HHsearch alignment for GI: 254780953 and conserved domain: PRK06778

>PRK06778 hypothetical protein; Validated.
Probab=99.96  E-value=1.1e-28  Score=180.02  Aligned_cols=124  Identities=20%  Similarity=0.319  Sum_probs=108.4

Q ss_pred             CCCCEEEEECCEEEEEECCC---EECC-CHHHCCHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCH---HHHHHHHHH
Q ss_conf             17835886087589985221---1128-8131099999999999999985899489999803778720---011122589
Q gi|254780953|r   60 DTGIVVSRIGDMITCYIPVH---VSFV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTL---KNNLLISQE  132 (190)
Q Consensus        60 ~~~~~~~~~~~~~~~~~~~~---~~f~-~~a~l~~~~~~~L~~ia~~l~~~~~~~i~I~GHTD~~g~~---~~N~~LS~~  132 (190)
T Consensus       131 ~~~v~~~it~~GL~I~i~D~~~~~mF~~GSa~l~p~~~~lL~~ia~vL~~~~n-~I~I~GHTD~~Pi~~~~ySNWELSa~  209 (289)
T PRK06778        131 EANLEMEIVPQGLRVLIKDDQNRNMFERGSAQIMPFFKRLLVELAPVFDSLDN-KIIITGHTDAMAYKNNIYNNWNLSGD  209 (289)
T ss_pred             HHCEEEEECCCCEEEEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCC-EEEEEEECCCCCCCCCCCCCHHHHHH
T ss_conf             42704898489408999837888782889875687899999999999862895-38997405777777888996066899


Q ss_pred             HHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCCCCCHHHHHCCCCEEEEEECCH
Q ss_conf             999999988852387451699997034588899769779852991699993010
Q gi|254780953|r  133 RADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRG  186 (190)
Q Consensus       133 RA~~V~~~L~~~g~~~~r~i~v~g~G~~~p~~~n~~~~~ra~NRRVei~i~~~~  186 (190)
T Consensus       210 RA~avrr~L~~~Gl~~~ri~~V~G~Ad~~p~~~~dP~~--~~NRRI~I~vL~~~  261 (289)
T PRK06778        210 RALSARRVLEEAGMPEDKVMQVSAMADQMLLDAKNPQS--AGNRRIEIMVLTKS  261 (289)
T ss_pred             HHHHHHHHHHHCCCCHHHEEEEEEECCCCCCCCCCCCC--CCCCCEEEEEECHH
T ss_conf             99999999998599976888999845777789999876--54685799997869