMLVLPSFL 190
           +    P  +
Sbjct: 185 RYHADPRAI 193


>gi|315032902|gb|EFT44834.1| DNA repair protein RecO [Enterococcus faecalis TX0017]
          Length = 264

 Score = 91.8 bits (226), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 31/189 (16%), Positives = 62/189 (32%), Gaps = 2/189 (1%)

Query: 4   QDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQ--PILQAGNLVRVNWRSR 61
           +   IIL  + + EK+ ++++ T  YG+ + FV+          P +            R
Sbjct: 5   ETKGIILFTKDFKEKDKLVKIFTESYGKLMFFVKGAHRKNNPLLPAILPFTEAVYIGNFR 64

Query: 62  LAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCH 121
                     + ++          +  YG   +  +   + ++     L+   ++ L+  
Sbjct: 65  EEGLSFLNSSKGVQPFRNIQQDIFINAYGTYILNLVDAAIEDQHYDPNLFQFTHMALSAL 124

Query: 122 KIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAE 181
                   I    E  LL+  G   +   CV  G TQ     S K  G +C        +
Sbjct: 125 NEQKDPEIITNIFESQLLERFGVRPEWHHCVACGETQGKFDYSSKYSGVLCEKHWHLDEQ 184

Query: 182 KMLVLPSFL 190
           +    P  +
Sbjct: 185 RYHADPRAI 193


>gi|294791413|ref|ZP_06756570.1| DNA repair protein RecO [Scardovia inopinata F0304]
 gi|294457884|gb|EFG26238.1| DNA repair protein RecO [Scardovia inopinata F0304]
          Length = 244

 Score = 91.8 bits (226), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 31/210 (14%), Positives = 67/210 (31%), Gaps = 8/210 (3%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQ--PILQAGNLVRVNWRS 60
           ++D  ++L     GE + I+ ++T  +G+        +  + +    L+      +    
Sbjct: 4   YRDQGVVLRTIKLGEADRIITILTAHHGKIRAVAHGVRRAKSRFGSRLEPFMWDDLLIAQ 63

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLEL--YDMLNIFL 118
                    +  V+  + + ++ +         IV     +        +       + +
Sbjct: 64  GRHDLDTISQAVVISPYASLIVGTYEAYLSASVIVETVDKMITDLRQTGISQRQQYTLVI 123

Query: 119 NCHKIPSVIGKIFVQIELML----LKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRS 174
                 +        IE       L   G+   L  CVV G    + + S ++GGA+C +
Sbjct: 124 GALAALAEGKHSPQMIENSYVLRALSLAGWTPRLDSCVVCGRRDQVEYFSTEAGGAMCLT 183

Query: 175 VGLPYAEKMLVLPSFLWKEEQTIDADSLKS 204
             LP + K               D +SL  
Sbjct: 184 HRLPRSHKASGQTFSQLGLLLAGDWESLDQ 213


>gi|310643036|ref|YP_003947794.1| DNA repair protein reco [Paenibacillus polymyxa SC2]
 gi|309247986|gb|ADO57553.1| DNA repair protein RecO [Paenibacillus polymyxa SC2]
          Length = 246

 Score = 91.8 bits (226), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 32/186 (17%), Positives = 59/186 (31%), Gaps = 4/186 (2%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQ--PILQAGNLVRVNWRSRLA 63
           + I++    YGE N I+ + T   G+    VR  +  + +   + Q        +  R  
Sbjct: 2   EGIVIRSMDYGEGNKIITLCTESGGKVGVLVRGAKKSKSRHAALTQPFTYGEFVFF-RNT 60

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKI 123
                   E+++SH       +   Y   +   L R L + E     +  L   L   + 
Sbjct: 61  GLGTLNAGEIIQSHHTLREDITKAAYASYACELLDRVLQDEETGAFWFKQLKACLEALES 120

Query: 124 PSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVT-QDLLWVSPKSGGAVCRSVGLPYAEK 182
                 +    E  +L+  G+   L  C+ +G    D         G V       +   
Sbjct: 121 GKDPLIVMSIYEFKILQAAGYAPQLDACISSGQQCADEDMFISPRLGGVLCRGYKHFDPA 180

Query: 183 MLVLPS 188
            L +  
Sbjct: 181 ALSVAP 186


>gi|257082013|ref|ZP_05576374.1| recombination protein O [Enterococcus faecalis E1Sol]
 gi|257084564|ref|ZP_05578925.1| recombination protein O [Enterococcus faecalis Fly1]
 gi|257087440|ref|ZP_05581801.1| recombination protein O [Enterococcus faecalis D6]
 gi|256990043|gb|EEU77345.1| recombination protein O [Enterococcus faecalis E1Sol]
 gi|256992594|gb|EEU79896.1| recombination protein O [Enterococcus faecalis Fly1]
 gi|256995470|gb|EEU82772.1| recombination protein O [Enterococcus faecalis D6]
 gi|315025404|gb|EFT37336.1| DNA repair protein RecO [Enterococcus faecalis TX2137]
 gi|315161674|gb|EFU05691.1| DNA repair protein RecO [Enterococcus faecalis TX0645]
 gi|315173672|gb|EFU17689.1| DNA repair protein RecO [Enterococcus faecalis TX1346]
          Length = 264

 Score = 91.8 bits (226), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 31/189 (16%), Positives = 63/189 (33%), Gaps = 2/189 (1%)

Query: 4   QDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQ--PILQAGNLVRVNWRSR 61
           +   IIL  + + EK+ ++++ T  YG+ + FV+          P +            R
Sbjct: 5   ETKGIILFTKDFKEKDKLVKIFTESYGKLMFFVKGAHRKNNPLLPAILPFTEAVYIGNFR 64

Query: 62  LAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCH 121
                     + ++          +  YG   +  +   + ++     L+   ++ L+  
Sbjct: 65  EEGLSFLNSSKEVQPFRNIQQDIFINAYGTYILNLVDAAIEDQHYDPNLFQFTHMALSAL 124

Query: 122 KIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAE 181
                   I    E+ LL+  G   +   CV  G TQ     S K  G +C        +
Sbjct: 125 NEQKDPEIITNIFEIQLLERFGVRPEWHHCVACGETQGKFDYSSKYSGVLCEKHWHLDEQ 184

Query: 182 KMLVLPSFL 190
           +    P  +
Sbjct: 185 RYHADPRAI 193


>gi|189499187|ref|YP_001958657.1| DNA repair protein RecO [Chlorobium phaeobacteroides BS1]
 gi|238692226|sp|B3EKJ8|RECO_CHLPB RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|189494628|gb|ACE03176.1| DNA repair protein RecO [Chlorobium phaeobacteroides BS1]
          Length = 261

 Score = 91.8 bits (226), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 45/259 (17%), Positives = 86/259 (33%), Gaps = 22/259 (8%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQ--PILQAGNLVRVNW 58
           M  +  A++L    + E++ I  + TR +GR    ++ G++ + +   +   G+L+ V  
Sbjct: 1   MLTKTRAVVLKEVKFREQSKICSLYTRDFGRISVILKGGRNLKSRLSGLFCTGSLLEVVL 60

