Query         gi|254780953|ref|YP_003065366.1| OmpA/MotB [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 190
No_of_seqs    126 out of 7161
Neff          9.4 
Searched_HMMs 39220
Date          Mon May 30 04:30:50 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780953.hhm -d /home/congqian_1/database/cdd/Cdd.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PRK10510 putative outer membra 100.0 5.6E-45       0  270.8  17.3  183    1-184     1-218 (219)
  2 PRK09967 putative outer membra 100.0 1.4E-39 3.6E-44  240.7  15.7  157    1-184     1-159 (160)
  3 PRK09038 flagellar motor prote 100.0 1.5E-36 3.7E-41  223.9  18.7  134   54-189   113-251 (285)
  4 PRK10802 peptidoglycan-associa 100.0 3.4E-37 8.6E-42  227.5  15.4  103   78-181    69-172 (173)
  5 COG2885 OmpA Outer membrane pr 100.0 4.7E-37 1.2E-41  226.7  13.4  176    8-185    14-190 (190)
  6 PRK07734 motB flagellar motor  100.0 1.7E-34 4.4E-39  212.4  19.1  130   59-188   123-257 (259)
  7 PRK06925 flagellar motor prote 100.0 2.2E-34 5.7E-39  211.7  19.1  132   52-185    92-229 (230)
  8 TIGR02802 Pal_lipo peptidoglyc 100.0 7.2E-36 1.8E-40  220.1  10.4  102   80-182     2-104 (104)
  9 PRK06667 motB flagellar motor  100.0 5.1E-34 1.3E-38  209.7  17.4  136   54-189   103-247 (254)
 10 PRK06742 flagellar motor prote 100.0 2.3E-33 5.8E-38  206.1  19.5  135   47-183    81-224 (225)
 11 TIGR03350 type_VI_ompA type VI 100.0 3.5E-34 8.9E-39  210.6  15.1  131   50-182     2-137 (137)
 12 PRK08944 motB flagellar motor  100.0 5.6E-34 1.4E-38  209.5  15.7  133   51-185   155-293 (305)
 13 PRK08126 hypothetical protein; 100.0 1.7E-33 4.3E-38  206.8  15.3  133   49-183   290-427 (428)
 14 PRK07033 hypothetical protein; 100.0 2.8E-33 7.1E-38  205.6  15.7  135   48-184   286-425 (429)
 15 PRK08457 motB flagellar motor  100.0 4.6E-33 1.2E-37  204.4  16.8  126   60-189   101-233 (251)
 16 PRK09040 hypothetical protein; 100.0 1.8E-33 4.7E-38  206.6  12.9  133   50-187    65-207 (215)
 17 COG1360 MotB Flagellar motor p 100.0 1.9E-31 4.8E-36  195.4  15.9  134   52-185   106-243 (244)
 18 PRK10808 outer membrane protei 100.0 2.5E-31 6.4E-36  194.7  11.1  113   75-188   221-345 (347)
 19 PRK09039 hypothetical protein; 100.0 6.5E-31 1.7E-35  192.4  12.0  122   61-185   209-343 (343)
 20 PRK09041 motB flagellar motor  100.0 4.4E-29 1.1E-33  182.2  15.7  124   61-187   146-278 (317)
 21 cd07185 OmpA_C-like Peptidogly 100.0 1.3E-29 3.4E-34  185.0  11.4  103   79-182     3-106 (106)
 22 PRK06778 hypothetical protein; 100.0 1.1E-28 2.7E-33  180.0  14.5  124   60-186   131-261 (289)
 23 PRK05996 motB flagellar motor   99.9 7.1E-24 1.8E-28  153.0  14.9  122   61-185   302-430 (431)
 24 PRK12799 motB flagellar motor   99.9 4.6E-23 1.2E-27  148.5  16.2  124   61-187   136-268 (424)
 25 pfam00691 OmpA OmpA family. Th  99.9 4.8E-24 1.2E-28  154.0  10.6   95   81-176     1-97  (97)
 26 PRK07034 hypothetical protein;  99.8 6.4E-21 1.6E-25  136.5   9.0  140   47-187   354-509 (565)
 27 PRK11627 hypothetical protein;  94.8   0.026 6.7E-07   32.5   2.9   23    1-23      1-23  (192)
 28 PRK12696 flgH flagellar basal   94.1   0.069 1.8E-06   30.2   3.9   25    1-25      1-25  (238)
 29 PRK11671 mltC murein transglyc  83.7     3.3 8.3E-05   20.8   6.6  136    1-146     1-164 (360)
 30 PRK10834 hypothetical protein;  81.8     3.9 9.9E-05   20.4   7.4   16    1-16      1-16  (239)
 31 COG3417 FlgN Collagen-binding   81.4     1.9 4.8E-05   22.1   3.5   20    1-20      3-22  (200)
 32 PRK10866 outer membrane protei  81.3     1.9 4.9E-05   22.1   3.4   21    2-22      4-24  (243)
 33 PRK13731 conjugal transfer sur  81.1     3.1   8E-05   20.9   4.5   87    2-88      3-106 (243)
 34 pfam06291 Lambda_Bor Bor prote  80.3     0.9 2.3E-05   23.9   1.5   24    2-25      1-24  (97)
 35 PRK00022 lolB outer membrane l  79.7     2.4 6.2E-05   21.5   3.6   25    1-25      1-25  (203)
 36 PRK01326 prsA foldase protein   79.5       2 5.1E-05   22.0   3.1   25    1-25      1-28  (310)
 37 PRK13861 type IV secretion sys  79.2     1.2 3.1E-05   23.2   1.9   21    1-21      1-21  (293)
 38 TIGR02747 TraV type IV conjuga  78.4     1.3 3.3E-05   23.1   1.8   21    1-21      1-23  (174)
 39 PRK10449 heat-inducible protei  78.4     1.8 4.6E-05   22.2   2.6   24    2-25      1-24  (140)
 40 pfam05643 DUF799 Putative bact  77.9     1.9 4.9E-05   22.1   2.6   23    2-24      1-23  (215)
 41 pfam06474 MLTD_N MLTD_N.        77.9     2.3 5.9E-05   21.6   3.0   28    2-30      1-28  (93)
 42 PRK10760 murein hydrolase B; P  77.4     2.8 7.2E-05   21.2   3.3   27    2-28      1-27  (357)
 43 PRK12698 flgH flagellar basal   77.2     2.2 5.6E-05   21.7   2.7   23    2-25      1-23  (224)
 44 PRK13883 conjugal transfer pro  76.7     1.9 4.8E-05   22.1   2.3   21    1-22      1-21  (156)
 45 TIGR03525 GldK gliding motilit  76.5       2 5.2E-05   21.9   2.4   24    2-25      1-24  (449)
 46 pfam07901 DUF1672 Protein of u  76.1     2.5 6.4E-05   21.4   2.8   26    1-26      1-26  (304)
 47 pfam08139 LPAM_1 Prokaryotic m  74.8     2.5 6.3E-05   21.5   2.4   23    2-24      1-23  (26)
 48 PRK03002 prsA peptidylprolyl i  72.6     3.6 9.2E-05   20.5   2.9   25    1-25      1-28  (285)
 49 PRK12450 foldase protein PrsA;  70.8     4.4 0.00011   20.0   3.0   26    1-26      3-31  (309)
 50 PRK12407 flgH flagellar basal   70.1     4.3 0.00011   20.1   2.8   21    3-23      1-21  (220)
 51 COG5633 Predicted periplasmic   69.4     3.2 8.1E-05   20.9   2.0   27    2-28      1-27  (123)
 52 pfam04076 BOF Bacterial OB fol  68.2     7.9  0.0002   18.6   3.8   18  105-122    98-115 (126)
 53 TIGR03516 ppisom_GldI peptidyl  68.2     9.2 0.00023   18.3   5.7   70    2-72      1-71  (177)
 54 PRK11138 outer membrane protei  68.1     7.8  0.0002   18.7   3.8   25    2-26      4-28  (394)
 55 TIGR03431 PhnD phosphonate ABC  67.4     9.5 0.00024   18.2   5.5   25    1-25      1-25  (288)
 56 PRK11443 hypothetical protein;  66.6     5.7 0.00015   19.4   2.8   25    2-27      1-25  (120)
 57 PRK13616 lipoprotein LpqB; Pro  65.7     7.2 0.00018   18.9   3.2   27    1-27      5-31  (590)
 58 TIGR03352 VI_chp_3 type VI sec  64.4     3.5 8.9E-05   20.6   1.4   22    3-24      1-22  (146)
 59 PRK00249 flgH flagellar basal   64.3      11 0.00028   17.8   4.0   25    2-26      3-27  (231)
 60 PRK09810 entericidin A; Provis  64.1     5.7 0.00014   19.4   2.4   21    1-21      1-22  (41)
 61 TIGR03659 IsdE heme ABC transp  63.0      10 0.00026   18.1   3.5   23    5-27      6-28  (289)
 62 COG3065 Slp Starvation-inducib  62.9     6.3 0.00016   19.2   2.5   24    2-25      7-30  (191)
 63 PRK02944 OxaA-like protein pre  62.6     9.9 0.00025   18.1   3.4   23    1-23      1-26  (255)
 64 COG3009 Uncharacterized protei  61.1      13 0.00032   17.5   3.8   22    1-24      1-22  (190)
 65 PRK11260 cystine transporter s  59.4     9.3 0.00024   18.2   2.8   24    1-24      4-27  (264)
 66 COG3317 NlpB Uncharacterized l  58.8     9.5 0.00024   18.2   2.8   25    2-26      4-28  (342)
 67 COG3056 Uncharacterized lipopr  58.0     9.3 0.00024   18.2   2.6   26    1-26     14-39  (204)
 68 PRK11372 lysozyme inhibitor; P  56.9     7.8  0.0002   18.7   2.1   22    1-23      2-23  (109)
 69 TIGR03302 OM_YfiO outer membra  56.8      14 0.00036   17.2   3.4   22    3-24      2-23  (235)
 70 TIGR00752 slp outer membrane l  56.0     8.1 0.00021   18.6   2.1   25    2-26      2-26  (190)
 71 TIGR02887 spore_ger_x_C germin  55.9     8.5 0.00022   18.5   2.2   26    1-26      1-26  (400)
 72 PRK04405 prsA peptidylprolyl i  55.1      12  0.0003   17.7   2.8   22    1-22      4-28  (298)
 73 COG5510 Predicted small secret  55.1     9.7 0.00025   18.1   2.4   21    1-21      1-25  (44)
 74 PRK03095 prsA peptidylprolyl i  55.0      13 0.00034   17.4   3.0   24    1-24      1-25  (287)
 75 COG4764 Uncharacterized protei  54.7      11 0.00027   17.9   2.5   24    1-26      5-28  (197)
 76 PRK11251 DNA-binding transcrip  54.4      12 0.00032   17.5   2.8   25    1-25      1-25  (109)
 77 PRK13835 conjugal transfer pro  53.6      17 0.00043   16.8   4.2   25    2-26      1-25  (144)
 78 TIGR03502 lipase_Pla1_cef extr  53.3      13 0.00034   17.4   2.8   19    2-20      1-21  (792)
 79 pfam12262 Lipase_bact_N Bacter  53.1      12  0.0003   17.7   2.5   24    1-25      1-26  (269)
 80 TIGR02269 TIGR02269 Myxococcus  51.3      12 0.00029   17.7   2.2   23    6-28      2-24  (228)
 81 pfam00543 P-II Nitrogen regula  50.9      19 0.00048   16.5   4.3   32  132-163     8-39  (102)
 82 PRK10002 outer membrane protei  50.8      12  0.0003   17.6   2.2   20    1-20      1-20  (362)
 83 pfam02402 Lysis_col Lysis prot  50.7     7.8  0.0002   18.7   1.3   28    1-28      1-29  (46)
 84 COG4851 CamS Protein involved   50.3      16  0.0004   17.0   2.8   25    1-25      1-26  (382)
 85 pfam02698 DUF218 DUF218 domain  49.2      20 0.00051   16.4   5.5   56   89-152    12-67  (148)
 86 TIGR02898 spore_YhcN_YlaJ spor  48.2      13 0.00034   17.4   2.1   21    5-25      2-24  (185)
 87 cd03527 RuBisCO_small Ribulose  48.0      21 0.00054   16.3   3.8   29   91-119    58-86  (99)
 88 pfam11153 DUF2931 Protein of u  48.0      16  0.0004   17.0   2.5   19    2-21      1-19  (202)
 89 PRK11063 metQ DL-methionine tr  46.9      22 0.00056   16.2   7.2   17    8-24     13-29  (271)
 90 PRK11189 lipoprotein NlpI; Pro  46.8      22 0.00056   16.2   4.0   23    1-23      1-25  (297)
 91 PRK10665 nitrogen regulatory p  46.1      23 0.00057   16.1   4.5   31  132-162    11-41  (112)
 92 pfam07273 DUF1439 Protein of u  45.7      18 0.00046   16.6   2.5   20    1-20      1-20  (177)
 93 pfam06935 DUF1284 Protein of u  44.2      24 0.00062   15.9   3.9   61   89-152     3-71  (103)
 94 PRK12788 flgH flagellar basal   44.2      24 0.00062   15.9   3.3   21    2-23      1-21  (231)
 95 PRK02463 OxaA-like protein pre  44.0      24 0.00062   15.9   3.2   18    7-24     13-30  (307)
 96 PRK04792 tolB translocation pr  43.5      19 0.00049   16.5   2.3   20    1-20      1-21  (450)
 97 cd00145 POLBc DNA polymerase t  43.3      25 0.00064   15.8   4.0   34   85-120   131-164 (323)
 98 PRK09859 multidrug efflux syst  42.9      25 0.00064   15.8   3.4   22    3-24      5-27  (385)
 99 PRK10598 hypothetical protein;  42.5      21 0.00053   16.3   2.4   21    2-22      1-23  (186)
100 PRK10523 lipoprotein involved   42.3      26 0.00066   15.8   3.1   30  135-164   178-208 (234)
101 TIGR03300 assembly_YfgL outer   42.2      24 0.00061   16.0   2.7   22    3-24      1-22  (377)
102 COG3133 SlyB Outer membrane li  41.6      20 0.00051   16.4   2.2   25    1-25      1-26  (154)
103 COG5645 Predicted periplasmic   41.3     9.8 0.00025   18.1   0.6   22    2-23      1-22  (80)
104 pfam06572 DUF1131 Protein of u  40.9      27  0.0007   15.6   2.9   29    1-29      1-29  (192)
105 PRK01622 OxaA-like protein pre  40.3      28 0.00071   15.6   3.2   17    7-23     12-28  (266)
106 cd00741 Lipase Lipase.  Lipase  40.1      28 0.00072   15.6   8.3   62   92-166    11-72  (153)
107 pfam09476 Pilus_CpaD Pilus bio  39.8      28 0.00073   15.5  11.9   75   84-164    47-121 (200)
108 COG3111 Periplasmic protein wi  39.7      19 0.00049   16.5   1.9   17  104-120    97-113 (128)
109 PRK03757 hypothetical protein;  39.6      23 0.00058   16.1   2.3   25    2-26      1-25  (191)
110 TIGR02963 xanthine_xdhA xanthi  39.6      25 0.00064   15.8   2.4   24   95-119   234-257 (515)
111 PRK06481 fumarate reductase fl  39.4      29 0.00073   15.5   3.5   23    4-26      7-29  (506)
112 TIGR00972 3a0107s01c2 phosphat  39.1      29 0.00074   15.5   4.4   84   76-185   162-246 (248)
113 pfam00101 RuBisCO_small Ribulo  39.1      29 0.00074   15.5   3.7   28   91-118    57-84  (98)
114 PRK02939 hypothetical protein;  39.0      16  0.0004   16.9   1.4   24    2-25      1-24  (236)
115 TIGR01344 malate_syn_A malate   39.0      11 0.00028   17.8   0.6   11  115-125   124-134 (522)
116 COG3521 Predicted component of  38.4      28 0.00072   15.6   2.6   24    1-24      1-26  (159)
117 PRK11548 hypothetical protein;  38.4      30 0.00076   15.4   5.7   22    2-23      3-25  (113)
118 pfam01764 Lipase_3 Lipase (cla  38.3      30 0.00077   15.4   7.9   64   92-168    46-109 (141)
119 PRK09934 putative fimbrial pro  38.0      24 0.00061   15.9   2.1   22    2-23      1-22  (171)
120 PRK10783 mltD membrane-bound l  36.2      32 0.00083   15.2   3.4   23    2-25      1-23  (449)
121 COG4594 FecB ABC-type Fe3+-cit  36.0      33 0.00083   15.2   3.0   26    1-26      3-30  (310)
122 TIGR01618 phage_P_loop phage n  35.8      33 0.00084   15.2   6.3   82   93-176   124-213 (229)
123 TIGR01892 AcOrn-deacetyl acety  35.5      15 0.00039   17.0   0.8   68   88-164   275-345 (386)
124 PRK09915 putative outer membra  34.8      34 0.00087   15.1   3.6   25    2-26      6-32  (488)
125 COG1729 Uncharacterized protei  34.2      35  0.0009   15.0   4.5   25    1-25      1-25  (262)
126 PRK12700 flgH flagellar basal   34.0      35  0.0009   15.0   3.6   21    5-25      9-29  (230)
127 PRK10641 btuB vitamin B12/coba  33.7      16  0.0004   16.9   0.7   12    1-12      1-12  (615)
128 TIGR03511 GldH_lipo gliding mo  32.4      20 0.00052   16.3   1.1   22    1-22      3-24  (156)
129 PRK10053 hypothetical protein;  32.3      38 0.00097   14.8   2.9   59   60-121    59-118 (130)
130 PRK09837 copper/silver efflux   32.1      38 0.00097   14.8   3.5   23    1-23      1-23  (460)
131 PRK10533 putative lipoprotein;  31.7      35  0.0009   15.0   2.2   23    3-25      4-26  (171)
132 PRK10397 hypothetical protein;  31.4      30 0.00076   15.4   1.8   24    2-26      1-24  (137)
133 COG3218 ABC-type uncharacteriz  31.3      22 0.00056   16.2   1.1   22    1-22      9-30  (205)
134 PRK09973 putative outer membra  30.7      20 0.00051   16.4   0.8   23    1-23      1-25  (85)
135 pfam06788 UPF0257 Uncharacteri  30.6      22 0.00056   16.1   1.0   22    2-23      1-22  (236)
136 PRK02889 tolB translocation pr  30.6      41   0.001   14.7   2.4   27    1-27      3-29  (430)
137 PRK10290 superoxide dismutase;  30.4      41   0.001   14.6   2.6   22    2-23      1-22  (173)
138 KOG2534 consensus               30.4      26 0.00065   15.8   1.3   15  174-188   273-287 (353)
139 pfam08085 Entericidin Enterici  30.0      41   0.001   14.7   2.3   21    1-21      1-24  (42)
140 cd00307 RuBisCO_small_like Rib  29.4      42  0.0011   14.6   3.7   30   90-119    42-71  (84)
141 pfam12000 DUF3495 Domain of un  29.4      43  0.0011   14.5   3.5   37  124-160    40-79  (172)
142 PRK13619 psbV cytochrome c-550  29.1      31 0.00079   15.3   1.5   51   92-143    91-147 (161)
143 pfam07269 consensus             28.9      37 0.00095   14.9   1.9   20    2-23      1-20  (55)
144 TIGR02544 III_secr_YscJ type I  28.8      37 0.00094   14.9   1.9   19    3-21      2-20  (203)
145 pfam10671 TcpQ Toxin co-regula  28.6      20 0.00051   16.4   0.5   25    1-25      1-25  (178)
146 PRK00031 lolA outer-membrane l  28.6      36 0.00093   14.9   1.8   20    2-21      1-20  (201)
147 COG4314 NosL Predicted lipopro  28.4      44  0.0011   14.4   2.8   23    1-23      1-23  (176)
148 cd00519 Lipase_3 Lipase (class  27.8      45  0.0012   14.4   7.4   65   91-170   110-174 (229)
149 PRK13684 Ycf48-like protein; P  27.6      46  0.0012   14.4   2.2   20    2-21      8-27  (333)
150 PRK11162 mltA murein transglyc  27.4      46  0.0012   14.4   3.6   30    1-31      2-31  (362)
151 PRK10877 thiol:disulfide inter  27.3      46  0.0012   14.3   2.7   22    1-22      1-22  (232)
152 KOG4569 consensus               27.2      47  0.0012   14.3   7.3   57   93-160   155-211 (336)
153 PRK10672 rare lipoprotein A; P  26.6      48  0.0012   14.3   3.1   26    1-26      1-26  (369)
154 TIGR03044 PS_II_psb27 photosys  26.6      48  0.0012   14.3   2.6   21    3-23     10-30  (135)
155 PRK13614 lipoprotein LpqB; Pro  25.1      51  0.0013   14.1   2.8   23    3-25      9-31  (573)
156 pfam02169 LPP20 LPP20 lipoprot  24.4      39 0.00099   14.8   1.3   25    2-26      5-29  (168)
157 CHL00130 rbcS ribulose-1,5-bis  23.8      54  0.0014   14.0   4.1   33   91-123    60-92  (138)
158 TIGR02722 lp_ uncharacterized   23.6      55  0.0014   13.9   3.4   18    5-22      6-23  (215)
159 COG4607 CeuA ABC-type enteroch  23.1      56  0.0014   13.9   2.6   23    1-23      2-24  (320)
160 PRK13799 unknown domain/N-carb  23.1      56  0.0014   13.9   9.0   80   86-165   207-309 (591)
161 PRK10781 rcsF outer membrane l  22.7      57  0.0015   13.8   2.4   22    2-24      1-22  (133)
162 CHL00133 psbV photosystem II c  22.7      43  0.0011   14.5   1.3   51   92-143    91-147 (163)
163 TIGR02521 type_IV_pilW type IV  22.1      59  0.0015   13.8   3.8   16    7-22      1-16  (247)
164 PRK09861 cytoplasmic membrane   22.1      59  0.0015   13.8   8.2   21    4-24     10-30  (272)
165 PRK12789 flgI flagellar basal   22.0      53  0.0014   14.0   1.6   17    1-17      1-17  (367)
166 pfam03032 Brevenin Brevenin/es  21.9      59  0.0015   13.8   1.9   20    1-20      3-23  (46)
167 COG2834 LolA Outer membrane li  21.8      56  0.0014   13.9   1.7   22    1-22      5-26  (211)
168 pfam09961 DUF2195 Uncharacteri  21.6      60  0.0015   13.7   2.6   54  122-183    63-116 (121)
169 PHA00407 phage lambda Rz1-like  21.5      60  0.0015   13.7   2.3   21    5-25     36-56  (84)
170 PRK10796 LPS-assembly lipoprot  21.1      62  0.0016   13.6   1.9   54    9-67     10-64  (196)
171 COG4259 Uncharacterized protei  21.0      62  0.0016   13.6   2.7   24    1-24      1-28  (121)
172 PHA02118 hypothetical protein   20.8      63  0.0016   13.6   2.6   25    2-26      5-29  (202)
173 PRK09578 periplasmic multidrug  20.6      63  0.0016   13.6   3.2   22    3-24      7-29  (385)
174 PRK12699 flgH flagellar basal   20.2      65  0.0017   13.5   3.0   21    7-27     22-42  (246)
175 PRK13733 conjugal transfer pro  20.0      11 0.00029   17.8  -2.1   26    1-26      1-27  (171)

No 1  
>PRK10510 putative outer membrane lipoprotein; Provisional
Probab=100.00  E-value=5.6e-45  Score=270.77  Aligned_cols=183  Identities=30%  Similarity=0.443  Sum_probs=155.0

Q ss_pred             CHHHHHHHHHH---HHHHHHCCCCCCCCCCCCCC---C----------------------------CCCCCCCCCHHHHH
Q ss_conf             94789999999---99997514788765444445---5----------------------------55431111001233
Q gi|254780953|r    1 MIKELGLSMFI---MTTISGCGLASREKKKVFLH---K----------------------------SNDTDIVNKRFGSS   46 (190)
Q Consensus         1 m~k~l~l~~~~---~~~l~g~~~~~~~~~~~~~~---~----------------------------~~~~~~~~~~~~~~   46 (190)
                      |.++.+|...+   +++++||.+.+....+....   +                            +..+...+..++.+
T Consensus         1 m~~r~~lia~~~a~~l~lsgC~t~p~tg~~~~~~~~~ga~~Ga~~Ga~~G~~~~~~~~~~~galiGA~~G~~~G~~iG~~   80 (219)
T PRK10510          1 MKKRVYLIAAIVSGALAVSGCTTNPYTGEREAGKSGIGAGIGSLVGAGIGALSSSKKDRGKGALIGAAAGAALGGGVGYY   80 (219)
T ss_pred             CCHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHH
T ss_conf             94268999999999987413567898766553266675789999989862102575531010799999999998899998


