BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780951|ref|YP_003065364.1| hypothetical protein CLIBASIA_04250 [Candidatus Liberibacter asiaticus str. psy62] (49 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780951|ref|YP_003065364.1| hypothetical protein CLIBASIA_04250 [Candidatus Liberibacter asiaticus str. psy62] Length = 49 Score = 98.2 bits (243), Expect = 2e-23, Method: Compositional matrix adjust. Identities = 49/49 (100%), Positives = 49/49 (100%) Query: 1 MNTRIIGTVLMLAISPLLFSCSSKKGGEKKGAEKKTSAPLKNGKNQSRR 49 MNTRIIGTVLMLAISPLLFSCSSKKGGEKKGAEKKTSAPLKNGKNQSRR Sbjct: 1 MNTRIIGTVLMLAISPLLFSCSSKKGGEKKGAEKKTSAPLKNGKNQSRR 49 >gi|254780920|ref|YP_003065333.1| dTDP-glucose 4,6-dehydratase [Candidatus Liberibacter asiaticus str. psy62] Length = 358 Score = 22.7 bits (47), Expect = 1.1, Method: Composition-based stats. Identities = 10/24 (41%), Positives = 16/24 (66%) Query: 1 MNTRIIGTVLMLAISPLLFSCSSK 24 + T IIGT ++L + L +SC S+ Sbjct: 97 ITTNIIGTFILLEETRLWWSCLSQ 120 >gi|254780395|ref|YP_003064808.1| organic solvent tolerance protein [Candidatus Liberibacter asiaticus str. psy62] Length = 762 Score = 20.4 bits (41), Expect = 5.2, Method: Composition-based stats. Identities = 10/33 (30%), Positives = 16/33 (48%) Query: 17 LLFSCSSKKGGEKKGAEKKTSAPLKNGKNQSRR 49 L F+ + +G + TS P K KN++ R Sbjct: 16 LAFNIITPQGTPPSNEQTTTSTPSKIKKNETNR 48 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.311 0.127 0.343 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 30,585 Number of Sequences: 1233 Number of extensions: 861 Number of successful extensions: 4 Number of sequences better than 100.0: 4 Number of HSP's better than 100.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of query: 49 length of database: 328,796 effective HSP length: 22 effective length of query: 27 effective length of database: 301,670 effective search space: 8145090 effective search space used: 8145090 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (20.9 bits) S2: 31 (16.5 bits)