Query: 59  RSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQ-SIVPLFRFLPEREPCLELYDMLNIF 117
            +R  ++L       +         S      +   I  L       E  + L++ L   
Sbjct: 61  YNRSNRDLQLVSEARIIRSPMTAEPSMERFSAIYRLIEILKISTGNEEKNIRLFNALERT 120

Query: 118 LNCHKIPSVIGKIFV-QIELMLLKNIGFGLDLTKCV----------VTGVTQDLLWVSPK 166
           L     P       V    L L+   GF   + +CV            G   DL      
Sbjct: 121 LEKLCAPCRNADAAVAWFMLKLISESGFEPSIEQCVTTGKSILPMLQEGSADDLCLTYDP 180

Query: 167 SGGAVCRSVG--LPYAEKMLVLPSFLWKEEQTIDADSL------KSAFQLTDYFLNKYAL 218
            G ++        P  +++ V    L +    +D  S+          +L    L  Y  
Sbjct: 181 GGVSLPVPAAQKGPPGQRLPVQVYLLMRTLNRLDIRSIDEIDIPADNSRLLCDILQNYCS 240

Query: 219 QHNIIHCHLLRENFLGKLL 237
            HN  +        + ++L
Sbjct: 241 LHNNYNPSSKNRRIISRIL 259


>gi|307287712|ref|ZP_07567755.1| DNA repair protein RecO [Enterococcus faecalis TX0109]
 gi|306501450|gb|EFM70753.1| DNA repair protein RecO [Enterococcus faecalis TX0109]
 gi|315164811|gb|EFU08828.1| DNA repair protein RecO [Enterococcus faecalis TX1302]
          Length = 262

 Score = 91.8 bits (226), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 31/189 (16%), Positives = 63/189 (33%), Gaps = 2/189 (1%)

Query: 4   QDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSR 61
           +   IIL  + + EK+ ++++ T  YG+ + FV+          P +            R
Sbjct: 5   ETKGIILFTKDFKEKDKLVKIFTESYGKLMFFVKGAHRKNNPLMPAILPFTEAVYIGNFR 64

Query: 62  LAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCH 121
                     + ++          +  YG   +  +   + ++     L+   ++ L+  
Sbjct: 65  EEGLSFLNSSKEVQPFRNIQQDIFINAYGTYILNLVDAAIEDQHYDPNLFQFTHMALSAL 124

Query: 122 KIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAE 181
                   I    E+ LL+  G   +   CV  G TQ     S K  G +C        +
Sbjct: 125 NEQKDPEIITNIFEIQLLERFGVRPEWHHCVACGETQGKFDYSSKYSGVLCEKHWHLDEQ 184

Query: 182 KMLVLPSFL 190
           +    P  +
Sbjct: 185 RYHADPRAI 193


>gi|145296238|ref|YP_001139059.1| DNA repair protein RecO [Corynebacterium glutamicum R]
 gi|140846158|dbj|BAF55157.1| hypothetical protein [Corynebacterium glutamicum R]
          Length = 242

 Score = 91.4 bits (225), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 29/182 (15%), Positives = 64/182 (35%), Gaps = 3/182 (1%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQ--PILQAGNLVRVNWRS 60
           ++D A+++    +GE + I+ ++TR +G   G  +  +  + +    LQ    + V    
Sbjct: 6   FRDRALVVKTHDFGEADRIIVLLTRDHGIVRGVAKGVRRSKSRFGSRLQLFVELDVQLYP 65

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
               +      + +  + + ++          +I+ +   L   E    L++     L  
Sbjct: 66  GRKLST-ISGADTVGYYASGIIEDFTRYSCASAILEIATHLAGLENDPHLFEETTRALKN 124

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
            +          +  L  + + G+   L  C   G         P  GGAVC     P +
Sbjct: 125 IQDSPEPILNLDEFMLRAMNHAGWAPSLFDCAACGRPGPHNAFHPGIGGAVCLYCRPPGS 184

Query: 181 EK 182
            +
Sbjct: 185 AE 186


>gi|21230732|ref|NP_636649.1| DNA repair protein RecO [Xanthomonas campestris pv. campestris str.
           ATCC 33913]
 gi|66769272|ref|YP_244034.1| DNA repair protein RecO [Xanthomonas campestris pv. campestris str.
           8004]
 gi|188992423|ref|YP_001904433.1| DNA repair protein RecO [Xanthomonas campestris pv. campestris str.
           B100]
 gi|42559486|sp|Q8PB50|RECO_XANCP RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|81304769|sp|Q4USF9|RECO_XANC8 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|229485575|sp|B0RX25|RECO_XANCB RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|21112326|gb|AAM40573.1| DNA repair protein [Xanthomonas campestris pv. campestris str. ATCC
           33913]
 gi|66574604|gb|AAY50014.1| DNA repair protein [Xanthomonas campestris pv. campestris str.
           8004]
 gi|167734183|emb|CAP52391.1| Putative DNA repair protein [Xanthomonas campestris pv. campestris]
          Length = 241

 Score = 91.4 bits (225), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 35/167 (20%), Positives = 55/167 (32%), Gaps = 7/167 (4%)

Query: 1   MYWQDD-AIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM---QPILQAGNLVRV 56
           M  + +   +L  R++ E ++++EV+T Q+GR     R     R    +  LQ   L++ 
Sbjct: 1   MLIEHERGFVLHARAWRETSLLVEVLTEQHGRVGLLARGVHGPRKQALRAALQPLQLIQF 60

Query: 57  NWRSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNI 116
               R           +     A  L     L G      L R  P   P  EL+D    
Sbjct: 61  TAVQRGELAQLRQAEAID---TAPRLLGEAMLAGFYISELLLRLAPRHAPVPELFDCYAQ 117

Query: 117 FLNCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWV 163
                   + +     Q E  +L  +GFG DL               
Sbjct: 118 ARAHLASGAALAWGLRQFERDVLDGLGFGFDLQHDSDGQPIDPAARY 164


>gi|256617034|ref|ZP_05473880.1| recombination protein O [Enterococcus faecalis ATCC 4200]
 gi|256853770|ref|ZP_05559135.1| DNA repair protein recO [Enterococcus faecalis T8]
 gi|307277157|ref|ZP_07558261.1| DNA repair protein RecO [Enterococcus faecalis TX2134]
 gi|307290539|ref|ZP_07570451.1| DNA repair protein RecO [Enterococcus faecalis TX0411]
 gi|256596561|gb|EEU15737.1| recombination protein O [Enterococcus faecalis ATCC 4200]
 gi|256710713|gb|EEU25756.1| DNA repair protein recO [Enterococcus faecalis T8]
 gi|295113463|emb|CBL32100.1| DNA repair protein RecO [Enterococcus sp. 7L76]
 gi|306498394|gb|EFM67899.1| DNA repair protein RecO [Enterococcus faecalis TX0411]
 gi|306506087|gb|EFM75253.1| DNA repair protein RecO [Enterococcus faecalis TX2134]
 gi|315030212|gb|EFT42144.1| DNA repair protein RecO [Enterococcus faecalis TX4000]
          Length = 261

