RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780951|ref|YP_003065364.1| hypothetical protein CLIBASIA_04250 [Candidatus Liberibacter asiaticus str. psy62] (49 letters) >gnl|CDD|183271 PRK11671, mltC, murein transglycosylase C; Provisional. Length = 359 Score = 26.9 bits (60), Expect = 1.3 Identities = 10/19 (52%), Positives = 13/19 (68%) Query: 11 MLAISPLLFSCSSKKGGEK 29 + I+PLL SCSS K G+ Sbjct: 7 LALIAPLLISCSSTKKGDT 25 >gnl|CDD|150392 pfam09710, Trep_dent_lipo, Treponema clustered lipoprotein (Trep_dent_lipo). This entry represents a family of six predicted lipoproteins from a region of about 20 tandemly arranged genes in the Treponema denticola genome. Two other neighbouring genes share the lipoprotein signal peptide region but do not show more extensive homology. The function of this locus is unknown. Length = 394 Score = 26.0 bits (57), Expect = 2.1 Identities = 12/38 (31%), Positives = 23/38 (60%), Gaps = 3/38 (7%) Query: 9 VLMLAISPLLFSCSSK-KGGEKKGAEKKTSAPLKNGKN 45 +L+LA+ LLFSCS + K + + ++S ++ +N Sbjct: 8 ILILAV--LLFSCSKEVKEQREMRIKVESSMKIEPKEN 43 >gnl|CDD|149063 pfam07790, DUF1628, Protein of unknown function (DUF1628). The sequences making up this family are derived from hypothetical proteins of unknown function expressed by various archaeal species. The region in question is approximately 160 residues long. Length = 78 Score = 25.2 bits (56), Expect = 3.4 Identities = 8/16 (50%), Positives = 13/16 (81%) Query: 5 IIGTVLMLAISPLLFS 20 +IG VLM+AI+ +L + Sbjct: 6 VIGVVLMVAITVILAA 21 >gnl|CDD|148562 pfam07009, DUF1312, Protein of unknown function (DUF1312). This family consists of several bacterial proteins of around 120 residues in length. The function of this family is unknown. Length = 113 Score = 24.5 bits (54), Expect = 5.8 Identities = 12/29 (41%), Positives = 17/29 (58%) Query: 5 IIGTVLMLAISPLLFSCSSKKGGEKKGAE 33 II +++L+ SPL+F S K G K A Sbjct: 2 IIIILIVLSFSPLVFFYKSGKDGNNKKAV 30 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.311 0.127 0.343 Gapped Lambda K H 0.267 0.0705 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 686,692 Number of extensions: 24364 Number of successful extensions: 43 Number of sequences better than 10.0: 1 Number of HSP's gapped: 43 Number of HSP's successfully gapped: 7 Length of query: 49 Length of database: 5,994,473 Length adjustment: 22 Effective length of query: 27 Effective length of database: 5,519,097 Effective search space: 149015619 Effective search space used: 149015619 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits) S2: 50 (23.1 bits)