Q ss_pred             HHHHHHHHHHHHCCCCCEEEEECCEEEEEECCCEECC-CHHHCCHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCHHH
Q ss_conf             7888999999720178358860875899852211128-813109999999999999998589948999980377872001
Q gi|254780953|r   47 LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKN  125 (190)
Q Consensus        47 ~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~f~-~~a~l~~~~~~~L~~ia~~l~~~~~~~i~I~GHTD~~g~~~~  125 (190)
                      +|+++.+++.+++..++.+.+.++.+.+.+|.+++|+ +|+.|+|++++.|+.+|.+|++||+..|.|+||||+.|+++|
T Consensus        81 mD~qe~~lr~~l~~~gv~v~r~gd~l~l~mp~~I~F~~dsa~l~p~~~~~L~~vA~~L~~yp~~~V~I~GHTD~~G~~~y  160 (219)
T PRK10510         81 MDVQEAKLRDKMRGTGVSVTRSGDNIILNMPNNVTFDSSSATLKPAGANTLTGVAMVLKEYPKTAVNVVGYTDSTGSHDL  160 (219)
T ss_pred             HHHHHHHHHHHHCCCCCEEEECCCEEEEECCCCCEEECCCHHCCHHHHHHHHHHHHHHHHCCCCEEEEEEEECCCCCHHH
T ss_conf             89999999998512892899868778996788856618852129678999999999999889927999987689671999


Q ss_pred             HHHHHHHHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCCCCCHHHHHCCCCEEEEEEC
Q ss_conf             11225899999999888523874516999970345888997697798529916999930
Q gi|254780953|r  126 NLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP  184 (190)
Q Consensus       126 N~~LS~~RA~~V~~~L~~~g~~~~r~i~v~g~G~~~p~~~n~~~~~ra~NRRVei~i~~  184 (190)
                      |+.||++||++|++||+.+|+.+.| |.+.||||++|+++|+++++|++||||||.|+|
T Consensus       161 N~~LS~~RA~aV~~yL~~~GV~~~R-i~~~G~Ge~~Pia~n~t~~gra~NRRVEI~i~P  218 (219)
T PRK10510        161 NMRLSQQRADSVASALITQGVDASR-IRTQGLGPANPIASNSTAEGKAQNRRVEITLSP  218 (219)
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCHHH-EEEEEECCCCCCCCCCCHHHHHHCCCEEEEEEC
T ss_conf             9999999999999999985999564-899987665778999397789853988999957


No 2  
>PRK09967 putative outer membrane lipoprotein; Provisional
Probab=100.00  E-value=1.4e-39  Score=240.74  Aligned_cols=157  Identities=23%  Similarity=0.284  Sum_probs=124.3

Q ss_pred             CHHHHHHHHHH-HHHHHHCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCEEEEECCEEEEEECCC
Q ss_conf             94789999999-99997514788765444445555431111001233788899999972017835886087589985221
Q gi|254780953|r    1 MIKELGLSMFI-MTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVH   79 (190)
Q Consensus         1 m~k~l~l~~~~-~~~l~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~   79 (190)
                      |||.++..+++ +++++||++......              ...       ...+...    +  .....+...+.+++.
T Consensus         1 m~k~~~~~~l~~~l~lsgC~s~~~~~t--------------~~~-------~~~~~~~----~--~~~t~~~~~~g~~d~   53 (160)
T PRK09967          1 MIKHLVAPLIFTSLILTGCQSPQGKFT--------------PEQ-------VAAMQSY----G--FTESAGDWSLGLSDA   53 (160)
T ss_pred             CHHHHHHHHHHHHHHHHHCCCCCCCCC--------------HHH-------HHHHHHC----C--CCCCCCCCCCCCCCC
T ss_conf             907899999999999984589999989--------------899-------8888743----7--522354314489983


Q ss_pred             EECC-CHHHCCHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEEEC
Q ss_conf             1128-813109999999999999998589948999980377872001112258999999998885238745169999703
Q gi|254780953|r   80 VSFV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFA  158 (190)
Q Consensus        80 ~~f~-~~a~l~~~~~~~L~~ia~~l~~~~~~~i~I~GHTD~~g~~~~N~~LS~~RA~~V~~~L~~~g~~~~r~i~v~g~G  158 (190)
                      +||+ +++.|+|+++..|+++|.+|+++|...|.|+||||+.|+++||+.||++||++|++||+..|.++..+|.+.|||
T Consensus        54 V~Fd~d~~~L~~~s~~~L~~~A~~L~~~p~~~v~I~GHTD~~G~~~yN~~LS~rRA~aV~~~l~~~g~i~~~ri~~~g~G  133 (160)
T PRK09967         54 ILFAKNDYKLLPESQQQIQTMAAKLASTGLTHARMDGHTDNYGEDSYNEGLSLKRANVVADAWAMGGQIPRSNLTTQGLG  133 (160)
T ss_pred             EEECCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEEECC
T ss_conf             79269950119989999999999999789962999874799899899999999999999999985378544358999646


Q ss_pred             CCCCCCCCCCHHHHHCCCCEEEEEEC
Q ss_conf             45888997697798529916999930
Q gi|254780953|r  159 YKYPIDTNDTKVGRQNNQRIEIQIFP  184 (190)
Q Consensus       159 ~~~p~~~n~~~~~ra~NRRVei~i~~  184 (190)
                      +.+|+++|++++||++||||||+|..
T Consensus       134 e~~Pv~~n~t~~gra~NRRVeivit~  159 (160)
T PRK09967        134 KKYPIASNKTAQGRAENRRVAVVITT  159 (160)
T ss_pred             CCCCCCCCCCHHHHHHCCCEEEEEEC
T ss_conf             56738899698999876998999839


No 3  
>PRK09038 flagellar motor protein MotD; Reviewed
Probab=100.00  E-value=1.5e-36  Score=223.94  Aligned_cols=134  Identities=24%  Similarity=0.405  Sum_probs=120.2

Q ss_pred             HHHHHCCCCCEEEEECCEEEEEECCCEECC-CHHHCCHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCC----CHHHHHH
Q ss_conf             999720178358860875899852211128-81310999999999999999858994899998037787----2001112
Q gi|254780953|r   54 FQMQLQDTGIVVSRIGDMITCYIPVHVSFV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIG----TLKNNLL  128 (190)
Q Consensus        54 l~~~~~~~~~~~~~~~~~~~~~~~~~~~f~-~~a~l~~~~~~~L~~ia~~l~~~~~~~i~I~GHTD~~g----~~~~N~~  128 (190)
                      +........+.+...++++.+.+.+..+|+ +++.|++++++.|+.|+..|+..|+ .|.|+||||+.+    .+..||+
T Consensus       113 l~~~~~~~~v~v~~~~~gl~I~l~~~~lF~~GSA~L~~~~~~lL~~ia~~L~~~~n-~I~I~GHTD~~Pi~~~~~~sNWe  191 (285)
T PRK09038        113 LGPLIDSGQVTVRRNELWIEIEINSSLLFGSGDALLSDEAFAILEKVAEVLKPFPN-PIHVEGFTDNVPIATAQFPSNWE  191 (285)
T ss_pred             HHHHHHCCCEEEEECCCEEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCC-EEEEEEECCCCCCCCCCCCCHHH
T ss_conf             98641158359997399799995688686888432498799999999999984387-28999857887655566786489


Q ss_pred             HHHHHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCCCCCHHHHHCCCCEEEEEECCHHHC
Q ss_conf             2589999999988852387451699997034588899769779852991699993010113
Q gi|254780953|r  129 ISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGNIK  189 (190)
Q Consensus       129 LS~~RA~~V~~~L~~~g~~~~r~i~v~g~G~~~p~~~n~~~~~ra~NRRVei~i~~~~~~k  189 (190)
                      ||..||.+|+.||+..|+++.| +.++|||+++|+++|+|++||++||||||+|+.++..|
T Consensus       192 LSaaRA~aV~r~L~~~Gi~p~R-l~~~Gygd~~P~~~N~t~egRa~NRRVeIvILr~~~~~  251 (285)
T PRK09038        192 LSAARAASVVRLLADDGVAPSR-LAAVGYGEFQPVADNDTAEGRARNRRVVLVILRNLDVR  251 (285)
T ss_pred             HHHHHHHHHHHHHHHCCCCHHH-EEEEEECCCCCCCCCCCCHHHHHCCCEEEEEECCHHHH
T ss_conf             9999999999999975999678-79987657876899948002530787699996786764


No 4  
>PRK10802 peptidoglycan-associated outer membrane lipoprotein; Provisional
Probab=100.00  E-value=3.4e-37  Score=227.50  Aligned_cols=103  Identities=26%  Similarity=0.418  Sum_probs=98.3

Q ss_pred             CCEEC-CCHHHCCHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEE
Q ss_conf             21112-88131099999999999999985899489999803778720011122589999999988852387451699997
Q gi|254780953|r   78 VHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRG  156 (190)
Q Consensus        78 ~~~~f-~~~a~l~~~~~~~L~~ia~~l~~~~~~~i~I~GHTD~~g~~~~N~~LS~~RA~~V~~~L~~~g~~~~r~i~v~g  156 (190)
                      ..+|| ++++.|+++++..|+.++.+|+.+|+..|.|+||||++|+.+||+.||++||++|+.||+..|+.+.| |.++|
T Consensus        69 ~~vyFdfd~~~l~~~~~~~L~~~a~~L~~~p~~~v~i~GhtD~~Gt~eYN~~Ls~rRA~aV~~yL~~~GV~~~r-i~~vs  147 (173)
T PRK10802         69 NIVYFDLDKYDIRSDFAQMLDAHANFLRSNPSYKVTVEGHADERGTPEYNISLGERRANAVKMYLQGKGVSADQ-ISIVS  147 (173)
T ss_pred             CEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCHHH-EEEEE
T ss_conf             97991588521699899999999999998899179998746998849999999999999999999984999899-68987


Q ss_pred             ECCCCCCCCCCCHHHHHCCCCEEEE
Q ss_conf             0345888997697798529916999
Q gi|254780953|r  157 FAYKYPIDTNDTKVGRQNNQRIEIQ  181 (190)
Q Consensus       157 ~G~~~p~~~n~~~~~ra~NRRVei~  181 (190)
                      ||+.+|++.|+++++|++||||||+
T Consensus       148 yGee~P~~~~~~e~~~~~NRR~~~v  172 (173)
T PRK10802        148 YGKEKPAVLGHDEAAYAKNRRAVLV  172 (173)
T ss_pred             ECCCCCCCCCCCHHHHHHCCCEEEE
T ss_conf             6665768989398899876977886


No 5  
>COG2885 OmpA Outer membrane protein and related peptidoglycan-associated (lipo)proteins [Cell envelope biogenesis, outer membrane]
Probab=100.00  E-value=4.7e-37  Score=226.68  Aligned_cols=176  Identities=30%  Similarity=0.421  Sum_probs=128.4

Q ss_pred             HHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCEEEEECCEEEEEECCCEECC-CHH
Q ss_conf             9999999975147887654444455554311110012337888999999720178358860875899852211128-813
Q gi|254780953|r    8 SMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV-SEV   86 (190)
Q Consensus         8 ~~~~~~~l~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~f~-~~a   86 (190)
                      ..+....+.+|......... ...................+.........................+.++..++|+ +++
T Consensus        14 ~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~F~~ds~   92 (190)
T COG2885          14 AALPGAALGACASKLNGDSA-ALIGAGPGALGGAGAGVPLDVAEAELRAKEAGDGPAERRKARDIILNLPNDVLFDFDSS   92 (190)
T ss_pred             HHHHHHHHHCCHHCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCCCCCCCHHCCCCCEEEECCCCH
T ss_conf             10045542110100125653-22465544343345676655220012211003563212233320001454068358834


Q ss_pred             HCCHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCCC
Q ss_conf             10999999999999999858994899998037787200111225899999999888523874516999970345888997
Q gi|254780953|r   87 FLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTN  166 (190)
Q Consensus        87 ~l~~~~~~~L~~ia~~l~~~~~~~i~I~GHTD~~g~~~~N~~LS~~RA~~V~~~L~~~g~~~~r~i~v~g~G~~~p~~~n  166 (190)
                      .|+|+++..|+.++.+|+++|...|.|+||||+.|+++||+.||++||++|++||+.+|+.++| |.+.|||+++|+++|
T Consensus        93 ~l~p~~~~~L~~~a~~L~~~p~~~i~V~GHTD~~Gs~~yN~~LS~rRA~aV~~~L~~~Gv~~~~-i~~~G~G~~~Pia~n  171 (190)
T COG2885          93 VLKPKAQATLDELAKYLKKNPITRILVEGHTDSTGSDEYNQALSERRAEAVADYLVSQGVVADR-ISTVGYGEEKPIASN  171 (190)
T ss_pred             HHCHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCC-EEEEECCCCCCCCCC
T ss_conf             4398999999999999987899779997557887986787688899999999999984997011-789861645777889


Q ss_pred             CCHHHHHCCCCEEEEEECC
Q ss_conf             6977985299169999301
Q gi|254780953|r  167 DTKVGRQNNQRIEIQIFPR  185 (190)
Q Consensus       167 ~~~~~ra~NRRVei~i~~~  185 (190)
                      +|++||++||||||.|.+.
T Consensus       172 ~t~~gra~NRRVei~i~~~  190 (190)
T COG2885         172 ATEEGRAKNRRVEIKISPK  190 (190)
T ss_pred             CCCHHCCCCCCEEEEEECC
T ss_conf             7800103467478986278


No 6  
>PRK07734 motB flagellar motor protein MotB; Reviewed
Probab=100.00  E-value=1.7e-34  Score=212.38  Aligned_cols=130  Identities=23%  Similarity=0.314  Sum_probs=115.6

Q ss_pred             CCCCCEEEEECCEEEEEECCCEECC-CHHHCCHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCC----CHHHHHHHHHHH
Q ss_conf             0178358860875899852211128-81310999999999999999858994899998037787----200111225899
Q gi|254780953|r   59 QDTGIVVSRIGDMITCYIPVHVSFV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIG----TLKNNLLISQER  133 (190)
Q Consensus        59 ~~~~~~~~~~~~~~~~~~~~~~~f~-~~a~l~~~~~~~L~~ia~~l~~~~~~~i~I~GHTD~~g----~~~~N~~LS~~R  133 (190)
                      ....+.+...++++.+.+.+.++|+ +++.|+|+++..|..++..|..++...|.|+||||+.+    .+..||+||..|
T Consensus       123 l~~~v~v~~~~~Gl~I~l~~~~lF~~GsA~l~~~~~~lL~~ia~~l~~~~~~~I~V~GHTD~~Pi~~~~~~sNWeLSaaR  202 (259)
T PRK07734        123 LSSSLQTKLTEEGLLVTILDNILFDSGKADVRLEDLPLAKEMSNLLVSNPPRNITISGHTDNVPIANAQFASNWELSVMR  202 (259)
T ss_pred             CCCCEEEEECCCEEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCCCCCCCHHHHHHHH
T ss_conf             03653799748837999537766688987569779999999999998579963899985577666677676448999999


Q ss_pred             HHHHHHHHHHHCCCCCCEEEEEEECCCCCCCCCCCHHHHHCCCCEEEEEECCHHH
Q ss_conf             9999998885238745169999703458889976977985299169999301011
Q gi|254780953|r  134 ADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGNI  188 (190)
Q Consensus       134 A~~V~~~L~~~g~~~~r~i~v~g~G~~~p~~~n~~~~~ra~NRRVei~i~~~~~~  188 (190)
                      |.+|+.||+..+..+++++++.|||+++|+++|+|++||++||||||+|+|+..-
T Consensus       203 A~sV~~~L~~~~gi~~~rl~v~G~gd~~Pi~~n~t~egra~NRRVeI~il~~~~~  257 (259)
T PRK07734        203 AVNFMQVLLENKELDPEKFSAKGYGEYKPIASNDTAEGRAKNRRVEVLILPLTEK  257 (259)
T ss_pred             HHHHHHHHHHCCCCCCCEEEEEEECCCCCCCCCCCCCHHHCCCCEEEEEECCCCC
T ss_conf             9999999998169995679999855787489996920142178679999576302


No 7  
>PRK06925 flagellar motor protein MotS; Reviewed
Probab=100.00  E-value=2.2e-34  Score=211.72  Aligned_cols=132  Identities=26%  Similarity=0.332  Sum_probs=115.1

Q ss_pred             HHHHHHHCCCCCEEEEECCEEEEEECCCEECC-CHHHCCHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCC----HHHH
Q ss_conf             99999720178358860875899852211128-813109999999999999998589948999980377872----0011
Q gi|254780953|r   52 DEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGT----LKNN  126 (190)
Q Consensus        52 ~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~f~-~~a~l~~~~~~~L~~ia~~l~~~~~~~i~I~GHTD~~g~----~~~N  126 (190)
                      ..+........+.+...+.++.+.+++..+|+ +++.|+++++..|++|+..|+..|+ .|.|+||||+.+.    +..|
T Consensus        92 ~~l~~~~l~~~v~v~~~~~gv~i~l~~~~lF~~Gsa~l~~~~~~~L~~ia~~l~~~~~-~I~V~GHTD~~p~~~~~~~sN  170 (230)
T PRK06925         92 TYIEENELSSQITAKRDERGVVLVLQEAVLFDTGEADVLKNAEPLLHKIAVLLKTIPN-DIQVEGHTDSRPISTYRYPSN  170 (230)
T ss_pred             HHHHHHHCCCCEEEEECCCEEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCC-EEEEEEECCCCCCCCCCCCCH
T ss_conf             9998630246637887698689996898787889653487799999999999973996-389987448765555678853


Q ss_pred             HHHHHHHHHHHHHHHHHH-CCCCCCEEEEEEECCCCCCCCCCCHHHHHCCCCEEEEEECC
Q ss_conf             122589999999988852-38745169999703458889976977985299169999301
Q gi|254780953|r  127 LLISQERADVIKSYLIQR-GVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPR  185 (190)
Q Consensus       127 ~~LS~~RA~~V~~~L~~~-g~~~~r~i~v~g~G~~~p~~~n~~~~~ra~NRRVei~i~~~  185 (190)
                      |+||..||.+|++||+.. |+++.| +.+.|||+++|+++|+|+++|++||||||+|+.+
T Consensus       171 WeLS~aRA~~V~~~li~~~gi~~~r-l~~~Gygd~~P~~~n~t~e~ra~NRRVeI~i~~e  229 (230)
T PRK06925        171 WELSAARASSVIRYFTSKEKLDSSR-FIAVGYADTKPVKDNKTEEHMKENRRVEIVIKKQ  229 (230)
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCHHH-EEEEEECCCCCCCCCCCCCHHHCCCCEEEEEECC
T ss_conf             8999999999999999835998467-8998765787489995832032188679998458


No 8  
>TIGR02802 Pal_lipo peptidoglycan-associated lipoprotein; InterPro: IPR014169   Members in this entry represent the peptidoglycan-associated lipoprotein (Pal or OprL) protein of the Tol-Pal system. The system appears to be involved both in the maintenance of outer membrane integrity and in the import of certain organic molecules as nutrients. Members of this family contain a hydrodrophobic lipoprotein signal sequence, a conserved N-terminal cleavage and modification site, a poorly conserved low-complexity region, together comprising about 65 amino acids, and a well-conserved C-terminal domain. The entry represents only the conserved C-terminal domain..
Probab=100.00  E-value=7.2e-36  Score=220.08  Aligned_cols=102  Identities=28%  Similarity=0.423  Sum_probs=98.1

Q ss_pred             EEC-CCHHHCCHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEEEC
Q ss_conf             112-8813109999999999999998589948999980377872001112258999999998885238745169999703
Q gi|254780953|r   80 VSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFA  158 (190)
Q Consensus        80 ~~f-~~~a~l~~~~~~~L~~ia~~l~~~~~~~i~I~GHTD~~g~~~~N~~LS~~RA~~V~~~L~~~g~~~~r~i~v~g~G  158 (190)
                      +|| ++++.|+++++++|+..|.+|+++|+.+|.|+||||.+|+.+||+.|+++||.+|++||+.+|+.+.| |.+++||
T Consensus         2 vyF~~D~~~l~~e~~~~l~~hA~~L~~~p~~~V~iEGH~DERGTrEYNlALGeRRA~AV~~yL~~~GV~~~q-~~~vSYG   80 (104)
T TIGR02802         2 VYFDFDSSDLKSEAQAILDAHAQYLKKNPSVRVTIEGHTDERGTREYNLALGERRANAVKDYLQAKGVSASQ-IETVSYG   80 (104)
T ss_pred             EECCCCHHHCCHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCC-EEEEECC
T ss_conf             432358143177999999998999986799378886307888887777778899999999999973896110-0463026


Q ss_pred             CCCCCCCCCCHHHHHCCCCEEEEE
Q ss_conf             458889976977985299169999
Q gi|254780953|r  159 YKYPIDTNDTKVGRQNNQRIEIQI  182 (190)
Q Consensus       159 ~~~p~~~n~~~~~ra~NRRVei~i  182 (190)
                      +.+|+++++++++|++||||+|++
T Consensus        81 kErP~~~G~~E~~wakNRR~~~vy  104 (104)
T TIGR02802        81 KERPAALGHDEAAWAKNRRAVLVY  104 (104)
T ss_pred             CCCCCCCCCCHHHHHHCCCCCCCC
T ss_conf             656877898857775405310049


No 9  
>PRK06667 motB flagellar motor protein MotB; Validated
Probab=100.00  E-value=5.1e-34  Score=209.71  Aligned_cols=136  Identities=23%  Similarity=0.352  Sum_probs=117.5

Q ss_pred             HHHHHCCCCCEEEEECCEEEEEECCCEECC-CHHHCC-HHHHHHHHHHHHHHHHCCC--CEEEEEEECCCCC-----CHH
Q ss_conf             999720178358860875899852211128-813109-9999999999999985899--4899998037787-----200
Q gi|254780953|r   54 FQMQLQDTGIVVSRIGDMITCYIPVHVSFV-SEVFLE-KKFLPMLQLIATILNKFPS--TVIAIQSHTDSIG-----TLK  124 (190)
Q Consensus        54 l~~~~~~~~~~~~~~~~~~~~~~~~~~~f~-~~a~l~-~~~~~~L~~ia~~l~~~~~--~~i~I~GHTD~~g-----~~~  124 (190)
                      +...+....+.+....+++.+.+.+..+|+ ++++|+ ++++..|+.|+.++...+.  ..|.|+||||+.+     .+.
T Consensus       103 ~~~~~~~~~v~i~~~~~gl~i~l~~~~lF~~gsa~l~~~~~~~~l~~l~~il~~~~~~~~~I~VeGHTD~~pi~~~~~~~  182 (254)
T PRK06667        103 FKPEIQSNKVAVTEDERGLVISLVSDAFFYPGSADVKLEENRDLIQKLASFIGFLDLAGYNFRIEGHTDNVDVNPEGAWK  182 (254)
T ss_pred             HHHHHHCCCEEEEECCCEEEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCCCCCCCCCC
T ss_conf             88776438748997499799996068561799731264748999999999998456757428999437877668788888


Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCCCCCHHHHHCCCCEEEEEECCHHHC
Q ss_conf             11122589999999988852387451699997034588899769779852991699993010113
Q gi|254780953|r  125 NNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGNIK  189 (190)
Q Consensus       125 ~N~~LS~~RA~~V~~~L~~~g~~~~r~i~v~g~G~~~p~~~n~~~~~ra~NRRVei~i~~~~~~k  189 (190)
                      .||+||..||.+|..||+..|.++++++++.|||+++|+++|+|+++|++||||||+|++.+..+
T Consensus       183 sNWeLSsaRA~~V~~~l~~~g~i~~~rl~v~Gygd~~P~~~n~t~e~ra~NRRVeI~Il~~~~~~  247 (254)
T PRK06667        183 SNWELSGARAVNMLEYILNYEDQSESWFEVSGFGGSRPLATDDTPEGRAYNRRIDIVILTEASLS  247 (254)
T ss_pred             CHHHHHHHHHHHHHHHHHHCCCCCCCEEEEEEECCCCCCCCCCCHHHHHHCCCEEEEEECHHHHH
T ss_conf             62889999999999999981799954599985458876899959668840897699995746664


No 10 
>PRK06742 flagellar motor protein MotS; Reviewed
Probab=100.00  E-value=2.3e-33  Score=206.08  Aligned_cols=135  Identities=21%  Similarity=0.318  Sum_probs=114.6