 Score = 91.4 bits (225), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 31/189 (16%), Positives = 63/189 (33%), Gaps = 2/189 (1%)

Query: 4   QDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQ--PILQAGNLVRVNWRSR 61
           +   IIL  + + EK+ ++++ T  YG+ + FV+          P +            R
Sbjct: 5   ETKGIILFTKDFKEKDKLVKIFTESYGKLMFFVKGAHRKNNPLLPAILPFTEAVYIGNFR 64

Query: 62  LAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCH 121
                     + ++          +  YG   +  +   + ++     L+   ++ L+  
Sbjct: 65  EEGLSFLNSSKEVQPFRNIQQDIFINAYGTYILNLVDAAIEDQHYDPNLFQFTHMALSAL 124

Query: 122 KIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAE 181
                   I    E+ LL+  G   +   CV  G TQ     S K  G +C        +
Sbjct: 125 NEQKDPEIITNIFEIQLLERFGVRPEWHHCVACGETQGKFDYSSKYSGVLCEKHWHLDEQ 184

Query: 182 KMLVLPSFL 190
           +    P  +
Sbjct: 185 RYHADPRAI 193


>gi|229545170|ref|ZP_04433895.1| recombination protein O [Enterococcus faecalis TX1322]
 gi|229549419|ref|ZP_04438144.1| recombination protein O [Enterococcus faecalis ATCC 29200]
 gi|255972123|ref|ZP_05422709.1| recombination protein O [Enterococcus faecalis T1]
 gi|256963576|ref|ZP_05567747.1| recombination protein O [Enterococcus faecalis HIP11704]
 gi|257079641|ref|ZP_05574002.1| recombination protein O [Enterococcus faecalis JH1]
 gi|257090599|ref|ZP_05584960.1| recombination protein recO [Enterococcus faecalis CH188]
 gi|257416647|ref|ZP_05593641.1| recombination protein O [Enterococcus faecalis AR01/DG]
 gi|257421949|ref|ZP_05598939.1| DNA repair protein recO [Enterococcus faecalis X98]
 gi|294780921|ref|ZP_06746275.1| DNA repair protein RecO [Enterococcus faecalis PC1.1]
 gi|307270834|ref|ZP_07552122.1| DNA repair protein RecO [Enterococcus faecalis TX4248]
 gi|307271515|ref|ZP_07552787.1| DNA repair protein RecO [Enterococcus faecalis TX0855]
 gi|312899838|ref|ZP_07759157.1| DNA repair protein RecO [Enterococcus faecalis TX0470]
 gi|312905131|ref|ZP_07764252.1| DNA repair protein RecO [Enterococcus faecalis TX0635]
 gi|312953488|ref|ZP_07772328.1| DNA repair protein RecO [Enterococcus faecalis TX0102]
 gi|229305656|gb|EEN71652.1| recombination protein O [Enterococcus faecalis ATCC 29200]
 gi|229309715|gb|EEN75702.1| recombination protein O [Enterococcus faecalis TX1322]
 gi|255963141|gb|EET95617.1| recombination protein O [Enterococcus faecalis T1]
 gi|256954072|gb|EEU70704.1| recombination protein O [Enterococcus faecalis HIP11704]
 gi|256987671|gb|EEU74973.1| recombination protein O [Enterococcus faecalis JH1]
 gi|256999411|gb|EEU85931.1| recombination protein recO [Enterococcus faecalis CH188]
 gi|257158475|gb|EEU88435.1| recombination protein O [Enterococcus faecalis ARO1/DG]
 gi|257163773|gb|EEU93733.1| DNA repair protein recO [Enterococcus faecalis X98]
 gi|294452047|gb|EFG20495.1| DNA repair protein RecO [Enterococcus faecalis PC1.1]
 gi|306511787|gb|EFM80785.1| DNA repair protein RecO [Enterococcus faecalis TX0855]
 gi|306512835|gb|EFM81479.1| DNA repair protein RecO [Enterococcus faecalis TX4248]
 gi|310628697|gb|EFQ11980.1| DNA repair protein RecO [Enterococcus faecalis TX0102]
 gi|310631521|gb|EFQ14804.1| DNA repair protein RecO [Enterococcus faecalis TX0635]
 gi|311293088|gb|EFQ71644.1| DNA repair protein RecO [Enterococcus faecalis TX0470]
 gi|315152155|gb|EFT96171.1| DNA repair protein RecO [Enterococcus faecalis TX0031]
 gi|315155342|gb|EFT99358.1| DNA repair protein RecO [Enterococcus faecalis TX0043]
 gi|315159082|gb|EFU03099.1| DNA repair protein RecO [Enterococcus faecalis TX0312]
 gi|315579041|gb|EFU91232.1| DNA repair protein RecO [Enterococcus faecalis TX0630]
 gi|323481398|gb|ADX80837.1| DNA repair protein RecO [Enterococcus faecalis 62]
 gi|329572236|gb|EGG53896.1| DNA repair protein RecO [Enterococcus faecalis TX1467]
          Length = 262

 Score = 91.4 bits (225), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 31/189 (16%), Positives = 63/189 (33%), Gaps = 2/189 (1%)

Query: 4   QDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQ--PILQAGNLVRVNWRSR 61
           +   IIL  + + EK+ ++++ T  YG+ + FV+          P +            R
Sbjct: 5   ETKGIILFTKDFKEKDKLVKIFTESYGKLMFFVKGAHRKNNPLLPAILPFTEAVYIGNFR 64

Query: 62  LAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCH 121
                     + ++          +  YG   +  +   + ++     L+   ++ L+  
Sbjct: 65  EEGLSFLNSSKEVQPFRNIQQDIFINAYGTYILNLVDAAIEDQHYDPNLFQFTHMALSAL 124

Query: 122 KIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAE 181
                   I    E+ LL+  G   +   CV  G TQ     S K  G +C        +
Sbjct: 125 NEQKDPEIITNIFEIQLLERFGVRPEWHHCVACGETQGKFDYSSKYSGVLCEKHWHLDEQ 184

