HHsearch alignment for GI: 254780953 and conserved domain: PRK06742

>PRK06742 flagellar motor protein MotS; Reviewed.
Probab=100.00  E-value=2.3e-33  Score=206.08  Aligned_cols=135  Identities=21%  Similarity=0.318  Sum_probs=114.6

Q ss_pred             HHHHHHHHHHHHCCC---CCEEEEECCEEEEEECCCEECC-CHHHCCHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCC-
Q ss_conf             788899999972017---8358860875899852211128-81310999999999999999858994899998037787-
Q gi|254780953|r   47 LDKAEDEFQMQLQDT---GIVVSRIGDMITCYIPVHVSFV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIG-  121 (190)
Q Consensus        47 ~~~~~~~l~~~~~~~---~~~~~~~~~~~~~~~~~~~~f~-~~a~l~~~~~~~L~~ia~~l~~~~~~~i~I~GHTD~~g-  121 (190)
T Consensus        81 ~~~l~~~l~~~~~~~~~~~v~~~~~~~gl~I~l~~~~lF~~Gsa~l~p~~~~~L~~la~~l~~~~~-~I~I~GHTD~~pi  159 (225)
T PRK06742         81 MDELYKKLKAYVDNNGISQVNVYREDTGVSVVIVDNLIFDTGDANVKPEAKEIISQLVGFFQSVPN-PIVVEGHTDSRPI  159 (225)
T ss_pred             HHHHHHHHHHHHHHCCCCCEEEEECCCEEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCC-EEEEEEECCCCCC
T ss_conf             999999999999737876438997287389996787776898432396699999999999965997-0899996788766


Q ss_pred             ---CHHHHHHHHHHHHHHHHHHHHH-HCCCCCCEEEEEEECCCCCCCCCCCHHHHHCCCCEEEEEE
Q ss_conf             ---2001112258999999998885-2387451699997034588899769779852991699993
Q gi|254780953|r  122 ---TLKNNLLISQERADVIKSYLIQ-RGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIF  183 (190)
Q Consensus       122 ---~~~~N~~LS~~RA~~V~~~L~~-~g~~~~r~i~v~g~G~~~p~~~n~~~~~ra~NRRVei~i~  183 (190)
T Consensus       160 ~~~~~~sNWeLSsaRA~~V~r~l~~~~gi~~~r-l~~~Gygd~~P~~~n~t~e~ra~NRRVeI~i~  224 (225)
T PRK06742        160 HNDKFPSNWELSSARAANMIHHLIEVYNVDDKR-LAAVGYADTKPVVPNDSPQNWEKNRRVVIYIK  224 (225)
T ss_pred             CCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCE-EEEEEECCCCCCCCCCCHHHHHHCCCEEEEEE
T ss_conf             677888649999999999999999836999314-89986557761799949446853796699983