Q ss_pred             HHHHHHHHHHHHCCC---CCEEEEECCEEEEEECCCEECC-CHHHCCHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCC-
Q ss_conf             788899999972017---8358860875899852211128-81310999999999999999858994899998037787-
Q gi|254780953|r   47 LDKAEDEFQMQLQDT---GIVVSRIGDMITCYIPVHVSFV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIG-  121 (190)
Q Consensus        47 ~~~~~~~l~~~~~~~---~~~~~~~~~~~~~~~~~~~~f~-~~a~l~~~~~~~L~~ia~~l~~~~~~~i~I~GHTD~~g-  121 (190)
                      ++.....+...+.+.   .+.+...++++.+.+.+..+|+ +++.|+|+++..|++++..|+..|+ .|.|+||||+.+ 
T Consensus        81 ~~~l~~~l~~~~~~~~~~~v~~~~~~~gl~I~l~~~~lF~~Gsa~l~p~~~~~L~~la~~l~~~~~-~I~I~GHTD~~pi  159 (225)
T PRK06742         81 MDELYKKLKAYVDNNGISQVNVYREDTGVSVVIVDNLIFDTGDANVKPEAKEIISQLVGFFQSVPN-PIVVEGHTDSRPI  159 (225)
T ss_pred             HHHHHHHHHHHHHHCCCCCEEEEECCCEEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCC-EEEEEEECCCCCC
T ss_conf             999999999999737876438997287389996787776898432396699999999999965997-0899996788766


Q ss_pred             ---CHHHHHHHHHHHHHHHHHHHHH-HCCCCCCEEEEEEECCCCCCCCCCCHHHHHCCCCEEEEEE
Q ss_conf             ---2001112258999999998885-2387451699997034588899769779852991699993
Q gi|254780953|r  122 ---TLKNNLLISQERADVIKSYLIQ-RGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIF  183 (190)
Q Consensus       122 ---~~~~N~~LS~~RA~~V~~~L~~-~g~~~~r~i~v~g~G~~~p~~~n~~~~~ra~NRRVei~i~  183 (190)
                         .+..||+||..||.+|.+||+. .|+++.| +.+.|||+++|+.+|+|+++|++||||||+|-
T Consensus       160 ~~~~~~sNWeLSsaRA~~V~r~l~~~~gi~~~r-l~~~Gygd~~P~~~n~t~e~ra~NRRVeI~i~  224 (225)
T PRK06742        160 HNDKFPSNWELSSARAANMIHHLIEVYNVDDKR-LAAVGYADTKPVVPNDSPQNWEKNRRVVIYIK  224 (225)
T ss_pred             CCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCE-EEEEEECCCCCCCCCCCHHHHHHCCCEEEEEE
T ss_conf             677888649999999999999999836999314-89986557761799949446853796699983


No 11 
>TIGR03350 type_VI_ompA type VI secretion system OmpA/MotB family protein. The flagellar motor protein MotB and the Gram-negative bacterial outer membrane protein OmpA share a region of sequence homology. This model describes a domain found fused to type VI secretion system homologs of the type IV system protein DotU (see model TIGR03349), with OmpA/MotB homology.
Probab=100.00  E-value=3.5e-34  Score=210.63  Aligned_cols=131  Identities=27%  Similarity=0.400  Sum_probs=121.4

Q ss_pred             HHHHHHHHHCCCCCEEEEECCEEEEEECCCEECC-CHHHCCHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCC----HH
Q ss_conf             8999999720178358860875899852211128-813109999999999999998589948999980377872----00
Q gi|254780953|r   50 AEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGT----LK  124 (190)
Q Consensus        50 ~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~f~-~~a~l~~~~~~~L~~ia~~l~~~~~~~i~I~GHTD~~g~----~~  124 (190)
                      ++..+.+.+....+.++..++.+.++++++++|. +++.|+|+++..|++++..|+.+|. .|.|+||||+.|.    +.
T Consensus         2 ~~~~l~~~i~~g~v~V~~~~~~v~l~l~~~~lF~~gsa~L~~~~~~~L~~va~~L~~~~~-~I~I~GHTD~~~~~~~~~~   80 (137)
T TIGR03350         2 LRALLAPEIAAGLLTVDEDGDRSVVRLRGDELFASGSAEVRADFEPLLDRIAKALAAVPG-RITVVGHTDNVPIRTSRFP   80 (137)
T ss_pred             HHHHHHHHHHCCCEEEEEECCEEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCC-EEEEEEECCCCCCCCCCCC
T ss_conf             689999999769649999799999995798718899632098799999999999970998-5999998389877787751


Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCCCCCHHHHHCCCCEEEEE
Q ss_conf             1112258999999998885238745169999703458889976977985299169999
Q gi|254780953|r  125 NNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI  182 (190)
Q Consensus       125 ~N~~LS~~RA~~V~~~L~~~g~~~~r~i~v~g~G~~~p~~~n~~~~~ra~NRRVei~i  182 (190)
                      .||+||.+||.+|++||+..|+++.| +.+.|||+++|+++|+++++|++||||||+|
T Consensus        81 ~N~~LS~~RA~aV~~~L~~~Gi~~~r-l~~~g~G~~~P~~~n~~~~~r~~NRRVEI~i  137 (137)
T TIGR03350        81 SNWHLSEARAKAVADVLAQGGVPAGR-VRAEGRGDSEPIASNATAAGRAQNRRVEIDV  137 (137)
T ss_pred             HHHHHHHHHHHHHHHHHHHCCCCHHE-EEEEECCCCCCCCCCCCHHHHHHCCEEEEEC
T ss_conf             04679999999999999972997240-8997012778679993977997549089979


No 12 
>PRK08944 motB flagellar motor protein MotB; Reviewed
Probab=100.00  E-value=5.6e-34  Score=209.50  Aligned_cols=133  Identities=29%  Similarity=0.495  Sum_probs=117.4

Q ss_pred             HHHHHHHHCCCCCEEEEECCEEEEEECCCEECC-CHHHCCHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCC----HHH
Q ss_conf             999999720178358860875899852211128-813109999999999999998589948999980377872----001
Q gi|254780953|r   51 EDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGT----LKN  125 (190)
Q Consensus        51 ~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~f~-~~a~l~~~~~~~L~~ia~~l~~~~~~~i~I~GHTD~~g~----~~~  125 (190)
                      ...+...+....+.+...++++.+.+.+..+|+ +++.|++.++..|+.|+..|+..|+ .|.|+||||+.+.    +..
T Consensus       155 ~~~l~~~i~~~~v~v~~~~~~i~I~l~d~~lF~~GSa~l~p~~~~lL~~ia~~l~~~~n-~I~I~GHTD~~p~~~~~~~s  233 (305)
T PRK08944        155 AQQLEKEIEDGAIEIESLGQQIIIRIREKGSFPSGSAFLQPKFKPLVRKIGELLKDVPG-IITVSGHTDNMPISSELYRS  233 (305)
T ss_pred             HHHHHHHHHCCCEEEEECCCEEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCC-EEEEEEECCCCCCCCCCCCC
T ss_conf             99999753137637997388799995687675788642487689999999999973896-27997415777665556787


Q ss_pred             HHHHHHHHHHHHHHHHHHH-CCCCCCEEEEEEECCCCCCCCCCCHHHHHCCCCEEEEEECC
Q ss_conf             1122589999999988852-38745169999703458889976977985299169999301
Q gi|254780953|r  126 NLLISQERADVIKSYLIQR-GVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPR  185 (190)
Q Consensus       126 N~~LS~~RA~~V~~~L~~~-g~~~~r~i~v~g~G~~~p~~~n~~~~~ra~NRRVei~i~~~  185 (190)
                      ||+||..||.+|++||+.. |+++.| ++++|||+++|+++|+++++|++||||||+|+.+
T Consensus       234 NWeLSaaRA~~v~r~L~~~~gi~~~r-l~v~G~ad~~Pl~~n~t~e~ra~NRRVeI~il~~  293 (305)
T PRK08944        234 NWDLSSARAVAVAHELLKVKGFDPSR-LKVVGMADTQPLVPNDSPENRARNRRVEISIEQG  293 (305)
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCCCCE-EEEEEECCCCCCCCCCCHHHHHCCCCEEEEEECC
T ss_conf             48999999999999999806989434-8999865787489997801341188779999379


No 13 
>PRK08126 hypothetical protein; Provisional
Probab=100.00  E-value=1.7e-33  Score=206.80  Aligned_cols=133  Identities=22%  Similarity=0.349  Sum_probs=123.1

Q ss_pred             HHHHHHHHHHCCCCCEEEEECCEEEEEECCCEECC-CHHHCCHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCC----CH
Q ss_conf             88999999720178358860875899852211128-81310999999999999999858994899998037787----20
Q gi|254780953|r   49 KAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIG----TL  123 (190)
Q Consensus        49 ~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~f~-~~a~l~~~~~~~L~~ia~~l~~~~~~~i~I~GHTD~~g----~~  123 (190)
                      .+...+..++....+.+....+..++.+...-+|+ +++.|+|++.+.|++|+..|+..|+ .|.|.||||+.+    .+
T Consensus       290 rL~~~L~~EI~~glv~V~~~~~~~~V~l~~~~lF~sGsA~l~p~~~pll~rIa~~l~~~~G-~I~V~GHTDn~Pi~s~~f  368 (428)
T PRK08126        290 RLKILLKNEIAAGTLSVDEDARHSSVTFRGDAMFAPGGATVNPAMGPLINKIAREIARVPG-KVTVTGHTDNQPIRSAQF  368 (428)
T ss_pred             HHHHHHHHHHHCCCEEEEECCCEEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCC-EEEEEEECCCCCCCCCCC
T ss_conf             4889868899668648896398479997688887877611064479999999999837998-189988589988878887


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCCCCCHHHHHCCCCEEEEEE
Q ss_conf             011122589999999988852387451699997034588899769779852991699993
Q gi|254780953|r  124 KNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIF  183 (190)
Q Consensus       124 ~~N~~LS~~RA~~V~~~L~~~g~~~~r~i~v~g~G~~~p~~~n~~~~~ra~NRRVei~i~  183 (190)
                      .+||+||..||.+|+.+|...|+++.| +.+.|||+++|+++|+|++||++||||||+|.
T Consensus       369 ~SNw~LS~aRA~~V~~~L~~~~~~~~R-~~a~G~gd~~Pia~N~T~~gRa~NRRVEI~l~  427 (428)
T PRK08126        369 ASNLVLSEERATQVAQMLQSAGVPASR-LEAVGKGDADPVGDNRTPQGRAQNRRVEITVA  427 (428)
T ss_pred             CCHHHHHHHHHHHHHHHHHHCCCCCCE-EEEEEECCCCCCCCCCCHHHHHHCCCEEEEEE
T ss_conf             974999999999999999855999763-68872178899999989556753582478950


No 14 
>PRK07033 hypothetical protein; Provisional
Probab=100.00  E-value=2.8e-33  Score=205.59  Aligned_cols=135  Identities=20%  Similarity=0.308  Sum_probs=124.8

Q ss_pred             HHHHHHHHHHHCCCCCEEEEECCEEEEEECCCEECC-CHHHCCHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCC----
Q ss_conf             888999999720178358860875899852211128-813109999999999999998589948999980377872----
Q gi|254780953|r   48 DKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGT----  122 (190)
Q Consensus        48 ~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~f~-~~a~l~~~~~~~L~~ia~~l~~~~~~~i~I~GHTD~~g~----  122 (190)
                      ..+...+..++....+.++...+..++.+...-+|+ +++.|++++.+.|++|+..|+..|+ .|.|+||||+.+.    
T Consensus       286 ~~L~~~L~~EI~~G~v~V~~~~~~~~v~l~~~~lF~sGsa~l~~~~~~ll~~ia~~l~~~~g-~i~V~GHTDn~Pi~s~~  364 (429)
T PRK07033        286 PRLAKFLEPEIAAGLVAVRDEADRSVVTLRGDGLFASASTSVRDRYQPVLLRVADALNQVKG-NVLVTGYSDNRPIRTAR  364 (429)
T ss_pred             CCHHHHHHHHHHCCCEEEEECCCEEEEEECCCCCCCCCCHHHCHHHHHHHHHHHHHHHCCCC-EEEEEEECCCCCCCCCC
T ss_conf             30999989999748758997598269997888887886610086689999999999847998-08998838998887788


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCCCCCHHHHHCCCCEEEEEEC
Q ss_conf             00111225899999999888523874516999970345888997697798529916999930
Q gi|254780953|r  123 LKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP  184 (190)
Q Consensus       123 ~~~N~~LS~~RA~~V~~~L~~~g~~~~r~i~v~g~G~~~p~~~n~~~~~ra~NRRVei~i~~  184 (190)
                      +.+||+||..||.+|+.+|...++.++| +++.|||+++|+++|+|++||++||||||+|+.
T Consensus       365 f~SNw~LS~aRA~~V~~~l~~~~~~~~R-~~a~G~gd~~Pia~N~t~~gRa~NRRVEI~ll~  425 (429)
T PRK07033        365 FPSNWHLSQARAQAVRALLAARLGDPER-VTAEGRGDSDPVAPNDSPEGRARNRRVEITLMV  425 (429)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHCCCCCCE-EEEEEECCCCCCCCCCCHHHHHHCCCEEEEEEC
T ss_conf             8975999999999999999864999773-799763788888989882347546817999963


No 15 
>PRK08457 motB flagellar motor protein MotB; Reviewed
Probab=100.00  E-value=4.6e-33  Score=204.37  Aligned_cols=126  Identities=25%  Similarity=0.368  Sum_probs=108.3

Q ss_pred             CCCCEEEEECCEEEEEECCCEECC-CHHHCC-HHHHHHHHHHHHHHHHCCC-CEEEEEEECCCCCC----HHHHHHHHHH
Q ss_conf             178358860875899852211128-813109-9999999999999985899-48999980377872----0011122589
Q gi|254780953|r   60 DTGIVVSRIGDMITCYIPVHVSFV-SEVFLE-KKFLPMLQLIATILNKFPS-TVIAIQSHTDSIGT----LKNNLLISQE  132 (190)
Q Consensus        60 ~~~~~~~~~~~~~~~~~~~~~~f~-~~a~l~-~~~~~~L~~ia~~l~~~~~-~~i~I~GHTD~~g~----~~~N~~LS~~  132 (190)
                      ...+.+....+++.+.+++.++|+ +++.|. +..+..|+.++.+|+..|+ ..|.|+||||+.+.    +..||+||..
T Consensus       101 ~~~~~i~~~~~gi~i~l~~~~lF~~GsA~l~~~~~~~~L~~ia~il~~lp~~~~I~V~GHTD~~Pi~~~~f~SNWELSaa  180 (251)
T PRK08457        101 REGAALDQSDNGVALKLPSNLLFENGSAEIINQDMMLYLKRIAKIIQKLPKRVKIEVRGYTDNSPLNKTRYKSSYELAAN  180 (251)
T ss_pred             HHHHHHHCCCCCEEEEECCCCCCCCCCCEECCCCHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCCCCCCCCHHHHHHH
T ss_conf             53024540367269980687545798801168039999999999998489974599871589997777888873999999


Q ss_pred             HHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCCCCCHHHHHCCCCEEEEEECCHHHC
Q ss_conf             999999988852387451699997034588899769779852991699993010113
Q gi|254780953|r  133 RADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGNIK  189 (190)
Q Consensus       133 RA~~V~~~L~~~g~~~~r~i~v~g~G~~~p~~~n~~~~~ra~NRRVei~i~~~~~~k  189 (190)
                      ||.+|.+||+..|+++.| +++.|||+++|+++|   ++|++||||||+|...++.+
T Consensus       181 RA~~V~r~Li~~Gi~p~R-l~a~Gygd~~Pi~~N---e~ra~NRRVeI~i~~~~~d~  233 (251)
T PRK08457        181 RAYNVMKVLIQYGINPNR-LSFSSYGSNNPIAPN---ENRLKNNRVEIFFKVDANDT  233 (251)
T ss_pred             HHHHHHHHHHHCCCCHHH-EEEEEECCCCCCCCC---CCHHHCCCEEEEEECCCCCC
T ss_conf             999999999985998789-789853278879899---76556395799994288755


No 16 
>PRK09040 hypothetical protein; Provisional
Probab=100.00  E-value=1.8e-33  Score=206.62  Aligned_cols=133  Identities=23%  Similarity=0.324  Sum_probs=108.1

Q ss_pred             HHHHHHHHHCCCCCEEEEECCEEEEEECCCEECC-CHHHCCHHHHHHHHHHHHHHHHCCC---CEEEEEEECCCCCC---
Q ss_conf             8999999720178358860875899852211128-8131099999999999999985899---48999980377872---
Q gi|254780953|r   50 AEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV-SEVFLEKKFLPMLQLIATILNKFPS---TVIAIQSHTDSIGT---  122 (190)
Q Consensus        50 ~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~f~-~~a~l~~~~~~~L~~ia~~l~~~~~---~~i~I~GHTD~~g~---  122 (190)
                      +++.+...+....+.+  ..  ..+.++..++|. +++.|.|++++.|++++..|+.++.   ..|.|+||||+.+.   
T Consensus        65 l~~~L~~~~a~~~vt~--~~--~~i~i~~~vlF~~gsa~L~p~~~~~L~~ia~~L~~~~~~~~~~i~V~GhTD~~pi~~~  140 (215)
T PRK09040         65 LEQALAGPLAAGRVTL--VN--GRIGISGSVLFALNSDQLQPEGRELLKSLAGPLAAYLRARDEILMVSGFTDDQPVRAG  140 (215)
T ss_pred             HHHHHCCHHHCCEEEE--EC--CEEECCCCEEECCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCCCC
T ss_conf             9987415112363653--02--6796056436768964008326999999999999874479865998734899767677


Q ss_pred             ---HHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCCCCCHHHHHCCCCEEEEEECCHH
Q ss_conf             ---00111225899999999888523874516999970345888997697798529916999930101
Q gi|254780953|r  123 ---LKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGN  187 (190)
Q Consensus       123 ---~~~N~~LS~~RA~~V~~~L~~~g~~~~r~i~v~g~G~~~p~~~n~~~~~ra~NRRVei~i~~~~~  187 (190)
                         +.+||+||.+||.+|++||+..|+++.| +.+.|||+++|+++|+|++||++||||||.++||..
T Consensus       141 ~~~f~sNw~LS~~RA~~V~~~L~~~gv~~~r-l~~~g~G~~~P~~~n~t~~~ra~NRRVeI~~~p~~~  207 (215)
T PRK09040        141 NRRFADNWELSAQRALTVTRALIDAGVPASS-VFAAAFGSEQPVSSNADEEGRAKNRRVEIAPVPRPS  207 (215)
T ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHCCCCHHH-EEEEEECCCCCCCCCCCHHHHHHCCCEEEEEECCCC
T ss_conf             8888978999999999999999986999789-589886576878999498899876987899843898


No 17 
>COG1360 MotB Flagellar motor protein [Cell motility and secretion]
Probab=99.98  E-value=1.9e-31  Score=195.39  Aligned_cols=134  Identities=27%  Similarity=0.412  Sum_probs=119.2

Q ss_pred             HHHHHHHCCCCCEEEEECCEEEEEECCCEECC-CHHHCCHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCC---CHHHHH
Q ss_conf             99999720178358860875899852211128-81310999999999999999858994899998037787---200111
Q gi|254780953|r   52 DEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIG---TLKNNL  127 (190)
Q Consensus        52 ~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~f~-~~a~l~~~~~~~L~~ia~~l~~~~~~~i~I~GHTD~~g---~~~~N~  127 (190)
                      ..+........+.+....+++++.+.+..+|+ +++.+.++++..|.+++..|...++..|.|+||||+.+   .+..||
T Consensus       106 ~~~~~~~~~~~~~v~~~~~gl~i~i~~~~~F~~gsa~~~~~~~~~l~~ia~~l~~~~~~~I~I~GHTDn~p~~~~~~sNW  185 (244)
T COG1360         106 SKPKDIELEHQLGVDDVEEGLVISISDSLMFASGSAVVQPEFRDLLLKIAKLLADIPNGNIRIEGHTDNVPIKGSFYSNW  185 (244)
T ss_pred             HHHHHHHHHCCCEEEECCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCCHH
T ss_conf             89888775346558874886289962444646775212766799999999998726798289986589976677888508


Q ss_pred             HHHHHHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCCCCCHHHHHCCCCEEEEEECC
Q ss_conf             2258999999998885238745169999703458889976977985299169999301
Q gi|254780953|r  128 LISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPR  185 (190)
Q Consensus       128 ~LS~~RA~~V~~~L~~~g~~~~r~i~v~g~G~~~p~~~n~~~~~ra~NRRVei~i~~~  185 (190)
                      +||.+||.+|.++|+..|..+.+++++.|||+++|+++|+|+++|++||||||.|+.+
T Consensus       186 eLS~aRA~~v~~~L~~~g~~~~~~~~~~G~gd~~Pva~n~t~~~ra~NRRVeI~i~~~  243 (244)
T COG1360         186 ELSAARAQSVVRVLINGGLVEAKRLSVVGYADTRPLADNDTAEGRAKNRRVEILILTK  243 (244)
T ss_pred             HHHHHHHHHHHHHHHHCCCCCCCEEEEEECCCCCCCCCCCCHHHHHHCCEEEEEEECC
T ss_conf             8899999999999997489985668997125477678898813476578379998358


No 18 
>PRK10808 outer membrane protein A; Reviewed
Probab=99.97  E-value=2.5e-31  Score=194.68  Aligned_cols=113  Identities=23%  Similarity=0.382  Sum_probs=100.5

Q ss_pred             EECCCEEC-CCHHHCCHHHHHHHHHHHHHHHHC--CCCEEEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCE
Q ss_conf             85221112-881310999999999999999858--994899998037787200111225899999999888523874516
Q gi|254780953|r   75 YIPVHVSF-VSEVFLEKKFLPMLQLIATILNKF--PSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRF  151 (190)
Q Consensus        75 ~~~~~~~f-~~~a~l~~~~~~~L~~ia~~l~~~--~~~~i~I~GHTD~~g~~~~N~~LS~~RA~~V~~~L~~~g~~~~r~  151 (190)
                      .+..+++| ++++.|+|+++..|+.++..|++.  ++..|.|.||||+.|+++||+.||++||++|++||+.+|+.+.| 
T Consensus       221 tl~s~v~F~fdss~l~p~~~~~L~~~~~~l~~~~~~~~~i~v~GhtD~~G~~~yN~~LS~~RA~~V~~~l~~~Gi~~~~-  299 (347)
T PRK10808        221 TLKSDVLFNFNKATLKPEGQQALDQLYSQLSNLDPKDGSVVVLGYTDRIGSDAYNQALSERRAQSVVDYLISKGIPADK-  299 (347)
T ss_pred             CCCCCEEECCCCCCCCHHHHHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCHHH-
T ss_conf             1244225515702058668999999999997458776518999836998887887999999999999999986998451-


Q ss_pred             EEEEEECCCCCCCCCCCHHHH---------HCCCCEEEEEECCHHH
Q ss_conf             999970345888997697798---------5299169999301011
Q gi|254780953|r  152 ISVRGFAYKYPIDTNDTKVGR---------QNNQRIEIQIFPRGNI  188 (190)
Q Consensus       152 i~v~g~G~~~p~~~n~~~~~r---------a~NRRVei~i~~~~~~  188 (190)
                      |++.||||++|+++|.++++|         +.||||||.|....++
T Consensus       300 i~~~g~Ge~~pva~n~~~~~~~~~~li~c~a~nRRVei~v~g~~~~  345 (347)
T PRK10808        300 ISARGMGESNPVTGNTCDNVKPRAALIDCLAPDRRVEIEVKGIKDV  345 (347)
T ss_pred             EEEEEECCCCCCCCCCCCCCCCCCCHHHCCCCCCCEEEEEEEEEEE
T ss_conf             8999864668888897702244300010247887389999879874


No 19 
>PRK09039 hypothetical protein; Validated
Probab=99.97  E-value=6.5e-31  Score=192.36  Aligned_cols=122  Identities=30%  Similarity=0.452  Sum_probs=104.2

Q ss_pred             CCCEEEEECCEEEEEECCCEECC-CHHHCCHHHHHHHHHHHHHHHH----CC---CCEEEEEEECCCC-----CCHHHHH
Q ss_conf             78358860875899852211128-8131099999999999999985----89---9489999803778-----7200111
Q gi|254780953|r   61 TGIVVSRIGDMITCYIPVHVSFV-SEVFLEKKFLPMLQLIATILNK----FP---STVIAIQSHTDSI-----GTLKNNL  127 (190)
Q Consensus        61 ~~~~~~~~~~~~~~~~~~~~~f~-~~a~l~~~~~~~L~~ia~~l~~----~~---~~~i~I~GHTD~~-----g~~~~N~  127 (190)
                      +...+...++..  .++..++|+ ++++|.|+++..|.+++..+..    .|   ++.|+|+||||+.     |.+.+||
T Consensus       209 ~~~~I~i~gdrf--vf~SevLF~~gsa~l~~~gk~~l~~ia~~l~~i~~~Ip~~i~wilrVeGHTD~~pi~~~~~f~sNw  286 (343)
T PRK09039        209 DREGIRIVGDRF--VFQSEVLFPTGSAELNPEGQAEIAKLAAALIQLAKEIPPEINWVLRVDGHTDNVPLSGTGRFRDNW  286 (343)
T ss_pred             CCCCCCCCCCEE--EECCCCCCCCCCCHHCHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCCCCCCCCCCHH
T ss_conf             887741025547--740332316884010665899999999999998763750146137750457787888899999759