Query: 182 KMLVLPSFL 190
           +    P  +
Sbjct: 185 RYHADPRAI 193


>gi|29376904|ref|NP_816058.1| DNA repair protein RecO, putative [Enterococcus faecalis V583]
 gi|227553940|ref|ZP_03983987.1| recombination protein O [Enterococcus faecalis HH22]
 gi|255975190|ref|ZP_05425776.1| recombination protein O [Enterococcus faecalis T2]
 gi|256763102|ref|ZP_05503682.1| recombination protein O [Enterococcus faecalis T3]
 gi|256956686|ref|ZP_05560857.1| recombination protein O [Enterococcus faecalis DS5]
 gi|300861009|ref|ZP_07107096.1| DNA repair protein RecO [Enterococcus faecalis TUSoD Ef11]
 gi|307285809|ref|ZP_07565943.1| DNA repair protein RecO [Enterococcus faecalis TX0860]
 gi|42559464|sp|Q831U0|RECO_ENTFA RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|29344369|gb|AAO82128.1| DNA repair protein RecO, putative [Enterococcus faecalis V583]
 gi|227176926|gb|EEI57898.1| recombination protein O [Enterococcus faecalis HH22]
 gi|255968062|gb|EET98684.1| recombination protein O [Enterococcus faecalis T2]
 gi|256684353|gb|EEU24048.1| recombination protein O [Enterococcus faecalis T3]
 gi|256947182|gb|EEU63814.1| recombination protein O [Enterococcus faecalis DS5]
 gi|300850048|gb|EFK77798.1| DNA repair protein RecO [Enterococcus faecalis TUSoD Ef11]
 gi|306502570|gb|EFM71837.1| DNA repair protein RecO [Enterococcus faecalis TX0860]
 gi|315035614|gb|EFT47546.1| DNA repair protein RecO [Enterococcus faecalis TX0027]
 gi|315146684|gb|EFT90700.1| DNA repair protein RecO [Enterococcus faecalis TX4244]
 gi|315166397|gb|EFU10414.1| DNA repair protein RecO [Enterococcus faecalis TX1341]
 gi|315170293|gb|EFU14310.1| DNA repair protein RecO [Enterococcus faecalis TX1342]
 gi|315574359|gb|EFU86550.1| DNA repair protein RecO [Enterococcus faecalis TX0309B]
 gi|315580166|gb|EFU92357.1| DNA repair protein RecO [Enterococcus faecalis TX0309A]
 gi|327535694|gb|AEA94528.1| recombination protein O [Enterococcus faecalis OG1RF]
          Length = 262

 Score = 91.4 bits (225), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 31/189 (16%), Positives = 63/189 (33%), Gaps = 2/189 (1%)

Query: 4   QDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQ--PILQAGNLVRVNWRSR 61
           +   IIL  + + EK+ ++++ T  YG+ + FV+          P +            R
Sbjct: 5   ETKGIILFTKDFKEKDKLVKIFTESYGKLMFFVKGAHRKNNPLLPAILPFTEAVYIGNFR 64

Query: 62  LAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCH 121
                     + ++          +  YG   +  +   + ++     L+   ++ L+  
Sbjct: 65  EEGLSFLNSSKEVQPFRNIQQDIFINAYGTYILNLVDAAIEDQHYDPNLFQFTHMALSAL 124

Query: 122 KIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAE 181
                   I    E+ LL+  G   +   CV  G TQ     S K  G +C        +
Sbjct: 125 NEQKDPEIITNIFEIQLLERFGVRPEWHHCVACGETQGKFDYSSKYSGVLCEKHWHLDEQ 184

Query: 182 KMLVLPSFL 190
           +    P  +
Sbjct: 185 RYHADPRAI 193


>gi|312863966|ref|ZP_07724203.1| DNA repair protein RecO [Streptococcus vestibularis F0396]
 gi|311100532|gb|EFQ58738.1| DNA repair protein RecO [Streptococcus vestibularis F0396]
          Length = 257

 Score = 91.4 bits (225), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 35/203 (17%), Positives = 70/203 (34%), Gaps = 2/203 (0%)

Query: 4   QDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLA 63
           +   ++L  R+Y E + ++++ T Q G+ + FVR G S ++  ++Q  N+          
Sbjct: 5   ESRGLVLFNRNYRENDKLVKIFTEQAGKRMFFVRGGGSGKLSAVIQPLNIAEFMMTVNDE 64

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKI 123
                  +   ES            Y           + +     +L+  L   L   + 
Sbjct: 65  GLSFIEDYSQAESFKEITSDIFKLSYATYLAALTDAAIADGVVDAQLFAFLERTLELMEE 124

Query: 124 PSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKM 183
                 +    E+ +L   G  L+  +CV           S K  G +C +       + 
Sbjct: 125 GLDYEILTNIFEIQVLDRFGVRLNFHECVFCHRVGLPFDFSYKFSGLLCPNHYEEDERRS 184

Query: 184 LVLP--SFLWKEEQTIDADSLKS 204
            + P   +L    Q +  + L+S
Sbjct: 185 HLDPNVPYLLDRFQGLSFEELRS 207


>gi|255019673|ref|ZP_05291752.1| DNA repair protein RecO [Acidithiobacillus caldus ATCC 51756]
 gi|254970896|gb|EET28379.1| DNA repair protein RecO [Acidithiobacillus caldus ATCC 51756]
          Length = 248

 Score = 91.4 bits (225), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 35/153 (22%), Positives = 56/153 (36%), Gaps = 4/153 (2%)

Query: 4   QDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQ-PILQAGNLVRVNWRSRL 62
           +D A +L    + + +++LEV+T  +GR     R  +  R     L+AG    + WR R 
Sbjct: 6   EDHAFVLHRYPFSDSSLVLEVITAGHGRLGLLARGARRPRSALGGLEAGRPFVLRWRGRG 65

Query: 63  AQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHK 122
                       E   A+L      L        + R     +P  EL+      L    
Sbjct: 66  ELPT---LVSADEVAPARLPGPWQGLCLFYVNELVLRLTVRNDPVPELFAAYAEVLEDLW 122

Query: 123 IPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTG 155
             +       + E  LL+ +G+  DL  C V G
Sbjct: 123 AGARATWHLRRFEQRLLRALGWAADLPYCTVCG 155


>gi|290960571|ref|YP_003491753.1| recombination protein O [Streptomyces scabiei 87.22]
 gi|260650097|emb|CBG73213.1| Recombination protein O [Streptomyces scabiei 87.22]
          Length = 250

 Score = 91.4 bits (225), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 34/190 (17%), Positives = 77/190 (40%), Gaps = 14/190 (7%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQ--PILQAGNLVRVNWRS 60
           ++DD ++L  +  GE + I+ ++TR +GR     R  +  + +    L+  + V V + +
Sbjct: 5   FRDDGVVLRTQKLGEADRIITLLTRGHGRVRAVARGVRRTKSKFGARLEPFSHVDVQFFA 64

Query: 61  RLAQNLG-----EFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLEL--YDM 113
           R ++ LG       + E +  +   ++S         +++       + E    +  Y +
Sbjct: 65  RGSELLGRGLPLCTQSETIAPYGGGIVSDYARYTAGTAMLETAERFTDHEGEPAVQQYLL 124

Query: 114 LNIFLNCHKIPSVIGKIFVQIELMLLKNI---GFGLDLTKCVVTGVTQDLLWVSPKSGGA 170
           L   L           +   ++  LL+++   G+      C   G+     + S  +GG+
Sbjct: 125 LVGALRTLARGEHAPHLV--LDAFLLRSLAVNGYAPSFGDCAKCGMPGPNRFFSVAAGGS 182

Query: 171 VCRSVGLPYA 180
           VC    +P +
Sbjct: 183 VCVDCRVPGS 192


>gi|94968222|ref|YP_590270.1| DNA repair protein RecO [Candidatus Koribacter versatilis Ellin345]
 gi|119361444|sp|Q1ISF4|RECO_ACIBL RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|94550272|gb|ABF40196.1| DNA replication and repair protein RecO [Candidatus Koribacter
           versatilis Ellin345]
          Length = 244

 Score = 91.4 bits (225), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 32/167 (19%), Positives = 59/167 (35%), Gaps = 2/167 (1%)

Query: 1   MYWQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQ--PILQAGNLVRVNW 58
           M  Q +AI+L      E ++++ + TR  G+  G  +  +  R +    L+    VRV +
Sbjct: 1   MLKQSEAIVLRTYPMREADLLVTLFTRAEGKIKGVAKAAKKSRRRFGGALEPLTHVRVYY 60

Query: 59  RSRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFL 118
             R  Q L       + +              L  +  +   L       +    L++ +
Sbjct: 61  EDRERQELTRLDSCDVLASPMSAEVDYPRALALGHVAEVIDDLLPDREPNDAVFRLSLAV 120

Query: 119 NCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSP 165
               +P  +       +L +++  GF  DL  CVV G   D      
Sbjct: 121 LGQLVPGAVWMPLTYFDLWMVRLAGFLPDLMHCVVCGEELDDRAFFH 167


>gi|217970711|ref|YP_002355945.1| DNA repair protein RecO [Thauera sp. MZ1T]
 gi|217508038|gb|ACK55049.1| DNA repair protein RecO [Thauera sp. MZ1T]
          Length = 252

 Score = 91.0 bits (224), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 27/149 (18%), Positives = 52/149 (34%), Gaps = 5/149 (3%)

Query: 4   QDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQS--HRMQPILQAGNLVRVNWRSR 61
           Q  A +L    + E ++I+E+  R++GR     +  +    +++ +L A   + ++W   
Sbjct: 10  QQPAWVLHTYPWRETSLIVEIFAREHGRVALVAKGARRPHSQLRGVLLAFQPLWMDWSGG 69

Query: 62  LAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCH 121
                              LL     + G      L R     +P   L+D     +   
Sbjct: 70  GEVKT---LVRAEWQGGQPLLIGRALICGYYLNELLVRLTAREDPHPRLFDAYAEAVRAL 126

Query: 122 KIPSVIGKIFVQIELMLLKNIGFGLDLTK 150
                   I  + EL LL+ +G+   L  
Sbjct: 127 GRGEAESPILRRFELALLQELGYEAGLAN 155


>gi|257419863|ref|ZP_05596857.1| recombination protein recO [Enterococcus faecalis T11]
 gi|257161691|gb|EEU91651.1| recombination protein recO [Enterococcus faecalis T11]
          Length = 262

 Score = 91.0 bits (224), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 31/189 (16%), Positives = 63/189 (33%), Gaps = 2/189 (1%)

Query: 4   QDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQ--PILQAGNLVRVNWRSR 61
           +   IIL  + + EK+ ++++ T  YG+ + FV+          P +            R
Sbjct: 5   ETKGIILFTKDFKEKDKLVKIFTEAYGKLMFFVKGAHRKNNPLLPAILPFTEAVYIGNFR 64

Query: 62  LAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCH 121
                     + ++          +  YG   +  +   + ++     L+   ++ L+  
Sbjct: 65  EEGLSFLNSSKEVQPFRNIQQDIFINAYGTYILNLVDAAIEDQHYDPNLFQFTHMALSAL 124

Query: 122 KIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAE 181
                   I    E+ LL+  G   +   CV  G TQ     S K  G +C        +
Sbjct: 125 NEQKDPEIITNIFEIQLLERFGVRPEWHHCVACGETQGKFDYSSKYSGVLCEKHWHLDEQ 184

Query: 182 KMLVLPSFL 190
           +    P  +
Sbjct: 185 RYHADPRAI 193


>gi|269794674|ref|YP_003314129.1| DNA replication and repair protein RecO [Sanguibacter keddieii DSM
           10542]
 gi|269096859|gb|ACZ21295.1| DNA replication and repair protein RecO [Sanguibacter keddieii DSM
           10542]
          Length = 281

 Score = 91.0 bits (224), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 31/183 (16%), Positives = 57/183 (31%), Gaps = 4/183 (2%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQ--SHRMQPILQAGNLVRVNWRS 60
           ++D+A++L     GE + I+  +TR++G+     +  +  S R    L+    V V    
Sbjct: 8   YRDEALVLRTHKLGEADRIITFLTREHGKVRAVAKGVRRTSSRFGARLEPFMFVDVQLHV 67

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPC--LELYDMLNIFL 118
               ++      V     A     +L+  G   +    R +         + + +     
Sbjct: 68  GRNLDIVTQAEMVQPYARAIFSDYTLYTAGAVMLETADRLVEAEREPSVQQFWLLAGALR 127

Query: 119 NCHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLP 178
                    G +     L  L   G+      C   G        S   GG VC     P
Sbjct: 128 ALADHAHAPGLVLDSYLLRALAVAGWAPTFADCARCGEPGPHRAFSVAQGGTVCPRCRPP 187

Query: 179 YAE 181
            + 
Sbjct: 188 GST 190


>gi|320010909|gb|ADW05759.1| DNA repair protein RecO [Streptomyces flavogriseus ATCC 33331]
          Length = 248

 Score = 91.0 bits (224), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 35/211 (16%), Positives = 81/211 (38%), Gaps = 14/211 (6%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQ--PILQAGNLVRVNWRS 60
           ++DD ++L  +  GE + I+ ++TR +GR     R  +  + +    L+  + V V + +
Sbjct: 4   FRDDGVVLRTQKLGEADRIITILTRGHGRVRAVARGVRRTKSKFGARLEPFSHVDVQFFA 63

Query: 61  RLAQNLG-----EFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLEL--YDM 113
           R ++ +G       + E +  +   ++S         +++       + E    +  Y +
Sbjct: 64  RGSELIGRGLPLCTQSETIAPYGGGIVSDYARYTAGTAMLETAERFTDHEGEPAVQQYLL 123

Query: 114 LNIFLNCHKIPSVIGKIFVQIELMLLKNI---GFGLDLTKCVVTGVTQDLLWVSPKSGGA 170
           L   L           +   ++  LL+++   G+      C   G+     + S  +GG 
Sbjct: 124 LVGGLRTLARAEHAPNL--ILDAFLLRSLAVNGYAPSFVDCAKCGMPGPNRFFSVAAGGV 181