Q ss_pred             HHHHHHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCCCCCHHHHHCCCCEEEEEECC
Q ss_conf             2258999999998885238745169999703458889976977985299169999301
Q gi|254780953|r  128 LISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPR  185 (190)
Q Consensus       128 ~LS~~RA~~V~~~L~~~g~~~~r~i~v~g~G~~~p~~~n~~~~~ra~NRRVei~i~~~  185 (190)
                      +||..||.+|..||+..|+++.| +.+.|||+++|+.+|+++++|++||||||.+++|
T Consensus       287 eLS~~RA~sV~~~L~~~gv~~~r-l~a~G~g~~~Pl~~~~t~e~ra~NRRIEiklt~r  343 (343)
T PRK09039        287 ELSSARAISVVKYLIALGVPANR-LVAAGFGEYQPLDPGDTPEARARNRRIELKLTER  343 (343)
T ss_pred             HHHHHHHHHHHHHHHHCCCCHHH-EEEECCCCCCCCCCCCCHHHHHHCCCEEEEECCC
T ss_conf             99999999999999976998889-3652046678899995965797379557982789


No 20 
>PRK09041 motB flagellar motor protein MotB; Validated
Probab=99.97  E-value=4.4e-29  Score=182.16  Aligned_cols=124  Identities=23%  Similarity=0.322  Sum_probs=108.5

Q ss_pred             CCCEEEEECCEEEEEECCCE---ECC-CHHHCCHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCC-----HHHHHHHHH
Q ss_conf             78358860875899852211---128-813109999999999999998589948999980377872-----001112258
Q gi|254780953|r   61 TGIVVSRIGDMITCYIPVHV---SFV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGT-----LKNNLLISQ  131 (190)
Q Consensus        61 ~~~~~~~~~~~~~~~~~~~~---~f~-~~a~l~~~~~~~L~~ia~~l~~~~~~~i~I~GHTD~~g~-----~~~N~~LS~  131 (190)
                      ..+.++...+++.+.+-+..   +|+ +++.++|.++..|+.|+..|+..|+ .|.|+||||+.+-     +-.||+||.
T Consensus       146 ~~v~v~~t~~GL~I~I~D~~~~~mF~sGSA~l~p~~~~lL~~Ia~vL~~~~n-~I~I~GHTD~~P~~~~~~~~SNWeLSa  224 (317)
T PRK09041        146 PQLLIDLTQEGLRIQIVDSQNRPMFATGSAEVEPYMRDILREIAPVLNDVPN-RISLSGHTDATPYAGGEKGYSNWELSA  224 (317)
T ss_pred             CCEEEEEECCCEEEEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCC-CEEEEEECCCCCCCCCCCCCCCHHHHH
T ss_conf             1447998069459999866778676788664588899999999999972578-569987558777567888899515589


Q ss_pred             HHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCCCCCHHHHHCCCCEEEEEECCHH
Q ss_conf             99999999888523874516999970345888997697798529916999930101
Q gi|254780953|r  132 ERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGN  187 (190)
Q Consensus       132 ~RA~~V~~~L~~~g~~~~r~i~v~g~G~~~p~~~n~~~~~ra~NRRVei~i~~~~~  187 (190)
                      .||.+|+.+|+..|+.++|+.+|+||++++|+.++++..  +.||||||+|+.+.-
T Consensus       225 aRA~aarr~L~~~Gl~~~Ri~~V~G~AD~~Pl~~~dP~~--a~NRRI~I~vLt~~a  278 (317)
T PRK09041        225 DRANASRRELVAGGMDEGKVLRVVGLASTMLLDKKDPLN--PVNRRISIVVLNKKA  278 (317)
T ss_pred             HHHHHHHHHHHHCCCCHHHEEEEEEECCCCCCCCCCCCC--CCCCCEEEEEECHHH
T ss_conf             999999999998499976878999835677589999876--546857999978599


No 21 
>cd07185 OmpA_C-like Peptidoglycan binding domains similar to the C-terminal domain of outer-membrane protein OmpA. OmpA-like domains (named after the C-terminal domain of Escherichia coli OmpA protein) have been shown to non-covalently associate with peptidoglycan, a network of glycan chains composed of disaccharides, which are crosslinked via short peptide bridges. Well-studied members of this family include the Escherichia coli outer membrane protein OmpA, the Escherichia coli lipoprotein PAL, Neisseria meningitdis RmpM, which interact with the outer membrane, as well as the Escherichia coli motor protein MotB, and the Vibrio flagellar motor proteins PomB and MotY, which interact with the inner membrane.
Probab=99.96  E-value=1.3e-29  Score=185.01  Aligned_cols=103  Identities=37%  Similarity=0.597  Sum_probs=97.5

Q ss_pred             CEECC-CHHHCCHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEEE
Q ss_conf             11128-81310999999999999999858994899998037787200111225899999999888523874516999970
Q gi|254780953|r   79 HVSFV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGF  157 (190)
Q Consensus        79 ~~~f~-~~a~l~~~~~~~L~~ia~~l~~~~~~~i~I~GHTD~~g~~~~N~~LS~~RA~~V~~~L~~~g~~~~r~i~v~g~  157 (190)
                      .++|+ +++.|+++++..|+.++.+|+.+|...|.|.||||+.|+.+|||.||++||++|+.||+..|+.++| |.+.||
T Consensus         3 ~v~F~~~s~~l~~~~~~~L~~ia~~l~~~~~~~v~v~GhtD~~G~~~~N~~LS~~RA~~V~~~L~~~Gi~~~r-i~~~g~   81 (106)
T cd07185           3 TIYFDFGSAELTPEAKPLLDKLAEVLKKNPDAKIRIEGHTDSRGSDAYNQELSERRAEAVADYLVSKGVDASR-ITAVGY   81 (106)
T ss_pred             EEEECCCCCEECHHHHHHHHHHHHHHHHCCCCEEEEEEEECCCCCHHHHHHHHHHHHHHHHHHHHHCCCCHHH-EEEEEE
T ss_conf             9996899776198899999999999985899379999984899998998999999999999999984999899-899997


Q ss_pred             CCCCCCCCCCCHHHHHCCCCEEEEE
Q ss_conf             3458889976977985299169999
Q gi|254780953|r  158 AYKYPIDTNDTKVGRQNNQRIEIQI  182 (190)
Q Consensus       158 G~~~p~~~n~~~~~ra~NRRVei~i  182 (190)
                      |+++|+.+|+++++|++||||||++
T Consensus        82 G~~~p~~~~~~~~~~~~NRRVei~~  106 (106)
T cd07185          82 GESRPIASNDTEEGRAKNRRVEIVI  106 (106)
T ss_pred             CCCCCCCCCCCHHHHHHCCCEEEEC
T ss_conf             5557689990988998559889969


No 22 
>PRK06778 hypothetical protein; Validated
Probab=99.96  E-value=1.1e-28  Score=180.02  Aligned_cols=124  Identities=20%  Similarity=0.319  Sum_probs=108.4

Q ss_pred             CCCCEEEEECCEEEEEECCC---EECC-CHHHCCHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCH---HHHHHHHHH
Q ss_conf             17835886087589985221---1128-8131099999999999999985899489999803778720---011122589
Q gi|254780953|r   60 DTGIVVSRIGDMITCYIPVH---VSFV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTL---KNNLLISQE  132 (190)
Q Consensus        60 ~~~~~~~~~~~~~~~~~~~~---~~f~-~~a~l~~~~~~~L~~ia~~l~~~~~~~i~I~GHTD~~g~~---~~N~~LS~~  132 (190)
                      ...+.++.+.+++.+.+.+.   .+|+ +++.++|.+++.|+.|+..|+..|+ .|.|+||||+.+..   -.||+||..
T Consensus       131 ~~~v~~~it~~GL~I~i~D~~~~~mF~~GSa~l~p~~~~lL~~ia~vL~~~~n-~I~I~GHTD~~Pi~~~~ySNWELSa~  209 (289)
T PRK06778        131 EANLEMEIVPQGLRVLIKDDQNRNMFERGSAQIMPFFKRLLVELAPVFDSLDN-KIIITGHTDAMAYKNNIYNNWNLSGD  209 (289)
T ss_pred             HHCEEEEECCCCEEEEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCC-EEEEEEECCCCCCCCCCCCCHHHHHH
T ss_conf             42704898489408999837888782889875687899999999999862895-38997405777777888996066899


Q ss_pred             HHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCCCCCHHHHHCCCCEEEEEECCH
Q ss_conf             999999988852387451699997034588899769779852991699993010
Q gi|254780953|r  133 RADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRG  186 (190)
Q Consensus       133 RA~~V~~~L~~~g~~~~r~i~v~g~G~~~p~~~n~~~~~ra~NRRVei~i~~~~  186 (190)
                      ||.+|+.+|+..|++++|+.+|.||+++.|+.++++..  +.||||||+|+.+.
T Consensus       210 RA~avrr~L~~~Gl~~~ri~~V~G~Ad~~p~~~~dP~~--~~NRRI~I~vL~~~  261 (289)
T PRK06778        210 RALSARRVLEEAGMPEDKVMQVSAMADQMLLDAKNPQS--AGNRRIEIMVLTKS  261 (289)
T ss_pred             HHHHHHHHHHHCCCCHHHEEEEEEECCCCCCCCCCCCC--CCCCCEEEEEECHH
T ss_conf             99999999998599976888999845777789999876--54685799997869


No 23 
>PRK05996 motB flagellar motor protein MotB; Validated
Probab=99.92  E-value=7.1e-24  Score=153.03  Aligned_cols=122  Identities=25%  Similarity=0.402  Sum_probs=106.3

Q ss_pred             CCCEEEEECCEEEEEECCCE---ECC-CHHHCCHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCC--HH-HHHHHHHHH
Q ss_conf             78358860875899852211---128-813109999999999999998589948999980377872--00-111225899
Q gi|254780953|r   61 TGIVVSRIGDMITCYIPVHV---SFV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGT--LK-NNLLISQER  133 (190)
Q Consensus        61 ~~~~~~~~~~~~~~~~~~~~---~f~-~~a~l~~~~~~~L~~ia~~l~~~~~~~i~I~GHTD~~g~--~~-~N~~LS~~R  133 (190)
                      ..+.+..+.+++.|.+-+.-   .|. +|+.++|..+..|..|+.+|...|+ .|.|.||||+.+-  .. .||+||..|
T Consensus       302 ~~v~v~~t~eGLrIqI~D~~~~~MF~~GSA~p~p~~~~lL~~Ia~vL~~~pn-~I~I~GHTDa~Pf~~~~y~NWeLSa~R  380 (431)
T PRK05996        302 PGVTVTPVEGGLLISLTDQVDYGMFAIGSAVPRAELVLAMEKIGQLLAEQPG-AVIIRGHTDARPFKSATYDNWRLSTAR  380 (431)
T ss_pred             CCEEEEECCCEEEEEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCC-CEEEEEECCCCCCCCCCCCCCCCCHHH
T ss_conf             6528986599279999858999884779775688999999999999963898-179987568877778899842111899


Q ss_pred             HHHHHHHHHHHCCCCCCEEEEEEECCCCCCCCCCCHHHHHCCCCEEEEEECC
Q ss_conf             9999998885238745169999703458889976977985299169999301
Q gi|254780953|r  134 ADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPR  185 (190)
Q Consensus       134 A~~V~~~L~~~g~~~~r~i~v~g~G~~~p~~~n~~~~~ra~NRRVei~i~~~  185 (190)
                      |.+.+..|+..|+.+.|+.+|+||++++|..++++..  +.||||||.|-.+
T Consensus       381 A~aARr~L~~gGl~~~RI~rV~G~ADr~p~~~~dP~a--~~NRRIeILlr~~  430 (431)
T PRK05996        381 AQMAYYMLVRGGLDEKRILRVEGYADRRPKLPNDPNA--AANRRIEILIQAK  430 (431)
T ss_pred             HHHHHHHHHHCCCCHHHEEEEEEECCCCCCCCCCCCC--CCCCEEEEEEECC
T ss_conf             9999999998599854666788713567688899988--6457489997058


No 24 
>PRK12799 motB flagellar motor protein MotB; Reviewed
Probab=99.91  E-value=4.6e-23  Score=148.51  Aligned_cols=124  Identities=21%  Similarity=0.348  Sum_probs=106.6

Q ss_pred             CCCEEEEECCEEEEEECCC---EECC-CHHHCCHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCH----H-HHHHHHH
Q ss_conf             7835886087589985221---1128-8131099999999999999985899489999803778720----0-1112258
Q gi|254780953|r   61 TGIVVSRIGDMITCYIPVH---VSFV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTL----K-NNLLISQ  131 (190)
Q Consensus        61 ~~~~~~~~~~~~~~~~~~~---~~f~-~~a~l~~~~~~~L~~ia~~l~~~~~~~i~I~GHTD~~g~~----~-~N~~LS~  131 (190)
                      +.+.++...+++++.+-+.   .+|+ +++.++|.++..|..|+..|+..|+ +|.|.||||+.+-.    . .||+||.
T Consensus       136 ~qLlIdiTpEGLRIQIvD~qnRPMF~~GSA~l~Py~rdIL~aIApvLn~vPN-kIsISGHTDA~PYa~G~~gYSNWELSA  214 (424)
T PRK12799        136 PHLLINMMDEGLRIQIIDSQNRPMFKMGSAQVEPYMRDILRAIAPILNDIPN-KLSLSGHTDDLPYARGERGYSNWELSA  214 (424)
T ss_pred             CCEEEEEECCCEEEEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCC-CEEEEECCCCCCCCCCCCCCCCCHHHH
T ss_conf             1746997089358999857999760127775788999999999999865898-348863168855568998876562236


Q ss_pred             HHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCCCCCHHHHHCCCCEEEEEECCHH
Q ss_conf             99999999888523874516999970345888997697798529916999930101
Q gi|254780953|r  132 ERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGN  187 (190)
Q Consensus       132 ~RA~~V~~~L~~~g~~~~r~i~v~g~G~~~p~~~n~~~~~ra~NRRVei~i~~~~~  187 (190)
                      .||.+.++.|+..|+..+++++|+|++++.|...++...  ..|||+.|+|+.|..
T Consensus       215 DRANAARReLvaGGm~e~KvlRVvGmAst~~ld~~~p~~--PvNRRISIiVLnK~~  268 (424)
T PRK12799        215 DRANASRRELLAGGLDEGKILRVVGMASTMRLKEQASDD--PVNRRISILVLNKQS  268 (424)
T ss_pred             HHHHHHHHHHHHCCCCCCCEEEEEECCCCCCCCCCCCCC--CCCCEEEEEEECHHH
T ss_conf             668799999997689811367898512134146679998--543657899966688


No 25 
>pfam00691 OmpA OmpA family. The Pfam entry also includes MotB and related proteins which are not included in the Prosite family.
Probab=99.91  E-value=4.8e-24  Score=153.97  Aligned_cols=95  Identities=33%  Similarity=0.506  Sum_probs=88.2

Q ss_pred             EC-CCHHHCCHHHHHHHHHHHHHHHHC-CCCEEEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEEEC
Q ss_conf             12-881310999999999999999858-9948999980377872001112258999999998885238745169999703
Q gi|254780953|r   81 SF-VSEVFLEKKFLPMLQLIATILNKF-PSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFA  158 (190)
Q Consensus        81 ~f-~~~a~l~~~~~~~L~~ia~~l~~~-~~~~i~I~GHTD~~g~~~~N~~LS~~RA~~V~~~L~~~g~~~~r~i~v~g~G  158 (190)
                      || ++++.|+++++..|++++..|+.. +...|.|+||||..|+..+||.||.+||.+|+.||+..|+.+.| |.+.|||
T Consensus         1 ~F~~~s~~L~~~~~~~L~~~a~~l~~~~~~~~v~I~GhtD~~g~~~~N~~LS~~RA~~V~~~L~~~Gv~~~r-i~~~g~G   79 (97)
T pfam00691         1 LFDPGSAELTAEARETLDRLAEVLKAPELKIAIKIEGHTDSRGSAKYNWELSARRAQAVANYLVNHGIPPSR-ISVEGYG   79 (97)
T ss_pred             CCCCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEEEEEEECCCCCHHHHHHHHHHHHHHHHHHHHHCCCCHHH-EEEEEEC
T ss_conf             999981213989999999999999718997289999998999988899999999999999999985999789-8998875


Q ss_pred             CCCCCCCCCCHHHHHCCC
Q ss_conf             458889976977985299
Q gi|254780953|r  159 YKYPIDTNDTKVGRQNNQ  176 (190)
Q Consensus       159 ~~~p~~~n~~~~~ra~NR  176 (190)
                      +.+|+.+|+++++|++||
T Consensus        80 ~~~Pi~~~~~~~~r~~NR   97 (97)
T pfam00691        80 ESQPLASNDSDEGRAKNR   97 (97)
T ss_pred             CCCCCCCCCCHHHHHHCC
T ss_conf             768889992999997475


No 26 
>PRK07034 hypothetical protein; Provisional
Probab=99.84  E-value=6.4e-21  Score=136.51  Aligned_cols=140  Identities=18%  Similarity=0.268  Sum_probs=115.2

Q ss_pred             HHHHHHHHHHHHCCCCCEEEEECCEEEEEECCCEECC-CHHHCCHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCC----
Q ss_conf             7888999999720178358860875899852211128-81310999999999999999858994899998037787----
Q gi|254780953|r   47 LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIG----  121 (190)
Q Consensus        47 ~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~f~-~~a~l~~~~~~~L~~ia~~l~~~~~~~i~I~GHTD~~g----  121 (190)
                      ++.+...+...+.+.-+++....++-.+.+..+-.|+ +++.|.+++...+.+++..+.--|. .+.|+||||+++    
T Consensus       354 ~etLp~pL~~iL~EGwltvrk~P~gwllif~sDGaF~~g~A~l~~~f~~nieRLG~A~ApwpG-dleViGHTD~rPiRss  432 (565)
T PRK07034        354 AETLPPPLPQILTEGWLTAYKHPQGWLLVFKSDGAFDVGKANVRADFMHNIERLGLAFAPWPG-DLEVIGHTDSRPIRTS  432 (565)
T ss_pred             HHHCCCCCHHHHHHHHEEEEECCCCCEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCC-CEEEECCCCCCCCCCC
T ss_conf             543687432576520054020797418998248764434120369889889998676368888-6577514788764378


Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHHCC---------CCCCEEEEEEECCCCCCCCCCCHHHHHCCCCEEEE--EECCHH
Q ss_conf             2001112258999999998885238---------74516999970345888997697798529916999--930101
Q gi|254780953|r  122 TLKNNLLISQERADVIKSYLIQRGV---------SSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQ--IFPRGN  187 (190)
Q Consensus       122 ~~~~N~~LS~~RA~~V~~~L~~~g~---------~~~r~i~v~g~G~~~p~~~n~~~~~ra~NRRVei~--i~~~~~  187 (190)
                      ...+||.||+.||..|++.|...-.         .-.|-|..+|.|+++|+..|+|+++|.+||||+|.  |.+++-
T Consensus       433 ~fp~N~~LSeARA~~VAD~lR~s~~~~~~~~~~~~~QR~i~~~GrGd~~Pldt~~T~~~~~RNRRVDiLWKi~~~~a  509 (565)
T PRK07034        433 EFPDNQALSEARARNVADELRKTALPGGARAPENAVQRNIEYSGRGDAQPIDTAKTAAAYERNRRVDVLWKVIPDGA  509 (565)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHEEEECCCCCCCCCCCCHHHHHHHCCCCEEEEEECCCHH
T ss_conf             89840767888887899999985343544571266652000004788886654005777752653015665337514


No 27 
>PRK11627 hypothetical protein; Provisional
Probab=94.76  E-value=0.026  Score=32.50  Aligned_cols=23  Identities=17%  Similarity=0.524  Sum_probs=20.4

Q ss_pred             CHHHHHHHHHHHHHHHHCCCCCC
Q ss_conf             94789999999999975147887
Q gi|254780953|r    1 MIKELGLSMFIMTTISGCGLASR   23 (190)
Q Consensus         1 m~k~l~l~~~~~~~l~g~~~~~~   23 (190)
                      |||++.+.++..++++||++.+.
T Consensus         1 ~mkk~~~~l~a~~lL~gCas~p~   23 (192)
T PRK11627          1 MLKKILFPLVALFMLAGCATPPT   23 (192)
T ss_pred             CHHHHHHHHHHHHHHHHHCCCCC
T ss_conf             92879999999999986069976


No 28 
>PRK12696 flgH flagellar basal body L-ring protein; Reviewed
Probab=94.12  E-value=0.069  Score=30.15  Aligned_cols=25  Identities=28%  Similarity=0.465  Sum_probs=21.5

Q ss_pred             CHHHHHHHHHHHHHHHHCCCCCCCC
Q ss_conf             9478999999999997514788765
Q gi|254780953|r    1 MIKELGLSMFIMTTISGCGLASREK   25 (190)
Q Consensus         1 m~k~l~l~~~~~~~l~g~~~~~~~~   25 (190)
                      |||++.+.++++++++||+......
T Consensus         1 mm~~~l~~~~~~~~L~GC~~~~~~~   25 (238)
T PRK12696          1 MIRKLLAASCAVLLLSGCNAARQQP   25 (238)
T ss_pred             CHHHHHHHHHHHHHHHCCCCCCCCC
T ss_conf             9589999999999951656888888


No 29 
>PRK11671 mltC murein transglycosylase C; Provisional
Probab=83.70  E-value=3.3  Score=20.79  Aligned_cols=136  Identities=17%  Similarity=0.137  Sum_probs=59.1

Q ss_pred             CHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCC-CC-CEEEEECCEEEEE---
Q ss_conf             947899999999999751478876544444555543111100123378889999997201-78-3588608758998---
Q gi|254780953|r    1 MIKELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQD-TG-IVVSRIGDMITCY---   75 (190)
Q Consensus         1 m~k~l~l~~~~~~~l~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~-~~-~~~~~~~~~~~~~---   75 (190)
                      |||++.+.++++.++.+|+++..........         ......+|.+.......+.. +| .++...+..-.+.   
T Consensus         1 ~~~k~~~~~~~~~~l~~c~~~~~~~~~~~~~---------~kdt~~~~~l~~~f~~ni~~~Wg~~e~~~a~~~~YVKYtd   71 (360)
T PRK11671          1 MMKKYLALALIAPLLISCSSSKKGDTYNEAW---------VKDTNGFDILMGQFAHNIENIWGFKEVLIAGPKDYVKYTD   71 (360)
T ss_pred             CCHHHHHHHHHHHHHHHHCCCCCCCCCCHHH---------HHCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCEEEECC
T ss_conf             9146889999999998710468887633777---------6123079999999876588743876431367753477146


Q ss_pred             ---ECCCEECC-CHHH---C-CHHHHHHH-HHHHHHHHHCCCCEEEEEEECCC--CC----C-------HHHHHHH-HHH
Q ss_conf             ---52211128-8131---0-99999999-99999998589948999980377--87----2-------0011122-589
Q gi|254780953|r   76 ---IPVHVSFV-SEVF---L-EKKFLPML-QLIATILNKFPSTVIAIQSHTDS--IG----T-------LKNNLLI-SQE  132 (190)
Q Consensus        76 ---~~~~~~f~-~~a~---l-~~~~~~~L-~~ia~~l~~~~~~~i~I~GHTD~--~g----~-------~~~N~~L-S~~  132 (190)
                         -...+-|+ |.-.   | ..+.+..| +.|...|-.-.+ .-.|.=++|.  .+    +       +..+..+ -..
T Consensus        72 ~Y~tRa~vdF~~G~I~vETl~~~~p~~~L~~AIv~tLL~~~D-p~~vDl~sd~~~~~~~~~PfL~gqV~D~~g~~i~~~w  150 (360)
T PRK11671         72 QYQTRSHINFDDGTITIETIAGTNPAAHLRRAIIKTLLMGDD-PSSIDLYSDVDDIPISKEPFLYGQVVDNTGQPIRWEG  150 (360)
T ss_pred             CCCEEEEEECCCCEEEEEECCCCCHHHHHHHHHHHHHCCCCC-CCHHCCCCCCCCCCCCCCCEEHHHEECCCCCCCCCHH
T ss_conf             653012663478839999657768579999999999768899-5110343555557668985345420348998056098


Q ss_pred             HHHHHHHHHHHHCC
Q ss_conf             99999998885238
Q gi|254780953|r  133 RADVIKSYLIQRGV  146 (190)
Q Consensus       133 RA~~V~~~L~~~g~  146 (190)
                      ||+..++||+.+..
T Consensus       151 rA~ryAdyLi~~~l  164 (360)
T PRK11671        151 RASNFADYLLQNKL  164 (360)
T ss_pred             HHHHHHHHHHHHHH
T ss_conf             99999999997456