Query: 171 VCRSVGLPYAEKMLVLPSFLWKEEQTIDADS 201
           +C    +P +         L     T D ++
Sbjct: 182 ICGDCRVPGSVVPSAEAVELLSALLTGDWET 212


>gi|238020903|ref|ZP_04601329.1| hypothetical protein GCWU000324_00798 [Kingella oralis ATCC 51147]
 gi|237867883|gb|EEP68889.1| hypothetical protein GCWU000324_00798 [Kingella oralis ATCC 51147]
          Length = 300

 Score = 91.0 bits (224), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 23/166 (13%), Positives = 48/166 (28%), Gaps = 5/166 (3%)

Query: 8   IILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRM--QPILQAGNLVRVNWRSRLAQN 65
            +L    + E ++ +E  +R +GR     R+ ++     + +L     +  +W  +    
Sbjct: 64  FLLTALPWRENSLRVEAFSRDFGRVSLLARSARTRGSELRGVLLPFVPISASWFGKEELK 123

Query: 66  LGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPS 125
                                 +  L     + +     +   EL+  L+  L       
Sbjct: 124 TVHRAEWRGGWAQPV---GQRLMSALYVNELVLKLTAREDGQPELFTALHDVLRAICTAP 180

Query: 126 VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAV 171
                    E  LL  +GF  D  +           W + +   AV
Sbjct: 181 HFASALRCFEWRLLTLLGFAPDWARDADGRRVAAEGWYAVQPETAV 226


>gi|77457223|ref|YP_346728.1| DNA repair protein RecO [Pseudomonas fluorescens Pf0-1]
 gi|92087032|sp|Q3KHL7|RECO_PSEPF RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|77381226|gb|ABA72739.1| DNA repair protein [Pseudomonas fluorescens Pf0-1]
          Length = 229

 Score = 91.0 bits (224), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 27/152 (17%), Positives = 54/152 (35%), Gaps = 5/152 (3%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQN 65
            A +L  R+Y E + +++ +T   GR    +R+ +  +   + +    + V +R +    
Sbjct: 10  PAYVLHSRAYRETSALVDFLTP-QGRLRAVLRSARG-KAGTLARPFVPLEVEFRGKGELK 67

Query: 66  LGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPS 125
                  +     A  +       GL     L R LP  +P   ++D     L       
Sbjct: 68  N---VGRMESVGNATWMVGEALFSGLYLNELLIRLLPAEDPHPAVFDHYAATLLALAEGR 124

Query: 126 VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVT 157
            +  +    E  LL ++G+G  L   +     
Sbjct: 125 PLEPLLRSFEWRLLDDLGYGFSLNTDINDEPV 156


>gi|312277442|gb|ADQ62099.1| DNA repair protein recO [Streptococcus thermophilus ND03]
          Length = 257

 Score = 91.0 bits (224), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 36/203 (17%), Positives = 70/203 (34%), Gaps = 2/203 (0%)

Query: 4   QDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLA 63
           +    IL  R+Y E + ++++ T+Q G+ + FVR G S ++  ++Q  N+          
Sbjct: 5   ESRGFILFNRNYRENDKLVKIFTKQAGKRMFFVRGGGSGKLSAVIQPLNIAEFMMTVNDE 64

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKI 123
                  +   ES            Y           + +     +L+  L   L   + 
Sbjct: 65  GLSFIEDYSQAESFKEITSDIFKLSYATYLAALTDAAIADGVVDAQLFAFLEKTLVLMEE 124

Query: 124 PSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKM 183
                 +    E+ +L   G  L+  +CV           S K  G +C +       + 
Sbjct: 125 GLDYEILTNIFEIQVLDRFGVRLNFHECVFCHRVGLPFDFSYKFSGLLCPNHYEEDERRS 184

Query: 184 LVLP--SFLWKEEQTIDADSLKS 204
            + P   +L    Q +  + L+S
Sbjct: 185 HLDPNVPYLLDRFQGLSFEELRS 207


>gi|313500337|gb|ADR61703.1| RecO [Pseudomonas putida BIRD-1]
          Length = 227

 Score = 91.0 bits (224), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 41/232 (17%), Positives = 74/232 (31%), Gaps = 14/232 (6%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQN 65
            A +L  R+Y E + +++  T   GR    +R  +  +   +++    + V  R R    
Sbjct: 8   PAYVLHSRAYKETSALVDFFTP-QGRMRAVLRRARG-KGGSLVRPFVSLEVELRGRGELK 65

Query: 66  LGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPS 125
                  +  +  A  L       GL     L R LP   P   L++   + L       
Sbjct: 66  N---VSRMDSTGIAAWLHGDALFSGLYLNELLMRLLPAEAPFPALFEHYTLTLQALSAGR 122

Query: 126 VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKMLV 185
            +  +    E  LL  +G+   L   V             +    + R         +  
Sbjct: 123 PLEPLLRSFEWRLLDELGYAFSLHHDVNEQPIAADGLYRLRVDAGLERVELAQ--PGLFR 180

Query: 186 LPSFLWKEEQTID-ADSLKSAFQLTDYFLNKYALQHNIIHCHL-LRENFLGK 235
               L   +   D   +L +A +     L + AL  ++    L  RE F  +
Sbjct: 181 GTELLALAQTDWDAPGALLAAKR-----LMRQALAVHLGAKPLVSRELFRKR 227


>gi|257890446|ref|ZP_05670099.1| recombination protein O [Enterococcus faecium 1,231,410]
 gi|294618703|ref|ZP_06698236.1| DNA repair protein RecO [Enterococcus faecium E1679]
 gi|257826806|gb|EEV53432.1| recombination protein O [Enterococcus faecium 1,231,410]
 gi|291595046|gb|EFF26390.1| DNA repair protein RecO [Enterococcus faecium E1679]
          Length = 270

 Score = 91.0 bits (224), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 32/186 (17%), Positives = 61/186 (32%), Gaps = 2/186 (1%)

Query: 4   QDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHR--MQPILQAGNLVRVNWRSR 61
           +   +IL  R+Y EK+ ++++ T   G+ + +++        + P L            R
Sbjct: 6   ESKGLILSSRNYKEKDKLVKIFTESSGKMMFYIKGIHRQNQPLAPALLPFTEAVYIGNFR 65

Query: 62  LAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCH 121
                     + + +         L  YG   +  +   + + +    L+      L   
Sbjct: 66  SEGLSFLSSVKDVHAFRNIQEDIFLSGYGTYLLNLVDAAIEDHQYDPHLFQFTQQALQRM 125

Query: 122 KIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAE 181
                   I    E+ +L+  G     T CVV G T+     S K GG +C         
Sbjct: 126 DQGDDAEIITNIFEVQILQRFGIAPIWTHCVVCGETKGKFDYSSKYGGVICEKHWPMDEH 185

Query: 182 KMLVLP 187
           +    P
Sbjct: 186 RYHADP 191


>gi|227519873|ref|ZP_03949922.1| recombination protein O [Enterococcus faecalis TX0104]
 gi|227072667|gb|EEI10630.1| recombination protein O [Enterococcus faecalis TX0104]
 gi|315144806|gb|EFT88822.1| DNA repair protein RecO [Enterococcus faecalis TX2141]
          Length = 264

 Score = 91.0 bits (224), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 30/189 (15%), Positives = 63/189 (33%), Gaps = 2/189 (1%)

Query: 4   QDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQ--PILQAGNLVRVNWRSR 61
           +   IIL  + + EK+ ++++ T  YG+ + FV+          P +            R
Sbjct: 5   ETKGIILFTKDFKEKDKLVKIFTESYGKLMFFVKGAHRKNNPLLPAILPFTEAVYIGNFR 64

Query: 62  LAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCH 121
                     + ++          +  YG   +  +   + ++     L+   ++ L+  
Sbjct: 65  EEGLSFLNSSKEVQPFRNIQQDIFINAYGTYILNLVDAAIEDQHYDPNLFQFTHMALSAL 124

Query: 122 KIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAE 181
                   I    E+ LL+  G   +   CV  G TQ     S +  G +C        +
Sbjct: 125 NEQKDPEIITNIFEIQLLERFGVRPEWHHCVACGETQGKFDYSSRYSGVLCEKHWHLDEQ 184

Query: 182 KMLVLPSFL 190
           +    P  +
Sbjct: 185 RYHADPRAI 193


>gi|19553482|ref|NP_601484.1| DNA repair protein RecO [Corynebacterium glutamicum ATCC 13032]
 gi|62391125|ref|YP_226527.1| DNA repair protein RecO [Corynebacterium glutamicum ATCC 13032]
 gi|21325055|dbj|BAB99677.1| Recombinational DNA repair protein [Corynebacterium glutamicum ATCC
           13032]
 gi|41326464|emb|CAF20626.1| Recombinational DNA repair protein (RecF pathway) [Corynebacterium
           glutamicum ATCC 13032]
          Length = 242

 Score = 91.0 bits (224), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 28/182 (15%), Positives = 64/182 (35%), Gaps = 3/182 (1%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQ--PILQAGNLVRVNWRS 60
           ++D A+++    +GE + I+ ++TR +G   G  +  +  + +    LQ    + V    
Sbjct: 6   FRDRALVVKTYDFGEADRIIVLLTRDHGIVRGVAKGVRRSKSRFGSRLQLFVELDVQLYP 65

Query: 61  RLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNC 120
               +      + +  + + ++          +I+ +   +   E    L++     L  
Sbjct: 66  GRKLST-ISGADTVGYYASGIIEDFTRYSCASAILEIATHIAGLENDPHLFEETTRALKN 124

Query: 121 HKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYA 180
            +          +  L  + + G+   L  C   G         P  GGAVC     P +
Sbjct: 125 IQDSPEPILNLDEFMLRAMNHAGWAPSLFDCAACGRPGPHNAFHPGVGGAVCLYCRPPGS 184

Query: 181 EK 182
            +
Sbjct: 185 AE 186


>gi|322390548|ref|ZP_08064065.1| recombination protein O [Streptococcus parasanguinis ATCC 903]
 gi|321142744|gb|EFX38205.1| recombination protein O [Streptococcus parasanguinis ATCC 903]
          Length = 259

 Score = 91.0 bits (224), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 29/188 (15%), Positives = 65/188 (34%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRL 62
            +   I+L  R + E + ++++ T + G+ + FV++    R+ P+LQ      +  +   
Sbjct: 5   IETRGIVLYNRDFREDDKLVKIFTEKSGKRMFFVKHAGKSRLNPMLQPLVTADMLLKIND 64

Query: 63  AQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHK 122
                   F+ ++ +           Y    +      + + +    L+  L   L+  +
Sbjct: 65  DGLSYIDDFQDVQVYKKINADLFALSYATYVLALADASIQDNQVDPALFAFLEKTLSLME 124

Query: 123 IPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEK 182
                  +    E+ LL   G  L+L +C            S +  G +C         +
Sbjct: 125 EGLDYEVLTNIFEIQLLSRFGVVLNLHECCFCHRVGLPFDYSFRYSGVLCPDHYDRDERR 184

Query: 183 MLVLPSFL 190
               P+ L
Sbjct: 185 AHWHPNVL 192


>gi|322517630|ref|ZP_08070495.1| recombination protein O [Streptococcus vestibularis ATCC 49124]
 gi|322123707|gb|EFX95292.1| recombination protein O [Streptococcus vestibularis ATCC 49124]
          Length = 257

 Score = 91.0 bits (224), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 35/203 (17%), Positives = 70/203 (34%), Gaps = 2/203 (0%)

Query: 4   QDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLA 63
           +   ++L  R+Y E + ++++ T Q G+ + FVR G S ++  ++Q  N+          
Sbjct: 5   ESRGLVLFNRNYRENDKLVKIFTEQAGKRMFFVRGGGSGKLSAVIQPLNIAEFMMTVNDE 64

Query: 64  QNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKI 123
                  +   ES            Y           + +     +L+  L   L   + 
Sbjct: 65  GLSFIEDYSQAESFKEITSDIFKLSYATYLAALTDAAIADGVVDAQLFAFLKKTLELMEE 124

Query: 124 PSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKM 183
                 +    E+ +L   G  L+  +CV           S K  G +C +       + 
Sbjct: 125 GLDYEILTNIFEIQVLDRFGVRLNFHECVFCHRVGLPFDFSYKFSGLLCPNHYEEDERRS 184

Query: 184 LVLP--SFLWKEEQTIDADSLKS 204
            + P   +L    Q +  + L+S
Sbjct: 185 HLDPNVPYLLDRFQGLSFEELRS 207


>gi|330950054|gb|EGH50314.1| DNA repair protein RecO [Pseudomonas syringae Cit 7]
          Length = 227

 Score = 90.6 bits (223), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 25/150 (16%), Positives = 57/150 (38%), Gaps = 5/150 (3%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQN 65
            A +L  R+Y E + +++ +T   GR    +R+ +  +   + +    + V +R R    
Sbjct: 8   PAYVLHSRAYRENSALVDFLTP-QGRLRAVLRSAKG-KAGSLARPFVPLEVEFRGRGELK 65

Query: 66  LGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPS 125
                  +  +  A  ++      G+     L R LP  +P   +++     L    +  
Sbjct: 66  N---VGRMESAGVATWMTGEALFSGMYLNELLIRLLPAEDPHPAVFEHYAATLLALSLGR 122

Query: 126 VIGKIFVQIELMLLKNIGFGLDLTKCVVTG 155
            +  +    E  LL ++G+G  +   +   
Sbjct: 123 PLEPLLRSFEWRLLDDLGYGFAMDADINGE 152