No 30 
>PRK10834 hypothetical protein; Provisional
Probab=81.75  E-value=3.9  Score=20.35  Aligned_cols=16  Identities=19%  Similarity=0.401  Sum_probs=9.7

Q ss_pred             CHHHHHHHHHHHHHHH
Q ss_conf             9478999999999997
Q gi|254780953|r    1 MIKELGLSMFIMTTIS   16 (190)
Q Consensus         1 m~k~l~l~~~~~~~l~   16 (190)
                      |+|+++..+++++.+.
T Consensus         1 m~Krl~~~~~~~~~~~   16 (239)
T PRK10834          1 MLKRVFYSLLVLIGLL   16 (239)
T ss_pred             CHHHHHHHHHHHHHHH
T ss_conf             9799999999999999


No 31 
>COG3417 FlgN Collagen-binding surface adhesin SpaP (antigen I/II family) [General function prediction only]
Probab=81.40  E-value=1.9  Score=22.11  Aligned_cols=20  Identities=20%  Similarity=0.384  Sum_probs=18.4

Q ss_pred             CHHHHHHHHHHHHHHHHCCC
Q ss_conf             94789999999999975147
Q gi|254780953|r    1 MIKELGLSMFIMTTISGCGL   20 (190)
Q Consensus         1 m~k~l~l~~~~~~~l~g~~~   20 (190)
                      |||++...++++++++||+.
T Consensus         3 k~k~~~~il~~al~l~GCs~   22 (200)
T COG3417           3 KMKIYASILLLALFLSGCSS   22 (200)
T ss_pred             HHHHHHHHHHHHHHHHHCCC
T ss_conf             57999999999999841136


No 32 
>PRK10866 outer membrane protein assembly complex subunit YfiO; Provisional
Probab=81.27  E-value=1.9  Score=22.09  Aligned_cols=21  Identities=19%  Similarity=0.284  Sum_probs=17.5

Q ss_pred             HHHHHHHHHHHHHHHHCCCCC
Q ss_conf             478999999999997514788
Q gi|254780953|r    2 IKELGLSMFIMTTISGCGLAS   22 (190)
Q Consensus         2 ~k~l~l~~~~~~~l~g~~~~~   22 (190)
                      ||.|.++++++++++||+...
T Consensus         4 ~k~l~~~~~l~l~l~gCs~~~   24 (243)
T PRK10866          4 MKYLVAAATLSLFLAGCSGSK   24 (243)
T ss_pred             HHHHHHHHHHHHHHHHCCCCC
T ss_conf             899999999999998768998


No 33 
>PRK13731 conjugal transfer surface exclusion protein TraT; Provisional
Probab=81.08  E-value=3.1  Score=20.89  Aligned_cols=87  Identities=18%  Similarity=0.253  Sum_probs=45.6

Q ss_pred             HHHHHHHHHHH--HHHHHCCCCCCCCCC----CCCC--C----CCCCC-----CCCCHHHHHHHHHHHHHHHHHCCCCCE
Q ss_conf             47899999999--999751478876544----4445--5----55431-----111001233788899999972017835
Q gi|254780953|r    2 IKELGLSMFIM--TTISGCGLASREKKK----VFLH--K----SNDTD-----IVNKRFGSSLDKAEDEFQMQLQDTGIV   64 (190)
Q Consensus         2 ~k~l~l~~~~~--~~l~g~~~~~~~~~~----~~~~--~----~~~~~-----~~~~~~~~~~~~~~~~l~~~~~~~~~~   64 (190)
                      ||+++++.+++  ++++||+...+.-.+    ....  .    .++.+     .....-+..+...++++...+...|-.
T Consensus         3 ~kk~~~~~~~~~~l~lsGC~a~~tai~krnL~VqTkMS~TIfLdP~s~ktVyv~vrNTS~~~~~~l~~~i~~~L~akGY~   82 (243)
T PRK13731          3 TKKLMMVALVSSTLALSGCGAMSTAIKKRNLEVKTQMSETIWLEPASERTVFLQIKNTSDKDMSGLQGKIADAVKAKGYQ   82 (243)
T ss_pred             HHHHHHHHHHHHHHHHCCHHHHHHHHHHCCCCEECEECCCEEECCCCCCEEEEEEECCCCCCHHHHHHHHHHHHHHCCEE
T ss_conf             37757999999999971568767787735752222000438866854557999985178772456789999999858909


Q ss_pred             EEEECCEEEEEECCCEECCCHHHC
Q ss_conf             886087589985221112881310
Q gi|254780953|r   65 VSRIGDMITCYIPVHVSFVSEVFL   88 (190)
Q Consensus        65 ~~~~~~~~~~~~~~~~~f~~~a~l   88 (190)
                      +....+.-..-+..+++.-+...+
T Consensus        83 iv~~P~~A~Y~LQaNVL~~~K~~~  106 (243)
T PRK13731         83 VVTSPDKAYYWIQANVLKADKMDL  106 (243)
T ss_pred             EECCHHHCEEEEEEEEHHCCCCCH
T ss_conf             867865760772742402355787


No 34 
>pfam06291 Lambda_Bor Bor protein. This family consists of several Bacteriophage lambda Bor and Escherichia coli Iss proteins. Expression of bor significantly increases the survival of the Escherichia coli host cell in animal serum. This property is a well known bacterial virulence determinant indeed, bor and its adjacent sequences are highly homologous to the iss serum resistance locus of the plasmid ColV2-K94, which confers virulence in animals. It has been suggested that lysogeny may generally have a role in bacterial survival in animal hosts, and perhaps in pathogenesis.
Probab=80.26  E-value=0.9  Score=23.91  Aligned_cols=24  Identities=17%  Similarity=0.331  Sum_probs=19.1

Q ss_pred             HHHHHHHHHHHHHHHHCCCCCCCC
Q ss_conf             478999999999997514788765
Q gi|254780953|r    2 IKELGLSMFIMTTISGCGLASREK   25 (190)
Q Consensus         2 ~k~l~l~~~~~~~l~g~~~~~~~~   25 (190)
                      ||++.++++++++++||+..+-.-
T Consensus         1 MKk~~~~~~~allLtgCa~QT~~~   24 (97)
T pfam06291         1 MKKMLFAAALALLITGCAQQTFTV   24 (97)
T ss_pred             CHHHHHHHHHHHHHCCCCCEEEEE
T ss_conf             922599999999972133049993


No 35 
>PRK00022 lolB outer membrane lipoprotein LolB; Provisional
Probab=79.66  E-value=2.4  Score=21.49  Aligned_cols=25  Identities=24%  Similarity=0.361  Sum_probs=18.9

Q ss_pred             CHHHHHHHHHHHHHHHHCCCCCCCC
Q ss_conf             9478999999999997514788765
Q gi|254780953|r    1 MIKELGLSMFIMTTISGCGLASREK   25 (190)
Q Consensus         1 m~k~l~l~~~~~~~l~g~~~~~~~~   25 (190)
                      |.+.+.+.++++++++||++.+...
T Consensus         1 ~~r~~~~l~~~~llLsgCat~p~~~   25 (203)
T PRK00022          1 MFRLLRLLPLAALLLAGCASLPPPK   25 (203)
T ss_pred             CHHHHHHHHHHHHHHHHCCCCCCCC
T ss_conf             9063899999999986614899988


No 36 
>PRK01326 prsA foldase protein PrsA; Reviewed
Probab=79.54  E-value=2  Score=21.97  Aligned_cols=25  Identities=20%  Similarity=0.347  Sum_probs=17.8

Q ss_pred             CHHHHHHHH---HHHHHHHHCCCCCCCC
Q ss_conf             947899999---9999997514788765
Q gi|254780953|r    1 MIKELGLSM---FIMTTISGCGLASREK   25 (190)
Q Consensus         1 m~k~l~l~~---~~~~~l~g~~~~~~~~   25 (190)
                      |+|++++++   +.+++|+||+..+...
T Consensus         1 MKKKl~~~~~~~~svl~LaaCs~~~~~~   28 (310)
T PRK01326          1 MKKKLIAGAVTLLSVATLAACSKTNDNT   28 (310)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHCCCCCCC
T ss_conf             9088999999999999998716999880


No 37 
>PRK13861 type IV secretion system protein VirB9; Provisional
Probab=79.24  E-value=1.2  Score=23.16  Aligned_cols=21  Identities=33%  Similarity=0.262  Sum_probs=14.8

Q ss_pred             CHHHHHHHHHHHHHHHHCCCC
Q ss_conf             947899999999999751478
Q gi|254780953|r    1 MIKELGLSMFIMTTISGCGLA   21 (190)
Q Consensus         1 m~k~l~l~~~~~~~l~g~~~~   21 (190)
                      |||+|++++++++++++.+.+
T Consensus         1 mmk~l~~~~~~~l~~~~~a~A   21 (293)
T PRK13861          1 MIKKLFLTLACLLFAAIGALA   21 (293)
T ss_pred             CCHHHHHHHHHHHHHHHHHHH
T ss_conf             908999999999986126678


No 38 
>TIGR02747 TraV type IV conjugative transfer system protein TraV; InterPro: IPR014118   This entry includes TraV, which is a component of conjugative type IV secretion system. TraV is an outer membrane lipoprotein that is believed to interact with the secretin TraK , , . The alignment contains three conserved cysteines in the N-terminal half..
Probab=78.43  E-value=1.3  Score=23.06  Aligned_cols=21  Identities=19%  Similarity=0.471  Sum_probs=15.3

Q ss_pred             CHHHHHHHHHHHHH--HHHCCCC
Q ss_conf             94789999999999--9751478
Q gi|254780953|r    1 MIKELGLSMFIMTT--ISGCGLA   21 (190)
Q Consensus         1 m~k~l~l~~~~~~~--l~g~~~~   21 (190)
                      |||..+|+++.+++  |+||++.
T Consensus         1 Mmr~~~L~~~~~~~f~LtGCsa~   23 (174)
T TIGR02747         1 MMRLKVLLLLACVAFLLTGCSAS   23 (174)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHH
T ss_conf             90678999999998720025774


No 39 
>PRK10449 heat-inducible protein; Provisional
Probab=78.42  E-value=1.8  Score=22.20  Aligned_cols=24  Identities=13%  Similarity=0.253  Sum_probs=17.3

Q ss_pred             HHHHHHHHHHHHHHHHCCCCCCCC
Q ss_conf             478999999999997514788765
Q gi|254780953|r    2 IKELGLSMFIMTTISGCGLASREK   25 (190)
Q Consensus         2 ~k~l~l~~~~~~~l~g~~~~~~~~   25 (190)
                      ||++..++++.++++||++++...
T Consensus         1 MKk~l~l~~~~llLagC~s~~~~~   24 (140)
T PRK10449          1 MKKVVALVALSLLMAGCVSSGKIS   24 (140)
T ss_pred             CCHHHHHHHHHHHHHHCCCCCCCC
T ss_conf             903499999999997523899887


No 40 
>pfam05643 DUF799 Putative bacterial lipoprotein (DUF799). This family consists of several bacterial proteins of unknown function. Some of the family members are described as putative lipoproteins.
Probab=77.92  E-value=1.9  Score=22.06  Aligned_cols=23  Identities=22%  Similarity=0.382  Sum_probs=19.2

Q ss_pred             HHHHHHHHHHHHHHHHCCCCCCC
Q ss_conf             47899999999999751478876
Q gi|254780953|r    2 IKELGLSMFIMTTISGCGLASRE   24 (190)
Q Consensus         2 ~k~l~l~~~~~~~l~g~~~~~~~   24 (190)
                      ||++.+.++.+++++||+.+...
T Consensus         1 mK~lil~l~~~l~L~gCa~~~~~   23 (215)
T pfam05643         1 MKPLILGLAAVLALSACQVQKAP   23 (215)
T ss_pred             CHHHHHHHHHHHHHHHCCCCCCC
T ss_conf             93149999999998623489998


No 41 
>pfam06474 MLTD_N MLTD_N.
Probab=77.86  E-value=2.3  Score=21.62  Aligned_cols=28  Identities=7%  Similarity=0.113  Sum_probs=17.1

Q ss_pred             HHHHHHHHHHHHHHHHCCCCCCCCCCCCC
Q ss_conf             47899999999999751478876544444
Q gi|254780953|r    2 IKELGLSMFIMTTISGCGLASREKKKVFL   30 (190)
Q Consensus         2 ~k~l~l~~~~~~~l~g~~~~~~~~~~~~~   30 (190)
                      ||. ..+++++++|+||.++.........
T Consensus         1 Mk~-kail~~alLLaGCQst~~~~~~t~~   28 (93)
T pfam06474         1 MRA-KAVLAAALLLVGCQSTQAVSSTTSQ   28 (93)
T ss_pred             CCH-HHHHHHHHHHHHHCCCCCCCCCCCC
T ss_conf             918-9999999999981379999998777


No 42 
>PRK10760 murein hydrolase B; Provisional
Probab=77.37  E-value=2.8  Score=21.15  Aligned_cols=27  Identities=4%  Similarity=0.154  Sum_probs=20.0

Q ss_pred             HHHHHHHHHHHHHHHHCCCCCCCCCCC
Q ss_conf             478999999999997514788765444
Q gi|254780953|r    2 IKELGLSMFIMTTISGCGLASREKKKV   28 (190)
Q Consensus         2 ~k~l~l~~~~~~~l~g~~~~~~~~~~~   28 (190)
                      |+++...+.++++|++|++.+..+...
T Consensus         1 ~r~~~~~~~~~~~l~~css~p~~~~~~   27 (357)
T PRK10760          1 KRRYVTLLPLFVLLAACSSKPKPTETE   27 (357)
T ss_pred             CCCHHHHHHHHHHHHHHCCCCCCCCCC
T ss_conf             940486899999999851899999987


No 43 
>PRK12698 flgH flagellar basal body L-ring protein; Reviewed
Probab=77.23  E-value=2.2  Score=21.73  Aligned_cols=23  Identities=13%  Similarity=0.387  Sum_probs=15.3

Q ss_pred             HHHHHHHHHHHHHHHHCCCCCCCC
Q ss_conf             478999999999997514788765
Q gi|254780953|r    2 IKELGLSMFIMTTISGCGLASREK   25 (190)
Q Consensus         2 ~k~l~l~~~~~~~l~g~~~~~~~~   25 (190)
                      ||++.+ ++++++|+||+......
T Consensus         1 M~r~~l-~~~~l~L~gCa~~~~~p   23 (224)
T PRK12698          1 MARYIL-LALALLLAGCSSTPKKP   23 (224)
T ss_pred             CHHHHH-HHHHHHHHCCCCCCCCC
T ss_conf             977999-99999983656889888


No 44 
>PRK13883 conjugal transfer protein TrbH; Provisional
Probab=76.74  E-value=1.9  Score=22.12  Aligned_cols=21  Identities=24%  Similarity=0.316  Sum_probs=14.4

Q ss_pred             CHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             9478999999999997514788
Q gi|254780953|r    1 MIKELGLSMFIMTTISGCGLAS   22 (190)
Q Consensus         1 m~k~l~l~~~~~~~l~g~~~~~   22 (190)
                      |+|. .++.++++.++||+++.
T Consensus         1 MrK~-~~~all~laL~gCAtt~   21 (156)
T PRK13883          1 MRKI-LSLALLALALGGCATTS   21 (156)
T ss_pred             CHHH-HHHHHHHHHHHCCCCCC
T ss_conf             9268-99999999970331357


No 45 
>TIGR03525 GldK gliding motility-associated lipoprotein GldK. Members of this protein family are exclusive to the Bacteroidetes phylum (previously Cytophaga-Flavobacteria-Bacteroides). GldK is a lipoprotein linked to a type of rapid surface gliding motility found in certain Bacteroidetes, such as Flavobacterium johnsoniae. Knockouts of GldK abolish the gliding phenotype. GldK is homologous to GldJ. There is a GldK homolog in Cytophaga hutchinsonii and several other species that has a different, shorter architecture and is represented by a separate model. Gliding motility appears closely linked to chitin utilization in the model species Flavobacterium johnsoniae. Bacteroidetes with members of this protein family appear to have all of the genes associated with gliding motility.
Probab=76.53  E-value=2  Score=21.94  Aligned_cols=24  Identities=13%  Similarity=0.325  Sum_probs=18.4

Q ss_pred             HHHHHHHHHHHHHHHHCCCCCCCC
Q ss_conf             478999999999997514788765
Q gi|254780953|r    2 IKELGLSMFIMTTISGCGLASREK   25 (190)
Q Consensus         2 ~k~l~l~~~~~~~l~g~~~~~~~~   25 (190)
                      ||++++.+++++++.+|++...-+
T Consensus         1 Mkk~~~~~~~~~~~~SCg~~~~GE   24 (449)
T TIGR03525         1 MKKYLVFAALVVLVYSCGSGDKGE   24 (449)
T ss_pred             CCHHHHHHHHHHHHHHCCCCCCCE
T ss_conf             912489999999872105899713


No 46 
>pfam07901 DUF1672 Protein of unknown function (DUF1672). This family is composed of hypothetical bacterial proteins of unknown function.
Probab=76.11  E-value=2.5  Score=21.44  Aligned_cols=26  Identities=27%  Similarity=0.443  Sum_probs=19.2

Q ss_pred             CHHHHHHHHHHHHHHHHCCCCCCCCC
Q ss_conf             94789999999999975147887654
Q gi|254780953|r    1 MIKELGLSMFIMTTISGCGLASREKK   26 (190)
Q Consensus         1 m~k~l~l~~~~~~~l~g~~~~~~~~~   26 (190)
                      |.|.+.+.+...++|.||+.......
T Consensus         1 MkK~i~~il~~~llL~GCs~mn~~~~   26 (304)
T pfam07901         1 MRKLIKLILIATLLLSGCSTTNNESN   26 (304)
T ss_pred             CCHHHHHHHHHHHHHCCCCCCCCCCC
T ss_conf             90189999999999713344555420


No 47 
>pfam08139 LPAM_1 Prokaryotic membrane lipoprotein lipid attachment site. In prokaryotes, membrane lipoproteins are synthesized with a precursor signal peptide, which is cleaved by a specific lipoprotein signal peptidase (signal peptidase II). The peptidase recognizes a conserved sequence and cuts upstream of a cysteine residue to which a glyceride-fatty acid lipid is attached.
Probab=74.81  E-value=2.5  Score=21.48  Aligned_cols=23  Identities=22%  Similarity=0.479  Sum_probs=16.9

Q ss_pred             HHHHHHHHHHHHHHHHCCCCCCC
Q ss_conf             47899999999999751478876
Q gi|254780953|r    2 IKELGLSMFIMTTISGCGLASRE   24 (190)
Q Consensus         2 ~k~l~l~~~~~~~l~g~~~~~~~   24 (190)
                      ||++.+.++++++++||++....
T Consensus         1 Mkk~~~l~~~~l~LagCas~~~~   23 (26)
T pfam08139         1 MKKLLLLLLALLLLAGCASXXXX   23 (26)
T ss_pred             CHHHHHHHHHHHHHHCCCCCCCC
T ss_conf             96699999999998233200133


No 48 
>PRK03002 prsA peptidylprolyl isomerase; Reviewed
Probab=72.64  E-value=3.6  Score=20.55  Aligned_cols=25  Identities=16%  Similarity=0.313  Sum_probs=15.7

Q ss_pred             CHHHHHH---HHHHHHHHHHCCCCCCCC
Q ss_conf             9478999---999999997514788765
Q gi|254780953|r    1 MIKELGL---SMFIMTTISGCGLASREK   25 (190)
Q Consensus         1 m~k~l~l---~~~~~~~l~g~~~~~~~~   25 (190)
                      |+|++.+   +++++++++||+......
T Consensus         1 mkkK~i~~~~~~~svl~LaaC~~~~~~~   28 (285)
T PRK03002          1 MRGKHIFIITALISILMLSACGQKNSSA   28 (285)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHCCCCCCC
T ss_conf             9601899999999999999845799997


No 49 
>PRK12450 foldase protein PrsA; Reviewed
Probab=70.82  E-value=4.4  Score=20.04  Aligned_cols=26  Identities=19%  Similarity=0.342  Sum_probs=17.1

Q ss_pred             CHHHHHHHHH---HHHHHHHCCCCCCCCC
Q ss_conf             9478999999---9999975147887654
Q gi|254780953|r    1 MIKELGLSMF---IMTTISGCGLASREKK   26 (190)
Q Consensus         1 m~k~l~l~~~---~~~~l~g~~~~~~~~~   26 (190)
                      +||++++.+.   .+++|+||++.+....
T Consensus         3 ~mKK~~~~~~~~~svl~LaAC~s~~~~~~   31 (309)
T PRK12450          3 QMNKLITGVVTLATVVTLSACQSSHNNTK   31 (309)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCCCCCE
T ss_conf             79999999999999999986058999836


No 50 
>PRK12407 flgH flagellar basal body L-ring protein; Reviewed
Probab=70.14  E-value=4.3  Score=20.09  Aligned_cols=21  Identities=14%  Similarity=0.290  Sum_probs=16.3

Q ss_pred             HHHHHHHHHHHHHHHCCCCCC
Q ss_conf             789999999999975147887
Q gi|254780953|r    3 KELGLSMFIMTTISGCGLASR   23 (190)
Q Consensus         3 k~l~l~~~~~~~l~g~~~~~~   23 (190)
                      |+++++++++++++||+....
T Consensus         1 kr~l~l~~~~l~LsGC~~~~~   21 (220)
T PRK12407          1 KRFLILTPMVLALCGCESPAL   21 (220)
T ss_pred             CCCHHHHHHHHHHHCCCCCCC
T ss_conf             915799999999736588887


No 51 
>COG5633 Predicted periplasmic lipoprotein [General function prediction only]
Probab=69.36  E-value=3.2  Score=20.86  Aligned_cols=27  Identities=15%  Similarity=0.245  Sum_probs=19.6

Q ss_pred             HHHHHHHHHHHHHHHHCCCCCCCCCCC
Q ss_conf             478999999999997514788765444
Q gi|254780953|r    2 IKELGLSMFIMTTISGCGLASREKKKV   28 (190)
Q Consensus         2 ~k~l~l~~~~~~~l~g~~~~~~~~~~~   28 (190)
                      ||++.++.+.+++++||++...-....
T Consensus         1 Mrk~~~~~l~~~lLvGCsS~~~i~~~~   27 (123)
T COG5633           1 MRKLCLLSLALLLLVGCSSHQEILVND   27 (123)
T ss_pred             CCEEHHHHHHHHHHHCCCCCCCCCCCC
T ss_conf             930038999999942047887752255


No 52 
>pfam04076 BOF Bacterial OB fold (BOF) protein. Proteins in this family form an OB-fold. Analysis of the predicted binding site of BOF family proteins implies that they lack nucleic acid-binding properties. They contain an predicted N-terminal signal peptide which indicates that they localize in the periplasm where they may function to bind proteins, small molecules, or other typical OB-fold ligands. As hypothesized for the distantly related OB-fold containing bacterial enterotoxins, the loss of nucleotide-binding function and the rapid evolution of the BOF ligand-binding site may be associated with the presence of BOF proteins in mobile genetic elements and their potential role in bacterial pathogenicity.
Probab=68.22  E-value=7.9  Score=18.63  Aligned_cols=18  Identities=17%  Similarity=0.119  Sum_probs=14.3

Q ss_pred             HCCCCEEEEEEECCCCCC
Q ss_conf             589948999980377872
Q gi|254780953|r  105 KFPSTVIAIQSHTDSIGT  122 (190)
Q Consensus       105 ~~~~~~i~I~GHTD~~g~  122 (190)
                      -.|+..|+|.|.-|....
T Consensus        98 v~p~~kVrI~GevDk~~~  115 (126)
T pfam04076        98 VQPKDKVKITGEVDKDLN  115 (126)
T ss_pred             CCCCCEEEEEEEECCCCC
T ss_conf             799998999999947888


No 53 
>TIGR03516 ppisom_GldI peptidyl-prolyl isomerase, gliding motility-associated. Members of this protein family are exclusive to the Bacteroidetes phylum (previously Cytophaga-Flavobacteria-Bacteroides). GldI is a FKBP-type peptidyl-prolyl cis-trans isomerase (pfam00254) linked to a type of rapid surface gliding motility found in certain Bacteroidetes, such as Flavobacterium johnsoniae and Cytophaga hutchinsonii. Knockout of this gene abolishes the gliding phenotype. Gliding motility appears closely linked to chitin utilization in the model species Flavobacterium johnsoniae. This family is only found in Bacteroidetes containing the suite of genes proposed to confer the gliding motility phenotype.
Probab=68.15  E-value=9.2  Score=18.28  Aligned_cols=70  Identities=9%  Similarity=0.142  Sum_probs=30.2