>gi|325275442|ref|ZP_08141373.1| DNA repair protein RecO [Pseudomonas sp. TJI-51]
 gi|324099418|gb|EGB97333.1| DNA repair protein RecO [Pseudomonas sp. TJI-51]
          Length = 227

 Score = 90.6 bits (223), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 41/232 (17%), Positives = 78/232 (33%), Gaps = 14/232 (6%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQN 65
            A +L  R+Y E + +++  T   GR    +R  +  +   +++    + +  R R    
Sbjct: 8   PAYVLHSRAYKETSALVDFFTP-QGRMRAVLRRARG-KGGSLVRPFVPLELELRGRGELK 65

Query: 66  LGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPS 125
                  +  +  A  L       GL     L R LP   P + L++   + L       
Sbjct: 66  N---VGRMDSAGIAAWLHGDALFSGLYLNELLMRLLPAEAPFVALFEHYALTLQALAEGR 122

Query: 126 VIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEKMLV 185
            +  +    E  LL  +G+   L++ V             +    + R         +  
Sbjct: 123 PLEPLLRSFEWRLLDELGYAFSLSQDVNDYPIAADGLYRLRVDAGLERV--ELVQPGLFR 180

Query: 186 LPSFLWKEEQTIDAD-SLKSAFQLTDYFLNKYALQHNIIHCHL-LRENFLGK 235
               L   +    AD +L +A +     L + AL  ++    L  RE F  +
Sbjct: 181 GTELLALAQADWSADGALLAAKR-----LMRQALAVHLGGKPLVSRELFRKR 227


>gi|289676658|ref|ZP_06497548.1| DNA repair protein RecO [Pseudomonas syringae pv. syringae FF5]
 gi|302186919|ref|ZP_07263592.1| DNA repair protein RecO [Pseudomonas syringae pv. syringae 642]
          Length = 227

 Score = 90.6 bits (223), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 25/150 (16%), Positives = 57/150 (38%), Gaps = 5/150 (3%)

Query: 6   DAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLAQN 65
            A +L  R+Y E + +++ +T   GR    +R+ +  +   + +    + V +R R    
Sbjct: 8   PAYVLHSRAYRENSALVDFLTP-QGRLRAVLRSAKG-KAGSLARPFVPLEVEFRGRGELK 65

Query: 66  LGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHKIPS 125
                  +  +  A  ++      G+     L R LP  +P   +++     L    +  
Sbjct: 66  N---VGRMESAGVATWMTGEALFSGMYLNELLIRLLPAEDPHPAVFEHYAATLLALSLGR 122

Query: 126 VIGKIFVQIELMLLKNIGFGLDLTKCVVTG 155
            +  +    E  LL ++G+G  +   +   
Sbjct: 123 PLEPLLRSFEWRLLDDLGYGFAMDADINGE 152


>gi|322374257|ref|ZP_08048789.1| DNA repair protein RecO [Streptococcus sp. C150]
 gi|321276861|gb|EFX53934.1| DNA repair protein RecO [Streptococcus sp. C150]
          Length = 257

 Score = 90.6 bits (223), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 34/207 (16%), Positives = 69/207 (33%), Gaps = 3/207 (1%)

Query: 1   MY-WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWR 59
           M   +   ++L  R+Y E + ++++ T Q G+ + FVR G + ++  ++Q   +      
Sbjct: 1   MQKLESRGLVLFNRNYRENDKLVKIFTEQAGKRMFFVRGGGAGKLSAVIQPLTIAEFMMT 60

Query: 60  SRLAQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLN 119
                      +   ES            Y           + +     +L+  L   L 
Sbjct: 61  VNDEGLSFIEDYSQAESFKEITSDIFKLSYATYLAALTDAAIADGMVDEQLFAFLEKTLE 120

Query: 120 CHKIPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPY 179
             +       +    E+ +L   G  L+  +CV           S K  G +C +     
Sbjct: 121 LMEEGLDYEILTNIFEVQVLDRFGVKLNFHECVFCHRVGLPFDFSYKYSGLLCPNHYAED 180

Query: 180 AEKMLVLP--SFLWKEEQTIDADSLKS 204
             +  + P   +L    Q +    L+S
Sbjct: 181 ERRSHLDPNVPYLLDRFQGLSFKELRS 207


>gi|319940341|ref|ZP_08014691.1| DNA repair protein recO [Streptococcus anginosus 1_2_62CV]
 gi|319810397|gb|EFW06739.1| DNA repair protein recO [Streptococcus anginosus 1_2_62CV]
          Length = 257

 Score = 90.6 bits (223), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 27/202 (13%), Positives = 68/202 (33%), Gaps = 2/202 (0%)

Query: 3   WQDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRL 62
                ++L  R++ E + ++++ T Q G+ + FV++ ++ ++ P++Q   +     +   
Sbjct: 5   ITSKGLVLYNRNFRENDKLVKIFTEQAGKRMFFVKHARNSKLNPVIQPLVVADFLMKIND 64

Query: 63  AQNLGEFRFEVLESHCAKLLSSSLFLYGLQSIVPLFRFLPEREPCLELYDMLNIFLNCHK 122
                   ++ + +            Y    +      + + E    L+  L   L   +
Sbjct: 65  DGLSYIDDYQEVTTFQHINHDLFAMAYATYVVALADTSIQDNEIDSALFAFLQKTLELME 124

Query: 123 IPSVIGKIFVQIELMLLKNIGFGLDLTKCVVTGVTQDLLWVSPKSGGAVCRSVGLPYAEK 182
                  +    E+ +L   G  L+  +C            S    G +C         +
Sbjct: 125 QGLDYEVLTNIFEIQILSRFGISLNFHECCFCHRIGLPFDFSFTYNGVLCPEHYGKDERR 184

Query: 183 MLVLP--SFLWKEEQTIDADSL 202
             + P   +L  + Q +    L
Sbjct: 185 SHLDPNIPYLLDQFQAVQYSEL 206


>gi|55820130|ref|YP_138572.1| DNA repair protein RecO [Streptococcus thermophilus LMG 18311]
 gi|55822019|ref|YP_140460.1| DNA repair protein RecO [Streptococcus thermophilus CNRZ1066]
 gi|67461284|sp|Q5M209|RECO_STRT1 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|67461290|sp|Q5M6K1|RECO_STRT2 RecName: Full=DNA repair protein recO; AltName: Full=Recombination
           protein O
 gi|55736115|gb|AAV59757.1| DNA repair protein [Streptococcus thermophilus LMG 18311]
 gi|55738004|gb|AAV61645.1| DNA repair protein [Streptococcus thermophilus CNRZ1066]
          Length = 257

 Score = 90.6 bits (223), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 36/203 (17%), Positives = 70/203 (34%), Gaps = 2/203 (0%)

Query: 4   QDDAIILGVRSYGEKNIILEVMTRQYGRHLGFVRNGQSHRMQPILQAGNLVRVNWRSRLA 63
           +    IL  R+Y E + ++++ T+Q G+ + FVR G S ++  ++Q