Q ss_pred             HHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCC-CCEEEEECCEE
Q ss_conf             478999999999997514788765444445555431111001233788899999972017-83588608758
Q gi|254780953|r    2 IKELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDT-GIVVSRIGDMI   72 (190)
Q Consensus         2 ~k~l~l~~~~~~~l~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~-~~~~~~~~~~~   72 (190)
                      |+++++.+++++++.+|....... ........................+..+...+..+ ...+.....++
T Consensus         1 m~~~i~~i~~~~~~~sC~~~e~Rk-Pi~~~s~~f~~~S~~rNK~l~a~Ee~~I~~~i~~ds~~~y~~S~sG~   71 (177)
T TIGR03516         1 MKHLIAVILLLLLLLGCKTPEARR-PISRSSGTTIKLSAERNKKLIAAEEAAIKRIISADSIVKYETSQNGF   71 (177)
T ss_pred             CCCHHHHHHHHHHHHHCCCCCCCC-CCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEECCCCC
T ss_conf             943047898989987269964668-86658751499999998999999999999999869855356889962


No 54 
>PRK11138 outer membrane protein assembly complex subunit YfgL; Provisional
Probab=68.05  E-value=7.8  Score=18.67  Aligned_cols=25  Identities=28%  Similarity=0.406  Sum_probs=18.4

Q ss_pred             HHHHHHHHHHHHHHHHCCCCCCCCC
Q ss_conf             4789999999999975147887654
Q gi|254780953|r    2 IKELGLSMFIMTTISGCGLASREKK   26 (190)
Q Consensus         2 ~k~l~l~~~~~~~l~g~~~~~~~~~   26 (190)
                      +|.++..++++++++||+....++.
T Consensus         4 ~~~~~~~l~~~~ll~gCs~~~~~~~   28 (394)
T PRK11138          4 RKLLLPGLLSVALLSGCSLFDSEED   28 (394)
T ss_pred             HHHHHHHHHHHHHHHHCCCCCCCCC
T ss_conf             6779999999999865237888877


No 55 
>TIGR03431 PhnD phosphonate ABC transporter, periplasmic phosphonate binding protein. Note that this model does not identify all phnD-subfamily genes with evident phosphonate context, but all sequences above the trusted context may be inferred to bind phosphonate compounds even in the absence of such context. Furthermore, there is ample evidence to suggest that many other members of the TIGR01098 subfamily have a different primary function.
Probab=67.36  E-value=9.5  Score=18.19  Aligned_cols=25  Identities=16%  Similarity=0.211  Sum_probs=19.3

Q ss_pred             CHHHHHHHHHHHHHHHHCCCCCCCC
Q ss_conf             9478999999999997514788765
Q gi|254780953|r    1 MIKELGLSMFIMTTISGCGLASREK   25 (190)
Q Consensus         1 m~k~l~l~~~~~~~l~g~~~~~~~~   25 (190)
                      |||++.+.+++++++.+|.....+.
T Consensus         1 m~~r~l~~~~~~~~~~~~~a~a~~~   25 (288)
T TIGR03431         1 MLRRLILSLVAAFMLISSNAQAEDW   25 (288)
T ss_pred             CCHHHHHHHHHHHHHHCCHHHHCCC
T ss_conf             9088999999999997432243048


No 56 
>PRK11443 hypothetical protein; Provisional
Probab=66.60  E-value=5.7  Score=19.43  Aligned_cols=25  Identities=16%  Similarity=0.339  Sum_probs=16.5

Q ss_pred             HHHHHHHHHHHHHHHHCCCCCCCCCC
Q ss_conf             47899999999999751478876544
Q gi|254780953|r    2 IKELGLSMFIMTTISGCGLASREKKK   27 (190)
Q Consensus         2 ~k~l~l~~~~~~~l~g~~~~~~~~~~   27 (190)
                      ||++.+ .+++++|+||...+....+
T Consensus         1 Mk~~~~-~~~~lll~GCq~~p~t~ap   25 (120)
T PRK11443          1 MKKFIA-PLLALLVSGCQIDPYTHAP   25 (120)
T ss_pred             CHHHHH-HHHHHHHHCCCCCCCCCCC
T ss_conf             915899-9999999666789624686


No 57 
>PRK13616 lipoprotein LpqB; Provisional
Probab=65.68  E-value=7.2  Score=18.85  Aligned_cols=27  Identities=15%  Similarity=0.308  Sum_probs=21.1

Q ss_pred             CHHHHHHHHHHHHHHHHCCCCCCCCCC
Q ss_conf             947899999999999751478876544
Q gi|254780953|r    1 MIKELGLSMFIMTTISGCGLASREKKK   27 (190)
Q Consensus         1 m~k~l~l~~~~~~~l~g~~~~~~~~~~   27 (190)
                      +||.+.++++++++++||++.+.....
T Consensus         5 ~~~~~~~~~~~~~llaGCaslP~ss~p   31 (590)
T PRK13616          5 RLKALAALLAVALLVAGCASLPSSSAP   31 (590)
T ss_pred             HHHHHHHHHHHHHHHHHCCCCCCCCCC
T ss_conf             999999999999986120368999997


No 58 
>TIGR03352 VI_chp_3 type VI secretion lipoprotein, VC_A0113 family. Work by Mougous, et al. (2006), describes IAHP-related loci as a type VI secretion system (PMID:16763151). This protein family is associated with type VI secretion loci, although not treated explicitly by Mougous, et al.
Probab=64.40  E-value=3.5  Score=20.61  Aligned_cols=22  Identities=18%  Similarity=0.360  Sum_probs=15.2

Q ss_pred             HHHHHHHHHHHHHHHCCCCCCC
Q ss_conf             7899999999999751478876
Q gi|254780953|r    3 KELGLSMFIMTTISGCGLASRE   24 (190)
Q Consensus         3 k~l~l~~~~~~~l~g~~~~~~~   24 (190)
                      |++.+.++++++++||++++..
T Consensus         1 ~r~~~~l~~~lllagC~s~~~~   22 (146)
T TIGR03352         1 KRFAVLLAACLLLAGCSSAPPP   22 (146)
T ss_pred             CCEEHHHHHHHHHHHCCCCCCC
T ss_conf             9075589999998532599998


No 59 
>PRK00249 flgH flagellar basal body L-ring protein; Reviewed
Probab=64.30  E-value=11  Score=17.84  Aligned_cols=25  Identities=16%  Similarity=0.444  Sum_probs=18.4

Q ss_pred             HHHHHHHHHHHHHHHHCCCCCCCCC
Q ss_conf             4789999999999975147887654
Q gi|254780953|r    2 IKELGLSMFIMTTISGCGLASREKK   26 (190)
Q Consensus         2 ~k~l~l~~~~~~~l~g~~~~~~~~~   26 (190)
                      |..+.+.++++++++||+..+....
T Consensus         3 ~~~~~~~~~~~~~LsgCa~~~~~~~   27 (231)
T PRK00249          3 MMLIALALLLLLLLSGCASIPPKPL   27 (231)
T ss_pred             CHHHHHHHHHHHHHHHCCCCCCCCC
T ss_conf             3899999999999875348999888


No 60 
>PRK09810 entericidin A; Provisional
Probab=64.11  E-value=5.7  Score=19.44  Aligned_cols=21  Identities=33%  Similarity=0.574  Sum_probs=14.8

Q ss_pred             CHHHHHHHHH-HHHHHHHCCCC
Q ss_conf             9478999999-99999751478
Q gi|254780953|r    1 MIKELGLSMF-IMTTISGCGLA   21 (190)
Q Consensus         1 m~k~l~l~~~-~~~~l~g~~~~   21 (190)
                      |||++.+.++ ...+++||..+
T Consensus         1 mmkrli~lil~~~~ll~gcnta   22 (41)
T PRK09810          1 MMKRLIVLVLLASTLLTGCNTA   22 (41)
T ss_pred             CHHHHHHHHHHHHHHHHCCCCC
T ss_conf             9389999999999998256212


No 61 
>TIGR03659 IsdE heme ABC transporter, heme-binding protein isdE. This family of ABC substrate-binding proteins is observed primarily in close proximity with proteins localized to the cell wall and bearing the NEAT (NEAr Transporter, pfam05031) heme-binding domain. IsdE has been shown to bind heme and is involved in the process of scavenging heme for the purpose of obtaining iron.
Probab=63.04  E-value=10  Score=18.06  Aligned_cols=23  Identities=26%  Similarity=0.410  Sum_probs=14.6

Q ss_pred             HHHHHHHHHHHHHCCCCCCCCCC
Q ss_conf             99999999999751478876544
Q gi|254780953|r    5 LGLSMFIMTTISGCGLASREKKK   27 (190)
Q Consensus         5 l~l~~~~~~~l~g~~~~~~~~~~   27 (190)
                      ++++++++++++||+........
T Consensus         6 ~~~~~~~~~~l~~C~~~~~~~~~   28 (289)
T TIGR03659         6 LILLALLSLGLTGCSSSKAESKV   28 (289)
T ss_pred             HHHHHHHHHHHHHCCCCCCCCCC
T ss_conf             99999999998432899877766


No 62 
>COG3065 Slp Starvation-inducible outer membrane lipoprotein [Cell envelope biogenesis, outer membrane]
Probab=62.90  E-value=6.3  Score=19.19  Aligned_cols=24  Identities=21%  Similarity=0.235  Sum_probs=16.4

Q ss_pred             HHHHHHHHHHHHHHHHCCCCCCCC
Q ss_conf             478999999999997514788765
Q gi|254780953|r    2 IKELGLSMFIMTTISGCGLASREK   25 (190)
Q Consensus         2 ~k~l~l~~~~~~~l~g~~~~~~~~   25 (190)
                      ||+.++...++++|+||.+.+..-
T Consensus         7 ~~~~~l~~~laflLsgC~tiPk~l   30 (191)
T COG3065           7 MKKGALIGTLAFLLSGCVTIPKAL   30 (191)
T ss_pred             HHHHHHHHHHHHHHHHCCCCCHHH
T ss_conf             479999999999976303578312


No 63 
>PRK02944 OxaA-like protein precursor; Validated
Probab=62.64  E-value=9.9  Score=18.09  Aligned_cols=23  Identities=35%  Similarity=0.713  Sum_probs=15.5

Q ss_pred             CHHHHHHHHH---HHHHHHHCCCCCC
Q ss_conf             9478999999---9999975147887
Q gi|254780953|r    1 MIKELGLSMF---IMTTISGCGLASR   23 (190)
Q Consensus         1 m~k~l~l~~~---~~~~l~g~~~~~~   23 (190)
                      |+|++.+..+   ++++++||+.++.
T Consensus         1 mkk~~~~~~~~~~~~~~lsgC~~~~~   26 (255)
T PRK02944          1 MKKKLGLLAMVVALMAILAGCSEVNQ   26 (255)
T ss_pred             CCHHHHHHHHHHHHHHHHHCCCCCCC
T ss_conf             92899999999999999962468899


No 64 
>COG3009 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=61.11  E-value=13  Score=17.51  Aligned_cols=22  Identities=18%  Similarity=0.419  Sum_probs=15.0

Q ss_pred             CHHHHHHHHHHHHHHHHCCCCCCC
Q ss_conf             947899999999999751478876
Q gi|254780953|r    1 MIKELGLSMFIMTTISGCGLASRE   24 (190)
Q Consensus         1 m~k~l~l~~~~~~~l~g~~~~~~~   24 (190)
                      ||+-  +++..++.++||++....
T Consensus         1 Mm~w--l~~~aal~L~~Cas~~p~   22 (190)
T COG3009           1 MMRW--LMIIAALLLAGCASGEPS   22 (190)
T ss_pred             CCHH--HHHHHHHHHHHCCCCCCC
T ss_conf             9137--999999998753799988


No 65 
>PRK11260 cystine transporter subunit; Provisional
Probab=59.37  E-value=9.3  Score=18.24  Aligned_cols=24  Identities=8%  Similarity=0.200  Sum_probs=19.6

Q ss_pred             CHHHHHHHHHHHHHHHHCCCCCCC
Q ss_conf             947899999999999751478876
Q gi|254780953|r    1 MIKELGLSMFIMTTISGCGLASRE   24 (190)
Q Consensus         1 m~k~l~l~~~~~~~l~g~~~~~~~   24 (190)
                      |+|+++++++.+.+++||+..+..
T Consensus         4 ~~~~~~~~~l~~~~~~~~~~~~~a   27 (264)
T PRK11260          4 LGRQALMGVMAVALVAGMSVKSFA   27 (264)
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCCC
T ss_conf             679999999999999983576543


No 66 
>COG3317 NlpB Uncharacterized lipoprotein [Cell envelope biogenesis, outer membrane]
Probab=58.83  E-value=9.5  Score=18.20  Aligned_cols=25  Identities=20%  Similarity=0.360  Sum_probs=18.7

Q ss_pred             HHHHHHHHHHHHHHHHCCCCCCCCC
Q ss_conf             4789999999999975147887654
Q gi|254780953|r    2 IKELGLSMFIMTTISGCGLASREKK   26 (190)
Q Consensus         2 ~k~l~l~~~~~~~l~g~~~~~~~~~   26 (190)
                      |+++.+..++++.++||++.+....
T Consensus         4 ~~~lv~~al~v~~LaaCSs~~~~~~   28 (342)
T COG3317           4 SAKLVLGALLVLLLAACSSDSEYKR   28 (342)
T ss_pred             HHHHHHHHHHHHHHHHCCCCCCCCC
T ss_conf             7889999999998741468850003


No 67 
>COG3056 Uncharacterized lipoprotein [Cell envelope biogenesis, outer membrane]
Probab=58.01  E-value=9.3  Score=18.24  Aligned_cols=26  Identities=15%  Similarity=0.323  Sum_probs=17.2

Q ss_pred             CHHHHHHHHHHHHHHHHCCCCCCCCC
Q ss_conf             94789999999999975147887654
Q gi|254780953|r    1 MIKELGLSMFIMTTISGCGLASREKK   26 (190)
Q Consensus         1 m~k~l~l~~~~~~~l~g~~~~~~~~~   26 (190)
                      |.+++...+...++++||+..+..-.
T Consensus        14 ~t~k~L~~laa~~lLagC~a~~~tl~   39 (204)
T COG3056          14 MTKKILFPLAAIFLLAGCAAPPTTLI   39 (204)
T ss_pred             HHHHHHHHHHHHHHHHHCCCCCCEEE
T ss_conf             89999999999999975379975031


No 68 
>PRK11372 lysozyme inhibitor; Provisional
Probab=56.90  E-value=7.8  Score=18.66  Aligned_cols=22  Identities=18%  Similarity=0.463  Sum_probs=16.0

Q ss_pred             CHHHHHHHHHHHHHHHHCCCCCC
Q ss_conf             94789999999999975147887
Q gi|254780953|r    1 MIKELGLSMFIMTTISGCGLASR   23 (190)
Q Consensus         1 m~k~l~l~~~~~~~l~g~~~~~~   23 (190)
                      +||++.+ +.+.++++||+....
T Consensus         2 ~MKkll~-~~~~llLsGCs~~~~   23 (109)
T PRK11372          2 SMKKLLI-ICLPVLLTGCSAYNQ   23 (109)
T ss_pred             CHHHHHH-HHHHHHHHCCCCCCC
T ss_conf             5488999-999999704543221


No 69 
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO. Members of this protein family include YfiO, a near-essential protein of the outer membrane, part of a complex involved in protein insertion into the bacterial outer membrane. Many proteins in this family are annotated as ComL, based on the involvement of this protein in natural transformation with exogenous DNA in Neisseria gonorrhoeae. This protein family shows sequence similarity to, but is distinct from, the tol-pal system protein YbgF (TIGR02795).
Probab=56.82  E-value=14  Score=17.20  Aligned_cols=22  Identities=18%  Similarity=0.363  Sum_probs=14.9

Q ss_pred             HHHHHHHHHHHHHHHCCCCCCC
Q ss_conf             7899999999999751478876
Q gi|254780953|r    3 KELGLSMFIMTTISGCGLASRE   24 (190)
Q Consensus         3 k~l~l~~~~~~~l~g~~~~~~~   24 (190)
                      .++.+.++++++++||+.....
T Consensus         2 ~~~~~~~~~~~~l~sCs~~~~~   23 (235)
T TIGR03302         2 LLLILLLALLLLLAGCSSKKKK   23 (235)
T ss_pred             HHHHHHHHHHHHHHHCCCCCCC
T ss_conf             7999999999999873899766


No 70 
>TIGR00752 slp outer membrane lipoprotein, Slp family; InterPro: IPR004658 Slp superfamily members are present in the Gram-negative gamma proteobacteria Escherichia coli (which also contains a close paralog), Haemophilus influenzae and Pasteurella multocida and Vibrio cholerae. The known members of the family to date share a motif LX[GA]C near the N-terminus, which is compatible with the possibility that the protein is modified into a lipoprotein with Cys as the new N-terminus. Slp from E. coli is known to be a lipoprotein of the outer membrane and to be expressed in response to carbon starvation.; GO: 0019867 outer membrane.
Probab=55.97  E-value=8.1  Score=18.57  Aligned_cols=25  Identities=20%  Similarity=0.236  Sum_probs=17.6

Q ss_pred             HHHHHHHHHHHHHHHHCCCCCCCCC
Q ss_conf             4789999999999975147887654
Q gi|254780953|r    2 IKELGLSMFIMTTISGCGLASREKK   26 (190)
Q Consensus         2 ~k~l~l~~~~~~~l~g~~~~~~~~~   26 (190)
                      |++..|...++++|+||.+.+..=.
T Consensus         2 ~~~g~l~~~l~f~L~gC~~~P~~ik   26 (190)
T TIGR00752         2 VKKGLLITALAFLLTGCIAVPKAIK   26 (190)
T ss_pred             CCHHHHHHHHHHHHHHHCCCCCCCC
T ss_conf             2014568889988753146742345


No 71 
>TIGR02887 spore_ger_x_C germination protein, Ger(x)C family; InterPro: IPR008844 The GerAA, -AB, and -AC proteins of the Bacillus subtilis spore are required for the germination response to L-alanine as the sole germinant. Members of GerAC family are thought to be located in the inner spore membrane. Although the function of this family is unclear, they are likely to encode the components of the germination apparatus that respond directly to this germinant, mediating the spore's response .; GO: 0009847 spore germination, 0016020 membrane.
Probab=55.93  E-value=8.5  Score=18.46  Aligned_cols=26  Identities=12%  Similarity=0.169  Sum_probs=18.9

Q ss_pred             CHHHHHHHHHHHHHHHHCCCCCCCCC
Q ss_conf             94789999999999975147887654
Q gi|254780953|r    1 MIKELGLSMFIMTTISGCGLASREKK   26 (190)
Q Consensus         1 m~k~l~l~~~~~~~l~g~~~~~~~~~   26 (190)
                      ++.++.+.++++++|+||...-.-+.
T Consensus         1 ~~~~~~~~~~~~~lL~GCwd~~ei~~   26 (400)
T TIGR02887         1 KKLKILLLILALLLLTGCWDKREIED   26 (400)
T ss_pred             CHHHHHHHHHHHHHHCCCCCCHHHHH
T ss_conf             94667899999998326656200642


No 72 
>PRK04405 prsA peptidylprolyl isomerase; Provisional
Probab=55.10  E-value=12  Score=17.66  Aligned_cols=22  Identities=18%  Similarity=0.448  Sum_probs=12.7

Q ss_pred             CHHHHHHHHHH---HHHHHHCCCCC
Q ss_conf             94789999999---99997514788
Q gi|254780953|r    1 MIKELGLSMFI---MTTISGCGLAS   22 (190)
Q Consensus         1 m~k~l~l~~~~---~~~l~g~~~~~   22 (190)
                      +||++++++.+   ++.|+||++.+
T Consensus         4 ~MKK~~l~~~~~~~~l~LaaCss~~   28 (298)
T PRK04405          4 KMKKWALAAASAGLLLSLAGCSSNN   28 (298)
T ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCC
T ss_conf             7899999999999999998717999


No 73 
>COG5510 Predicted small secreted protein [Function unknown]
Probab=55.10  E-value=9.7  Score=18.13  Aligned_cols=21  Identities=24%  Similarity=0.566  Sum_probs=12.7

Q ss_pred             CHHH----HHHHHHHHHHHHHCCCC
Q ss_conf             9478----99999999999751478
Q gi|254780953|r    1 MIKE----LGLSMFIMTTISGCGLA   21 (190)
Q Consensus         1 m~k~----l~l~~~~~~~l~g~~~~   21 (190)
                      |||+    +++++++.+++++|-..
T Consensus         1 mmk~t~l~i~~vll~s~llaaCNT~   25 (44)
T COG5510           1 MMKKTILLIALVLLASTLLAACNTM   25 (44)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             9048999999999999999886630


No 74 
>PRK03095 prsA peptidylprolyl isomerase; Reviewed
Probab=55.02  E-value=13  Score=17.39  Aligned_cols=24  Identities=25%  Similarity=0.400  Sum_probs=12.9

Q ss_pred             CHHHHHH-HHHHHHHHHHCCCCCCC
Q ss_conf             9478999-99999999751478876
Q gi|254780953|r    1 MIKELGL-SMFIMTTISGCGLASRE   24 (190)
Q Consensus         1 m~k~l~l-~~~~~~~l~g~~~~~~~   24 (190)
                      |.|.+.. +++.+++|+||+..+..
T Consensus         1 MKK~~la~~~~svl~LaaC~~~~~~   25 (287)
T PRK03095          1 MKKAMLALAATSVIALSACGTSSSD   25 (287)
T ss_pred             CCHHHHHHHHHHHHHHHHCCCCCCC
T ss_conf             9078999999999999851689987


No 75 
>COG4764 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=54.71  E-value=11  Score=17.93  Aligned_cols=24  Identities=17%  Similarity=0.409  Sum_probs=16.3

Q ss_pred             CHHHHHHHHHHHHHHHHCCCCCCCCC
Q ss_conf             94789999999999975147887654
Q gi|254780953|r    1 MIKELGLSMFIMTTISGCGLASREKK   26 (190)
Q Consensus         1 m~k~l~l~~~~~~~l~g~~~~~~~~~   26 (190)
                      ||+.++.++  +++|+||++.+....
T Consensus         5 ~~r~~~~v~--lL~LagCaTaP~~~~   28 (197)
T COG4764           5 MMRLVFAVV--LLALAGCATAPSQVN   28 (197)
T ss_pred             HHHHHHHHH--HHHHHHCCCCCCCCC
T ss_conf             698999999--999703036876765


No 76 
>PRK11251 DNA-binding transcriptional activator OsmE; Provisional
Probab=54.44  E-value=12  Score=17.55  Aligned_cols=25  Identities=16%  Similarity=0.325  Sum_probs=19.8

Q ss_pred             CHHHHHHHHHHHHHHHHCCCCCCCC
Q ss_conf             9478999999999997514788765
Q gi|254780953|r    1 MIKELGLSMFIMTTISGCGLASREK   25 (190)
Q Consensus         1 m~k~l~l~~~~~~~l~g~~~~~~~~   25 (190)
                      |++.+..+.+.+.+|+||++....+
T Consensus         1 ~~~~~l~aaa~~~~LaGCt~~d~~~   25 (109)
T PRK11251          1 NMAGILSAAAVLTMLAGCTAYDRNP   25 (109)
T ss_pred             CCHHHHHHHHHHHHHHHCCCCCCCH
T ss_conf             9025889999999997144776781


No 77 
>PRK13835 conjugal transfer protein TrbH; Provisional
Probab=53.56  E-value=17  Score=16.78  Aligned_cols=25  Identities=20%  Similarity=0.352  Sum_probs=18.2

Q ss_pred             HHHHHHHHHHHHHHHHCCCCCCCCC
Q ss_conf             4789999999999975147887654
Q gi|254780953|r    2 IKELGLSMFIMTTISGCGLASREKK   26 (190)
Q Consensus         2 ~k~l~l~~~~~~~l~g~~~~~~~~~   26 (190)
                      |+++...+++..+++||.+....-.
T Consensus         1 mr~ll~~~i~a~~lsgCqta~dglt   25 (144)
T PRK13835          1 MRRLLAACILALLLSGCQTATDGLT   25 (144)
T ss_pred             CHHHHHHHHHHHHHHHCCCCCCCCC
T ss_conf             9559999999998640413688644


No 78 
>TIGR03502 lipase_Pla1_cef extracellular lipase, Pla-1/cef family. Members of this protein family are bacterial lipoproteins largely from the Gammaproteobacteria. Characterized members are expressed in extracellularly and have esterase activity. Members include the lipase Pla-1 from Aeromonas hydrophila (AF092033) and CHO cell elongation factor (cef) from Vibrio hollisae
Probab=53.28  E-value=13  Score=17.40  Aligned_cols=19  Identities=42%  Similarity=0.758  Sum_probs=11.8

Q ss_pred             HHHHHHHHHHHHH--HHHCCC
Q ss_conf             4789999999999--975147
Q gi|254780953|r    2 IKELGLSMFIMTT--ISGCGL   20 (190)
Q Consensus         2 ~k~l~l~~~~~~~--l~g~~~   20 (190)
                      |||+++.++++..  |+||+.
T Consensus         1 MKk~~l~~~iasal~LagCGg   21 (792)
T TIGR03502         1 MKKLLLSLAIASALGLAGCGD   21 (792)
T ss_pred             CCHHHHHHHHHHHHHHHCCCC
T ss_conf             933789999999875004578


No 79 
>pfam12262 Lipase_bact_N Bacterial virulence factor lipase N-terminal. This domain family is found in bacteria, and is typically between 258 and 271 amino acids in length. There are two conserved sequence motifs: DGT and DGWST. This family is the N-terminal region of bacterial virulence factor lipase. The N-terminal region contains a potential signalling sequence.
Probab=53.12  E-value=12  Score=17.69  Aligned_cols=24  Identities=25%  Similarity=0.508  Sum_probs=13.7

Q ss_pred             CHHHHHHHHHHHH--HHHHCCCCCCCC
Q ss_conf             9478999999999--997514788765
Q gi|254780953|r    1 MIKELGLSMFIMT--TISGCGLASREK   25 (190)
Q Consensus         1 m~k~l~l~~~~~~--~l~g~~~~~~~~   25 (190)
                      |+| +++.++++.  .|+||+..+..+
T Consensus         1 MKk-~~l~~~i~SAL~LaGCg~~s~~~   26 (269)
T pfam12262         1 MKK-KFLALLLASALLLAGCGDDTETS   26 (269)
T ss_pred             CCH-HHHHHHHHHHHHHCCCCCCCCCC
T ss_conf             924-79999999986411157996566


No 80 
>TIGR02269 TIGR02269 Myxococcus xanthus paralogous lipoprotein family TIGR02269; InterPro: IPR011755   This family consists of at least 9 paralogs in Myxococcus xanthus, a member of the Deltaproteobacteria. One appears truncated toward the N-terminus; the others are predicted lipoproteins. The function is unknown..
Probab=51.31  E-value=12  Score=17.73  Aligned_cols=23  Identities=13%  Similarity=0.296  Sum_probs=17.3

Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCC
Q ss_conf             99999999997514788765444
Q gi|254780953|r    6 GLSMFIMTTISGCGLASREKKKV   28 (190)
Q Consensus         6 ~l~~~~~~~l~g~~~~~~~~~~~   28 (190)
                      .++.+++++++||+++.......
T Consensus         2 l~~~lla~ll~GCa~~~~~~dP~   24 (228)
T TIGR02269         2 LLLLLLALLLVGCASTAPKSDPP   24 (228)
T ss_pred             HHHHHHHHHHHHHCCCCCCCCCH
T ss_conf             57998899987520578778740


No 81 
>pfam00543 P-II Nitrogen regulatory protein P-II. P-II modulates the activity of glutamine synthetase.
Probab=50.86  E-value=19  Score=16.53  Aligned_cols=32  Identities=25%  Similarity=0.276  Sum_probs=21.8

Q ss_pred             HHHHHHHHHHHHHCCCCCCEEEEEEECCCCCC
Q ss_conf             99999999888523874516999970345888
Q gi|254780953|r  132 ERADVIKSYLIQRGVSSNRFISVRGFAYKYPI  163 (190)
Q Consensus       132 ~RA~~V~~~L~~~g~~~~r~i~v~g~G~~~p~  163 (190)
                      .+.+.|++.|...|+..--...+.|+|..++.
T Consensus         8 ~kl~~v~~AL~~~G~~g~Tv~~v~G~G~q~g~   39 (102)
T pfam00543         8 EKLDEVKEALEKAGVPGMTVTEVKGRGRQKGH   39 (102)
T ss_pred             HHHHHHHHHHHHCCCCCEEEEEEEEECCCCCC
T ss_conf             99999999999779985899982897677774


No 82 
>PRK10002 outer membrane protein F; Provisional
Probab=50.84  E-value=12  Score=17.64  Aligned_cols=20  Identities=15%  Similarity=0.145  Sum_probs=14.2

Q ss_pred             CHHHHHHHHHHHHHHHHCCC
Q ss_conf             94789999999999975147
Q gi|254780953|r    1 MIKELGLSMFIMTTISGCGL   20 (190)
Q Consensus         1 m~k~l~l~~~~~~~l~g~~~   20 (190)
                      |||+..|++++..++++.+.
T Consensus         1 mMKK~~LA~ai~all~ag~a   20 (362)
T PRK10002          1 MMKRNILAVIVPALLVAGTA   20 (362)
T ss_pred             CCHHHHHHHHHHHHHHHCCC
T ss_conf             93087999999999860644


No 83 
>pfam02402 Lysis_col Lysis protein. These small bacterial proteins are required for colicin release and partial cell lysis. This family contains lysis proteins for several different forms of colicin. Bacillus subtilis lytA has been included in this family, the similarity is not highly significant, however it is also a short protein, that is involved in secretion of other proteins (Bateman A pers. obs.).
Probab=50.74  E-value=7.8  Score=18.67  Aligned_cols=28  Identities=18%  Similarity=0.253  Sum_probs=17.1

Q ss_pred             CHHHHHHHHHHH-HHHHHCCCCCCCCCCC
Q ss_conf             947899999999-9997514788765444
Q gi|254780953|r    1 MIKELGLSMFIM-TTISGCGLASREKKKV   28 (190)
Q Consensus         1 m~k~l~l~~~~~-~~l~g~~~~~~~~~~~   28 (190)
                      |+|.+++.++++ ++++||....-...+.
T Consensus         1 Mkki~~~~i~~~~~~L~aCQaNyiRDvqG   29 (46)
T pfam02402         1 MKKILFIGILLLTVLLSACQANYIRDVQG   29 (46)
T ss_pred             CCEEEEHHHHHHHHHHHHHHHHHEEECCC
T ss_conf             92420139999999999855504122568


No 84 
>COG4851 CamS Protein involved in sex pheromone biosynthesis [General function prediction only]
Probab=50.34  E-value=16  Score=16.99  Aligned_cols=25  Identities=28%  Similarity=0.369  Sum_probs=18.2

Q ss_pred             CHHHHHHHHHHH-HHHHHCCCCCCCC
Q ss_conf             947899999999-9997514788765
Q gi|254780953|r    1 MIKELGLSMFIM-TTISGCGLASREK   25 (190)
Q Consensus         1 m~k~l~l~~~~~-~~l~g~~~~~~~~   25 (190)
                      |+|.+.|++..+ ++|+||+..-.+.
T Consensus         1 Mkktl~i~~ta~vliLs~C~~~~dd~   26 (382)
T COG4851           1 MKKTLGIAATASVLILSGCFPFVDDT   26 (382)
T ss_pred             CCHHHHHHHHHHHHHHHHCCCCCCCC
T ss_conf             94015589999999986116766873


No 85 
>pfam02698 DUF218 DUF218 domain. This large family of proteins contains several highly conserved charged amino acids, suggesting this may be an enzymatic domain (Bateman A pers. obs). The family includes SanA, which is involved in Vancomycin resistance. This protein may be involved in murein synthesis.
Probab=49.16  E-value=20  Score=16.37  Aligned_cols=56  Identities=20%  Similarity=0.364  Sum_probs=40.0

Q ss_pred             CHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCEE
Q ss_conf             9999999999999998589948999980377872001112258999999998885238745169
Q gi|254780953|r   89 EKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFI  152 (190)
Q Consensus        89 ~~~~~~~L~~ia~~l~~~~~~~i~I~GHTD~~g~~~~N~~LS~~RA~~V~~~L~~~g~~~~r~i  152 (190)
                      .+.....++.-+++.++.+...|.+.|-.-  +.   + .  ..-|+..++||+..|+++++++
T Consensus        12 ~~~~~~R~~~a~~l~~~g~~~~ii~sGg~~--~~---~-~--~~ea~~~~~~l~~~gvp~~~I~   67 (148)
T pfam02698        12 SPALAARLDAAAELYRAGPAPRIIVSGGAG--GG---E-P--VSEAEVMRRYLVELGVPAEAIL   67 (148)
T ss_pred             CHHHHHHHHHHHHHHHHCCCCEEEEECCCC--CC---C-C--CCHHHHHHHHHHHCCCCHHHEE
T ss_conf             877999999999999809998899848988--88---8-8--7899999999998698999977


No 86 
>TIGR02898 spore_YhcN_YlaJ sporulation lipoprotein,  YhcN/YlaJ family; InterPro: IPR014247   This entry contains YhcN and YlaJ, which are predicted lipoproteins that have been detected as spore proteins but not vegetative proteins in Bacillus subtilis. Both appear to be expressed under control of the RNA polymerase sigma-G factor. The YlaJ-like members of this family have a low-complexity, strongly acidic, 40-residue C-terminal domain. .
Probab=48.15  E-value=13  Score=17.39  Aligned_cols=21  Identities=19%  Similarity=0.517  Sum_probs=16.6

Q ss_pred             HHHHHHHHHHH--HHCCCCCCCC
Q ss_conf             99999999999--7514788765
Q gi|254780953|r    5 LGLSMFIMTTI--SGCGLASREK   25 (190)
Q Consensus         5 l~l~~~~~~~l--~g~~~~~~~~   25 (190)
                      |++.|+++++|  +||+......
T Consensus         2 l~~~ll~~~~l~~tgC~~~~~~~   24 (185)
T TIGR02898         2 LFIILLLLLLLLATGCTNAQKKS   24 (185)
T ss_pred             HHHHHHHHHHHHHHCCCCCCCCC
T ss_conf             68899999999873134100146


No 87 
>cd03527 RuBisCO_small Ribulose bisphosphate carboxylase/oxygenase (Rubisco), small subunit. Rubisco is a bifunctional enzyme catalyzes the initial steps of two opposing metabolic pathways: photosynthetic carbon fixation and the competing process of photorespiration. Rubisco Form I, present in plants and green algae, is composed of eight large and eight small subunits. The nearly identical small subunits are encoded by a family of nuclear genes. After translation, the small subunits are translocated across the chloroplast membrane, where an N-terminal signal peptide is cleaved off. While the large subunits contain the catalytic activities, it has been shown that the small subunits are important for catalysis by enhancing the catalytic rate through inducing conformational changes in the large subunits.
Probab=47.98  E-value=21  Score=16.27  Aligned_cols=29  Identities=10%  Similarity=0.206  Sum_probs=22.0

Q ss_pred             HHHHHHHHHHHHHHHCCCCEEEEEEECCC
Q ss_conf             99999999999998589948999980377
Q gi|254780953|r   91 KFLPMLQLIATILNKFPSTVIAIQSHTDS  119 (190)
Q Consensus        91 ~~~~~L~~ia~~l~~~~~~~i~I~GHTD~  119 (190)
                      +...+|.+|....+.+|+..|+|.|+-..
T Consensus        58 d~~~Vl~Eie~C~k~~p~~yVRligfD~~   86 (99)
T cd03527          58 DPAQVLREIEACRKAYPDHYVRVVGFDNY   86 (99)
T ss_pred             CHHHHHHHHHHHHHHCCCCEEEEEEEECC
T ss_conf             99999999999999899866999998087


No 88 
>pfam11153 DUF2931 Protein of unknown function (DUF2931). Some members in this family of proteins are annotated as lipoproteins however this cannot be confirmed. Currently, there is no known function.
Probab=47.97  E-value=16  Score=16.97  Aligned_cols=19  Identities=16%  Similarity=0.590  Sum_probs=12.1

Q ss_pred             HHHHHHHHHHHHHHHHCCCC
Q ss_conf             47899999999999751478
Q gi|254780953|r    2 IKELGLSMFIMTTISGCGLA   21 (190)
Q Consensus         2 ~k~l~l~~~~~~~l~g~~~~   21 (190)
                      |+++.+ ++++++++||+.+
T Consensus         1 m~~i~~-ll~~lll~aCs~s   19 (202)
T pfam11153         1 MKKILL-LLLLLLLTACSTS   19 (202)
T ss_pred             CHHHHH-HHHHHHHHHHCCC
T ss_conf             901489-9999998760257


No 89 
>PRK11063 metQ DL-methionine transporter substrate-binding subunit; Provisional
Probab=46.89  E-value=22  Score=16.17  Aligned_cols=17  Identities=18%  Similarity=0.560  Sum_probs=10.4

Q ss_pred             HHHHHHHHHHCCCCCCC
Q ss_conf             99999999751478876
Q gi|254780953|r    8 SMFIMTTISGCGLASRE   24 (190)
Q Consensus         8 ~~~~~~~l~g~~~~~~~   24 (190)
                      +++++++++||++...+
T Consensus        13 ~l~~~l~l~gCg~~~~~   29 (271)
T PRK11063         13 ALIGSLALVGCGQDEKD   29 (271)
T ss_pred             HHHHHHHHCCCCCCCCC
T ss_conf             99999975005898567


No 90 
>PRK11189 lipoprotein NlpI; Provisional
Probab=46.76  E-value=22  Score=16.16  Aligned_cols=23  Identities=17%  Similarity=0.290  Sum_probs=14.7

Q ss_pred             CHHHHHHHHHH--HHHHHHCCCCCC
Q ss_conf             94789999999--999975147887
Q gi|254780953|r    1 MIKELGLSMFI--MTTISGCGLASR   23 (190)
Q Consensus         1 m~k~l~l~~~~--~~~l~g~~~~~~   23 (190)
                      |++.+-..+++  +++++||++.+.
T Consensus         1 m~~~~r~~~~~~~~l~LsGC~s~~~   25 (297)
T PRK11189          1 MKPFLRWCFVATAALLLAGCASSNT   25 (297)
T ss_pred             CCHHHHHHHHHHHHHHHHHHCCCCC
T ss_conf             9518999999999999986405887


No 91 
>PRK10665 nitrogen regulatory protein P-II 2; Provisional
Probab=46.05  E-value=23  Score=16.09  Aligned_cols=31  Identities=16%  Similarity=0.262  Sum_probs=19.6

Q ss_pred             HHHHHHHHHHHHHCCCCCCEEEEEEECCCCC
Q ss_conf             9999999988852387451699997034588
Q gi|254780953|r  132 ERADVIKSYLIQRGVSSNRFISVRGFAYKYP  162 (190)
Q Consensus       132 ~RA~~V~~~L~~~g~~~~r~i~v~g~G~~~p  162 (190)
                      .|.+.|++.|...|+..--...+.|||..+.
T Consensus        11 ~kl~~vk~aL~~~G~~g~Tv~~V~G~G~q~g   41 (112)
T PRK10665         11 FKLEDVREALSSIGIQGLTVTEVKGFGRQKG   41 (112)
T ss_pred             HHHHHHHHHHHHCCCCEEEEEECEEECCCCC
T ss_conf             9999999999978997399984868756887


No 92 
>pfam07273 DUF1439 Protein of unknown function (DUF1439). This family consists of several hypothetical bacterial proteins of around 190 residues in length. Several members of this family are annotated as being putative lipoproteins and are often known as YceB. The function of this family is unknown.
Probab=45.74  E-value=18  Score=16.63  Aligned_cols=20  Identities=35%  Similarity=0.542  Sum_probs=13.7

Q ss_pred             CHHHHHHHHHHHHHHHHCCC
Q ss_conf             94789999999999975147
Q gi|254780953|r    1 MIKELGLSMFIMTTISGCGL   20 (190)
Q Consensus         1 m~k~l~l~~~~~~~l~g~~~   20 (190)
                      |++.+.+.++++++++||..
T Consensus         1 Mk~~~~~~~~l~~~LsgC~~   20 (177)
T pfam07273         1 MKKLLLLILLLVLLLSGCAS   20 (177)
T ss_pred             CCHHHHHHHHHHHHHHCCCC
T ss_conf             91489999999999715575


No 93 
>pfam06935 DUF1284 Protein of unknown function (DUF1284). This family consists of several hypothetical bacterial and archaeal proteins of around 130 residues in length. The function of this family is unknown, although it is thought that they may be iron-sulphur binding proteins.
Probab=44.19  E-value=24  Score=15.92  Aligned_cols=61  Identities=18%  Similarity=0.274  Sum_probs=39.3

Q ss_pred             CHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCC----CHH----HHHHHHHHHHHHHHHHHHHHCCCCCCEE
Q ss_conf             999999999999999858994899998037787----200----1112258999999998885238745169
Q gi|254780953|r   89 EKKFLPMLQLIATILNKFPSTVIAIQSHTDSIG----TLK----NNLLISQERADVIKSYLIQRGVSSNRFI  152 (190)
Q Consensus        89 ~~~~~~~L~~ia~~l~~~~~~~i~I~GHTD~~g----~~~----~N~~LS~~RA~~V~~~L~~~g~~~~r~i  152 (190)
                      ++++....++|+..|+..|+..|.|...+|..=    ...    .+...=..|=..|...|   |+.+...+
T Consensus         3 S~~Fv~Nm~~I~~~l~~~~~~~I~lV~~~DdIC~~CP~~~~~~C~~~~kV~~~D~~vl~~l---gl~~g~~~   71 (103)
T pfam06935         3 SPEFVENMDKIVERLRAEPGEDIELVDGPDDICAPCPNKREGLCTSESKVRERDRRVLELL---GIKPGKVL   71 (103)
T ss_pred             CHHHHHHHHHHHHHHHHCCCCCEEEEECCCHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHC---CCCCCCEE
T ss_conf             8799999999999998788995798868177877199999994688589999999999984---99988788


No 94 
>PRK12788 flgH flagellar basal body L-ring protein; Reviewed
Probab=44.16  E-value=24  Score=15.92  Aligned_cols=21  Identities=14%  Similarity=0.418  Sum_probs=14.4

Q ss_pred             HHHHHHHHHHHHHHHHCCCCCC
Q ss_conf             4789999999999975147887
Q gi|254780953|r    2 IKELGLSMFIMTTISGCGLASR   23 (190)
Q Consensus         2 ~k~l~l~~~~~~~l~g~~~~~~   23 (190)
                      || ++++++.+++|+||+....
T Consensus         1 mr-~l~~~~a~l~LsGCa~~~~   21 (231)
T PRK12788          1 MR-LLVAILACLALAGCANNLA   21 (231)
T ss_pred             CC-HHHHHHHHHHHHHHCCCCC
T ss_conf             90-8999999999764038743


No 95 
>PRK02463 OxaA-like protein precursor; Provisional
Probab=44.03  E-value=24  Score=15.91  Aligned_cols=18  Identities=22%  Similarity=0.543  Sum_probs=12.0

Q ss_pred             HHHHHHHHHHHCCCCCCC
Q ss_conf             999999999751478876
Q gi|254780953|r    7 LSMFIMTTISGCGLASRE   24 (190)
Q Consensus         7 l~~~~~~~l~g~~~~~~~   24 (190)
                      +++.++++++||..++..
T Consensus        13 ~~~~~~l~LsgC~~~~~~   30 (307)
T PRK02463         13 LALSMLLTLTGCVGRDKH   30 (307)
T ss_pred             HHHHHHHHHHCCCCCCCC
T ss_conf             999999999634689999


No 96 
>PRK04792 tolB translocation protein TolB; Provisional
Probab=43.50  E-value=19  Score=16.50  Aligned_cols=20  Identities=30%  Similarity=0.458  Sum_probs=12.4

Q ss_pred             CHHHHHHHHHHHHH-HHHCCC
Q ss_conf             94789999999999-975147
Q gi|254780953|r    1 MIKELGLSMFIMTT-ISGCGL   20 (190)
Q Consensus         1 m~k~l~l~~~~~~~-l~g~~~   20 (190)
                      |||++++.+|++++ ++.++.
T Consensus         1 M~k~~~~~l~lll~~~s~~A~   21 (450)
T PRK04792          1 MLKRLILGLFVLLLSFSQVAN   21 (450)
T ss_pred             CCHHHHHHHHHHHHHHHHHHE
T ss_conf             938999999999998657520


No 97 
>cd00145 POLBc DNA polymerase type-B family catalytic domain. DNA-directed DNA polymerases elongate DNA by adding nucleotide triphosphate (dNTP) residues to the 5'-end of the growing chain of DNA. DNA-directed DNA polymerases are multifunctional with both synthetic (polymerase) and degradative modes (exonucleases) and play roles in the processes of DNA replication, repair, and recombination. DNA-dependent DNA polymerases can be classified in six main groups based upon their phylogenetic relationships with E. coli polymerase I (class A), E. coli polymerase II (class B), E. coli polymerase III (class C), euryarchaeota polymerase II (class D), human polymerase beta (class x), E. coli UmuC/DinB, and eukaryotic RAP 30/Xeroderma pigmentosum variant (class Y).  Family B DNA polymerases include E. coli DNA polymerase II, some eubacterial phage DNA polymerases, nuclear replicative DNA polymerases (alpha, delta, epsilon, and zeta), and eukaryotic viral and plasmid-borne enzymes. DNA polymerase is
Probab=43.31  E-value=25  Score=15.85  Aligned_cols=34  Identities=18%  Similarity=0.172  Sum_probs=28.6

Q ss_pred             HHHCCHHHHHHHHHHHHHHHHCCCCEEEEEEECCCC
Q ss_conf             131099999999999999985899489999803778
Q gi|254780953|r   85 EVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSI  120 (190)
Q Consensus        85 ~a~l~~~~~~~L~~ia~~l~~~~~~~i~I~GHTD~~  120 (190)
                      .+.++..++..|.....+++++ +..| |.|.|||.
T Consensus       131 A~siT~~GR~~i~~~~~~ie~~-g~~V-IYGDTDSi  164 (323)
T cd00145         131 AASITSFGREIIQDTIALVEEH-GARV-IYGDTDSI  164 (323)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHC-CCEE-EEECCCEE
T ss_conf             7898698999999999999983-9977-99757605


No 98 
>PRK09859 multidrug efflux system protein MdtE; Provisional
Probab=42.94  E-value=25  Score=15.81  Aligned_cols=22  Identities=23%  Similarity=0.404  Sum_probs=12.2

Q ss_pred             HHHHH-HHHHHHHHHHCCCCCCC
Q ss_conf             78999-99999999751478876
Q gi|254780953|r    3 KELGL-SMFIMTTISGCGLASRE   24 (190)
Q Consensus         3 k~l~l-~~~~~~~l~g~~~~~~~   24 (190)
                      |++.+ ++++.++++||+..+..
T Consensus         5 ~~~li~ll~~~~lL~gC~~~~~~   27 (385)
T PRK09859          5 RKLLIPLLFCGAMLTACDDKSAE   27 (385)
T ss_pred             HHHHHHHHHHHHHHHCCCCCCCC
T ss_conf             67899999999999537999768


No 99 
>PRK10598 hypothetical protein; Provisional
Probab=42.49  E-value=21  Score=16.28  Aligned_cols=21  Identities=19%  Similarity=0.520  Sum_probs=13.0

Q ss_pred             HHHHHH--HHHHHHHHHHCCCCC
Q ss_conf             478999--999999997514788
Q gi|254780953|r    2 IKELGL--SMFIMTTISGCGLAS   22 (190)
Q Consensus         2 ~k~l~l--~~~~~~~l~g~~~~~   22 (190)
                      ||++++  +++++.+++||+.-+
T Consensus         1 mkk~~l~~~l~l~~llsGC~~l~   23 (186)
T PRK10598          1 MKKFLLAAALLVSGLLVGCNQLT   23 (186)
T ss_pred             CCHHHHHHHHHHHHHHHCCCCCC
T ss_conf             91269999999999971435336


No 100
>PRK10523 lipoprotein involved with copper homeostasis and adhesion; Provisional
Probab=42.33  E-value=26  Score=15.76  Aligned_cols=30  Identities=27%  Similarity=0.424  Sum_probs=18.7

Q ss_pred             HHHHHHHHHHCCCC-CCEEEEEEECCCCCCC
Q ss_conf             99999888523874-5169999703458889
Q gi|254780953|r  135 DVIKSYLIQRGVSS-NRFISVRGFAYKYPID  164 (190)
Q Consensus       135 ~~V~~~L~~~g~~~-~r~i~v~g~G~~~p~~  164 (190)
                      +-=+.|+..++... +-++.+.||-.-+|--
T Consensus       178 ~LEr~Y~~~r~~~G~Pv~~~veG~~t~rPsm  208 (234)
T PRK10523        178 ELERGYLAARGNSGKPVLLTVEGHFTLRPSP  208 (234)
T ss_pred             HHHHHHHHCCCCCCCEEEEEEEEEEEECCCC
T ss_conf             9999999716899974899997787743680


No 101
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL. Members of this protein family are YfgL, a lipoprotein component of a complex that acts protein insertion into the bacterial outer membrane. Other members of this complex are NlpB, YfiO, and YaeT. This protein contains multiple copies of a repeat that, in other contexts, are associated with binding of the coenzyme PQQ.
Probab=42.19  E-value=24  Score=15.97  Aligned_cols=22  Identities=32%  Similarity=0.552  Sum_probs=16.7

Q ss_pred             HHHHHHHHHHHHHHHCCCCCCC
Q ss_conf             7899999999999751478876
Q gi|254780953|r    3 KELGLSMFIMTTISGCGLASRE   24 (190)
Q Consensus         3 k~l~l~~~~~~~l~g~~~~~~~   24 (190)
                      |++.+.++++++++||+....+
T Consensus         1 ~~~~~~~~~~~~l~gCs~~~~~   22 (377)
T TIGR03300         1 KRLALVIALAALLSGCSWFSSK   22 (377)
T ss_pred             CCCHHHHHHHHHHHHCCCCCCC
T ss_conf             9238999999998556576799


No 102
>COG3133 SlyB Outer membrane lipoprotein [Cell envelope biogenesis, outer membrane]
Probab=41.61  E-value=20  Score=16.37  Aligned_cols=25  Identities=20%  Similarity=0.323  Sum_probs=16.5

Q ss_pred             CHHHHHHHH-HHHHHHHHCCCCCCCC
Q ss_conf             947899999-9999997514788765
Q gi|254780953|r    1 MIKELGLSM-FIMTTISGCGLASREK   25 (190)
Q Consensus         1 m~k~l~l~~-~~~~~l~g~~~~~~~~   25 (190)
                      |.|.+++.. +.++.|+||.......
T Consensus         1 M~k~~~avA~~~al~L~GCan~d~~S   26 (154)
T COG3133           1 MIKTALAVAALMALSLTGCANNDTLS   26 (154)
T ss_pred             CCHHHHHHHHHHHHHCCCCCCCCCCC
T ss_conf             94257899999887400110587436


No 103
>COG5645 Predicted periplasmic lipoprotein [General function prediction only]
Probab=41.27  E-value=9.8  Score=18.12  Aligned_cols=22  Identities=27%  Similarity=0.668  Sum_probs=16.2

Q ss_pred             HHHHHHHHHHHHHHHHCCCCCC
Q ss_conf             4789999999999975147887
Q gi|254780953|r    2 IKELGLSMFIMTTISGCGLASR   23 (190)
Q Consensus         2 ~k~l~l~~~~~~~l~g~~~~~~   23 (190)
                      |+++.+.+...++++||++.-+
T Consensus         1 mr~i~l~l~v~lllSGC~SV~s   22 (80)
T COG5645           1 MRNILLSLMVLLLLSGCGSVIS   22 (80)
T ss_pred             CCEEHHHHHHHHHHCCCCEEEE
T ss_conf             9153278999998376410377


No 104
>pfam06572 DUF1131 Protein of unknown function (DUF1131). This family consists of several hypothetical bacterial proteins of unknown function.
Probab=40.92  E-value=27  Score=15.63  Aligned_cols=29  Identities=14%  Similarity=0.091  Sum_probs=17.8

Q ss_pred             CHHHHHHHHHHHHHHHHCCCCCCCCCCCC
Q ss_conf             94789999999999975147887654444
Q gi|254780953|r    1 MIKELGLSMFIMTTISGCGLASREKKKVF   29 (190)
Q Consensus         1 m~k~l~l~~~~~~~l~g~~~~~~~~~~~~   29 (190)
                      |+...++.+.+.++|+||+..+.-.+...
T Consensus         1 ~~~~r~~l~~~~llL~GCst~s~fsWSsl   29 (192)
T pfam06572         1 MKSLRLFLLALPLLLTGCSTLSNFSWSSL   29 (192)
T ss_pred             CCCHHHHHHHHHHHHHCCCCCCCCCCCCC
T ss_conf             94301368776688606556688542226


No 105
>PRK01622 OxaA-like protein precursor; Validated
Probab=40.34  E-value=28  Score=15.58  Aligned_cols=17  Identities=35%  Similarity=0.712  Sum_probs=10.5

Q ss_pred             HHHHHHHHHHHCCCCCC
Q ss_conf             99999999975147887
Q gi|254780953|r    7 LSMFIMTTISGCGLASR   23 (190)
Q Consensus         7 l~~~~~~~l~g~~~~~~   23 (190)
                      ++++++++++||+.+..
T Consensus        12 ~~~~~~~~lsgc~~~~~   28 (266)
T PRK01622         12 LSLLLVFVLSGCSNAAP   28 (266)
T ss_pred             HHHHHHHHHHCCCCCCC
T ss_conf             99999999954689999


No 106
>cd00741 Lipase Lipase.  Lipases are esterases that can hydrolyze long-chain acyl-triglycerides into di- and monoglycerides, glycerol, and free fatty acids at a water/lipid interface.  A typical feature of lipases is "interfacial activation", the process of becoming active at the lipid/water interface, although several examples of lipases have been identified that do not undergo interfacial activation . The active site of a lipase contains a catalytic triad consisting of Ser - His - Asp/Glu, but unlike most serine proteases, the active site is buried inside the structure.  A "lid" or "flap" covers the active site, making it inaccessible to solvent and substrates. The lid opens during the process of interfacial activation, allowing the lipid substrate access to the active site.
Probab=40.12  E-value=28  Score=15.56  Aligned_cols=62  Identities=21%  Similarity=0.270  Sum_probs=42.4

Q ss_pred             HHHHHHHHHHHHHHCCCCEEEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCCC
Q ss_conf             999999999999858994899998037787200111225899999999888523874516999970345888997
Q gi|254780953|r   92 FLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTN  166 (190)
Q Consensus        92 ~~~~L~~ia~~l~~~~~~~i~I~GHTD~~g~~~~N~~LS~~RA~~V~~~L~~~g~~~~r~i~v~g~G~~~p~~~n  166 (190)
                      .......+...+.++|+.+|.|.||.           |...=|.-...+|..+.  +.+.+.+.+||.-++-..+
T Consensus        11 ~~~~~~~~~~~~~~~p~~~l~vtGHS-----------LGgalA~l~a~~l~~~~--~~~~~~~~tfg~Prvg~~~   72 (153)
T cd00741          11 ANLVLPLLKSALAQYPDYKIHVTGHS-----------LGGALAGLAGLDLRGRG--LGRLVRVYTFGPPRVGNAA   72 (153)
T ss_pred             HHHHHHHHHHHHHHCCCCEEEEEEEC-----------HHHHHHHHHHHHHHHHC--CCCCEEEEEECCCCCCCHH
T ss_conf             99999999999998899779999636-----------27899999999999727--8975289980898565511


No 107
>pfam09476 Pilus_CpaD Pilus biogenesis CpaD protein (pilus_cpaD). Proteins in this entry consist of a pilus biogenesis protein, CpaD, from Caulobacter, and homologues in other bacteria, including three in the root nodule bacterium Bradyrhizobium japonicum. The molecular function of the homologues is not known.
Probab=39.75  E-value=28  Score=15.53  Aligned_cols=75  Identities=16%  Similarity=0.085  Sum_probs=53.4

Q ss_pred             CHHHCCHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEEECCCCCC
Q ss_conf             81310999999999999999858994899998037787200111225899999999888523874516999970345888
Q gi|254780953|r   84 SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPI  163 (190)
Q Consensus        84 ~~a~l~~~~~~~L~~ia~~l~~~~~~~i~I~GHTD~~g~~~~N~~LS~~RA~~V~~~L~~~g~~~~r~i~v~g~G~~~p~  163 (190)
                      +...|++..+..|..++.-....-.-.|.|.=.     +...|-.-+..=+..|+..|...|+.+.+ |.+.+|-...|.
T Consensus        47 ~~~~Lt~~qr~~l~~f~~~~~~~g~g~i~I~~P-----sgs~n~~aa~~~~~~ir~~l~~~Gv~~~~-I~~~~y~~~~~~  120 (200)
T pfam09476        47 GRGGLTASQRARLAGFAARYGRRGAGPLVIDVP-----SGSPNARAASALSAEVRALLAAAGVPPSN-ISVRAYDAAGAR  120 (200)
T ss_pred             CCCCCCHHHHHHHHHHHHHHHCCCCCEEEEECC-----CCCCCHHHHHHHHHHHHHHHHHCCCCHHH-EEECCCCCCCCC
T ss_conf             889889999999999999984568861899758-----99863578999999999999985998431-554225777878


Q ss_pred             C
Q ss_conf             9
Q gi|254780953|r  164 D  164 (190)
Q Consensus       164 ~  164 (190)
                      .
T Consensus       121 ~  121 (200)
T pfam09476       121 A  121 (200)
T ss_pred             C
T ss_conf             8


No 108
>COG3111 Periplasmic protein with OB-fold [Function unknown]
Probab=39.70  E-value=19  Score=16.46  Aligned_cols=17  Identities=24%  Similarity=0.268  Sum_probs=13.5

Q ss_pred             HHCCCCEEEEEEECCCC
Q ss_conf             85899489999803778
Q gi|254780953|r  104 NKFPSTVIAIQSHTDSI  120 (190)
Q Consensus       104 ~~~~~~~i~I~GHTD~~  120 (190)
                      .-.|+..|.|.|--|..
T Consensus        97 tv~P~dkV~I~GevDk~  113 (128)
T COG3111          97 TVTPKDKVRIQGEVDKD  113 (128)
T ss_pred             CCCCCCEEEEEEEECCC
T ss_conf             06856689997687378


No 109
>PRK03757 hypothetical protein; Provisional
Probab=39.58  E-value=23  Score=16.06  Aligned_cols=25  Identities=16%  Similarity=0.139  Sum_probs=13.7

Q ss_pred             HHHHHHHHHHHHHHHHCCCCCCCCC
Q ss_conf             4789999999999975147887654
Q gi|254780953|r    2 IKELGLSMFIMTTISGCGLASREKK   26 (190)
Q Consensus         2 ~k~l~l~~~~~~~l~g~~~~~~~~~   26 (190)
                      ||++++.++++.++.+++.+.....
T Consensus         1 mkk~~l~~~l~a~~~~~~~A~a~~y   25 (191)
T PRK03757          1 MKKTLLGLTLGSLLFSAGSAVAADY   25 (191)
T ss_pred             CCHHHHHHHHHHHHHHCCCCCCCCE
T ss_conf             9043999999999863040457527


No 110
>TIGR02963 xanthine_xdhA xanthine dehydrogenase, small subunit; InterPro: IPR014307   Members of this protein are the small subunit (or, in eukaryotes, the N-terminal domain) of xanthine dehydrogenase, an enzyme of purine catabolism via urate. The small subunit contains both an FAD and a 2Fe-2S cofactor. Aldehyde oxidase (retinal oxidase) appears to have arisen as a neofunctionalisation among xanthine dehydrogenases in eukaryotes. ; GO: 0004854 xanthine dehydrogenase activity, 0004855 xanthine oxidase activity, 0050660 FAD binding.
Probab=39.56  E-value=25  Score=15.85  Aligned_cols=24  Identities=25%  Similarity=0.357  Sum_probs=20.5

Q ss_pred             HHHHHHHHHHHCCCCEEEEEEECCC
Q ss_conf             9999999998589948999980377
Q gi|254780953|r   95 MLQLIATILNKFPSTVIAIQSHTDS  119 (190)
Q Consensus        95 ~L~~ia~~l~~~~~~~i~I~GHTD~  119 (190)
                      .++++|.++..+|+..| |.|=||=
T Consensus       234 t~~dLA~l~~a~P~Ari-vAGsTDV  257 (515)
T TIGR02963       234 TLDDLAALKAAHPKARI-VAGSTDV  257 (515)
T ss_pred             CHHHHHHHHHHCCCCEE-EECCEEH
T ss_conf             88999999972899589-9646004


No 111
>PRK06481 fumarate reductase flavoprotein subunit; Validated
Probab=39.42  E-value=29  Score=15.50  Aligned_cols=23  Identities=26%  Similarity=0.690  Sum_probs=15.5

Q ss_pred             HHHHHHHHHHHHHHCCCCCCCCC
Q ss_conf             89999999999975147887654
Q gi|254780953|r    4 ELGLSMFIMTTISGCGLASREKK   26 (190)
Q Consensus         4 ~l~l~~~~~~~l~g~~~~~~~~~   26 (190)
                      .+.+++++.++|+||+.......
T Consensus         7 ~~~~~~~~~~~~~~c~~~~~~~~   29 (506)
T PRK06481          7 TLGMLLLLALILTGCGSNTTSKS   29 (506)
T ss_pred             HHHHHHHHHHHHHHCCCCCCCCC
T ss_conf             99999999999865079999988


No 112
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein; InterPro: IPR005670   This is a family of phosphate transport system permease proteins.; GO: 0005315 inorganic phosphate transmembrane transporter activity, 0015114 phosphate transmembrane transporter activity, 0006817 phosphate transport, 0016020 membrane.
Probab=39.14  E-value=29  Score=15.47  Aligned_cols=84  Identities=19%  Similarity=0.121  Sum_probs=55.7

Q ss_pred             ECCCEECC-CHHHCCHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEE
Q ss_conf             52211128-81310999999999999999858994899998037787200111225899999999888523874516999
Q gi|254780953|r   76 IPVHVSFV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISV  154 (190)
Q Consensus        76 ~~~~~~f~-~~a~l~~~~~~~L~~ia~~l~~~~~~~i~I~GHTD~~g~~~~N~~LS~~RA~~V~~~L~~~g~~~~r~i~v  154 (190)
                      -|+.+++| +.|.|.|-+...+.++..-|++.  +.|.|.=|             +.+.|..|.+|-.=-  -..+++  
T Consensus       162 ePeVlLlDEPTSALDPIaT~~IEeLi~eLk~~--YTivIVTH-------------nMqQA~RiSD~tAFF--~~G~Lv--  222 (248)
T TIGR00972       162 EPEVLLLDEPTSALDPIATGKIEELIQELKKK--YTIVIVTH-------------NMQQAARISDRTAFF--YDGELV--  222 (248)
T ss_pred             CCCEECCCCCCCCCCHHHHHHHHHHHHHHHHC--CEEEEEEC-------------CHHHHHHHHHHHHHH--HCCEEE--
T ss_conf             88521057888757877899999999987652--97998817-------------756789999999886--567257--


Q ss_pred             EEECCCCCCCCCCCHHHHHCCCCEEEEEECC
Q ss_conf             9703458889976977985299169999301
Q gi|254780953|r  155 RGFAYKYPIDTNDTKVGRQNNQRIEIQIFPR  185 (190)
Q Consensus       155 ~g~G~~~p~~~n~~~~~ra~NRRVei~i~~~  185 (190)
                      + ||++.-+-.|.      +++|-|=+|..|
T Consensus       223 E-~G~T~~iF~~P------k~~~T~dYisGr  246 (248)
T TIGR00972       223 E-YGDTEQIFTNP------KEKRTEDYISGR  246 (248)
T ss_pred             E-ECCHHHHHHHH------HHHCCHHCCCCC
T ss_conf             4-07813876215------652000101457


No 113
>pfam00101 RuBisCO_small Ribulose bisphosphate carboxylase, small chain.
Probab=39.11  E-value=29  Score=15.47  Aligned_cols=28  Identities=7%  Similarity=0.204  Sum_probs=21.2

Q ss_pred             HHHHHHHHHHHHHHHCCCCEEEEEEECC
Q ss_conf             9999999999999858994899998037
Q gi|254780953|r   91 KFLPMLQLIATILNKFPSTVIAIQSHTD  118 (190)
Q Consensus        91 ~~~~~L~~ia~~l~~~~~~~i~I~GHTD  118 (190)
                      +..++|.+|-..++.+|+..|++.|+-.
T Consensus        57 d~~~Vl~ele~c~~~~p~~YVRliG~D~   84 (98)
T pfam00101        57 DAAQVLAELEECRKAYPGEYVRLIGFDN   84 (98)
T ss_pred             CHHHHHHHHHHHHHHCCCCEEEEEEECC
T ss_conf             9999999999999989987599999858


No 114
>PRK02939 hypothetical protein; Reviewed
Probab=39.01  E-value=16  Score=16.94  Aligned_cols=24  Identities=17%  Similarity=0.267  Sum_probs=17.9

Q ss_pred             HHHHHHHHHHHHHHHHCCCCCCCC
Q ss_conf             478999999999997514788765
Q gi|254780953|r    2 IKELGLSMFIMTTISGCGLASREK   25 (190)
Q Consensus         2 ~k~l~l~~~~~~~l~g~~~~~~~~   25 (190)
                      ||+..++++++++++||-......
T Consensus         1 ~k~~~~~~~l~~~L~gCD~~~al~   24 (236)
T PRK02939          1 MKYKLLPCLLAILLTGCDRTEVTL   24 (236)
T ss_pred             CCCHHHHHHHHHHHHCCCCCCCCC
T ss_conf             962347899999876268888765


No 115
>TIGR01344 malate_syn_A malate synthase A; InterPro: IPR006252   These sequences represent plant malate synthase and one of two bacterial forms, designated malate synthase A. This enzyme and isocitrate lyase are the two characteristic enzymes of the glyoxylate shunt. The shunt enables the cell to use acetyl-CoA to generate increased levels of TCA cycle intermediates for biosynthetic pathways such as gluconeogenesis.; GO: 0004474 malate synthase activity, 0006097 glyoxylate cycle.
Probab=39.00  E-value=11  Score=17.80  Aligned_cols=11  Identities=18%  Similarity=0.066  Sum_probs=4.7

Q ss_pred             EECCCCCCHHH
Q ss_conf             80377872001
Q gi|254780953|r  115 SHTDSIGTLKN  125 (190)
Q Consensus       115 GHTD~~g~~~~  125 (190)
                      -|||...-..|
T Consensus       124 ~f~~~~~GK~Y  134 (522)
T TIGR01344       124 DFTDEESGKEY  134 (522)
T ss_pred             EEECCCCCCCC
T ss_conf             13228888620


No 116
>COG3521 Predicted component of the type VI protein secretion system [Intracellular trafficking, secretion, and    vesicular transport]
Probab=38.42  E-value=28  Score=15.56  Aligned_cols=24  Identities=25%  Similarity=0.457  Sum_probs=16.1

Q ss_pred             CHH--HHHHHHHHHHHHHHCCCCCCC
Q ss_conf             947--899999999999751478876
Q gi|254780953|r    1 MIK--ELGLSMFIMTTISGCGLASRE   24 (190)
Q Consensus         1 m~k--~l~l~~~~~~~l~g~~~~~~~   24 (190)
                      |.+  +..+++|.+.+++||+++...
T Consensus         1 M~~~~~a~~~l~al~~~sgCsss~~~   26 (159)
T COG3521           1 MNSSRKAVLALFALLVLSGCSSSKPL   26 (159)
T ss_pred             CCHHHHHHHHHHHHHHHHHHCCCCCC
T ss_conf             94257789999999985241258877


No 117
>PRK11548 hypothetical protein; Provisional
Probab=38.40  E-value=30  Score=15.40  Aligned_cols=22  Identities=23%  Similarity=0.445  Sum_probs=13.8

Q ss_pred             HHHHHH-HHHHHHHHHHCCCCCC
Q ss_conf             478999-9999999975147887
Q gi|254780953|r    2 IKELGL-SMFIMTTISGCGLASR   23 (190)
Q Consensus         2 ~k~l~l-~~~~~~~l~g~~~~~~   23 (190)
                      +|.+.. +++++++++||+....
T Consensus         3 ~k~l~~a~ll~~lllsgCS~~~~   25 (113)
T PRK11548          3 CKTLTAAAAVLLMLTAGCSTLER   25 (113)
T ss_pred             HHHHHHHHHHHHHHHCCCCCCCC
T ss_conf             57889999999999801157877


No 118
>pfam01764 Lipase_3 Lipase (class 3).
Probab=38.26  E-value=30  Score=15.39  Aligned_cols=64  Identities=22%  Similarity=0.308  Sum_probs=39.9

Q ss_pred             HHHHHHHHHHHHHHCCCCEEEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCCCCC
Q ss_conf             99999999999985899489999803778720011122589999999988852387451699997034588899769
Q gi|254780953|r   92 FLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDT  168 (190)
Q Consensus        92 ~~~~L~~ia~~l~~~~~~~i~I~GHTD~~g~~~~N~~LS~~RA~~V~~~L~~~g~~~~r~i~v~g~G~~~p~~~n~~  168 (190)
                      ....+..+...+.++++.+|.+.||.           |.-.=|.-..-+|...+..+...+.+..||.  |..-|..
T Consensus        46 ~~~i~~~l~~~~~~~~~~~l~itGHS-----------LGGa~A~l~a~~l~~~~~~~~~~~~~~tfg~--Prvgn~~  109 (141)
T pfam01764        46 RDQILEELKRLLEKYPDYKIVVTGHS-----------LGGALASLAAADLAENGLFPSSRIRVVTFGS--PRVGNYA  109 (141)
T ss_pred             HHHHHHHHHHHHHHCCCCEEEEEECC-----------HHHHHHHHHHHHHHHHCCCCCCCEEEEEECC--CCCCCHH
T ss_conf             99999999999997899769998056-----------5789999999999982567878658999479--9757999


No 119
>PRK09934 putative fimbrial protein; Provisional
Probab=37.95  E-value=24  Score=15.95  Aligned_cols=22  Identities=14%  Similarity=0.120  Sum_probs=14.6

Q ss_pred             HHHHHHHHHHHHHHHHCCCCCC
Q ss_conf             4789999999999975147887
Q gi|254780953|r    2 IKELGLSMFIMTTISGCGLASR   23 (190)
Q Consensus         2 ~k~l~l~~~~~~~l~g~~~~~~   23 (190)
                      |||++|++++.++++.++.+..
T Consensus         1 mkk~~l~~~~~l~~~~~~~aa~   22 (171)
T PRK09934          1 MRRVFIAIFCGLLWSPLSQAAS   22 (171)
T ss_pred             CHHHHHHHHHHHHHHHHHHHCC
T ss_conf             9268999999999863442113


No 120
>PRK10783 mltD membrane-bound lytic murein transglycosylase D; Provisional
Probab=36.25  E-value=32  Score=15.21  Aligned_cols=23  Identities=13%  Similarity=0.325  Sum_probs=15.4

Q ss_pred             HHHHHHHHHHHHHHHHCCCCCCCC
Q ss_conf             478999999999997514788765
Q gi|254780953|r    2 IKELGLSMFIMTTISGCGLASREK   25 (190)
Q Consensus         2 ~k~l~l~~~~~~~l~g~~~~~~~~   25 (190)
                      || +-+.++.+++|+||..+....
T Consensus         1 mk-~~~~l~~~~ll~gcq~~~~~~   23 (449)
T PRK10783          1 MK-AKAILLASVLLVGCQSSKNDA   23 (449)
T ss_pred             CC-HHHHHHHHHHHHHCCCCCCCC
T ss_conf             91-899999999997255788888


No 121
>COG4594 FecB ABC-type Fe3+-citrate transport system, periplasmic component [Inorganic ion transport and metabolism]
Probab=36.04  E-value=33  Score=15.19  Aligned_cols=26  Identities=15%  Similarity=0.387  Sum_probs=14.5

Q ss_pred             CHHHHHH--HHHHHHHHHHCCCCCCCCC
Q ss_conf             9478999--9999999975147887654
Q gi|254780953|r    1 MIKELGL--SMFIMTTISGCGLASREKK   26 (190)
Q Consensus         1 m~k~l~l--~~~~~~~l~g~~~~~~~~~   26 (190)
                      |++...+  +++++++++||++++....
T Consensus         3 ~~~~~~i~~lll~lllva~C~~s~~~~~   30 (310)
T COG4594           3 MKKTAIILTLLLLLLLVAACSSSDNNQK   30 (310)
T ss_pred             CHHHHHHHHHHHHHHHHHHHCCCCCCCC
T ss_conf             5035999999999999977147676555


No 122
>TIGR01618 phage_P_loop phage nucleotide-binding protein; InterPro: IPR006505   These sequences represent an uncharacterised family of proteins from a number of phage of Gram-positive bacteria. This protein contains a P-loop motif, G/A-X-X-G-X-G-K-T near its amino end. The function of these proteins is unknown..
Probab=35.83  E-value=33  Score=15.17  Aligned_cols=82  Identities=15%  Similarity=0.123  Sum_probs=58.9

Q ss_pred             HHHHHHHHHHHHHCCCCEEEEEEECCCCCCH-----HHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEE-ECC--CCCCC
Q ss_conf             9999999999985899489999803778720-----011122589999999988852387451699997-034--58889
Q gi|254780953|r   93 LPMLQLIATILNKFPSTVIAIQSHTDSIGTL-----KNNLLISQERADVIKSYLIQRGVSSNRFISVRG-FAY--KYPID  164 (190)
Q Consensus        93 ~~~L~~ia~~l~~~~~~~i~I~GHTD~~g~~-----~~N~~LS~~RA~~V~~~L~~~g~~~~r~i~v~g-~G~--~~p~~  164 (190)
                      ...+-.+..+|.+.++..|....|-++.+..     -||+.+..-|+..+=.+|--.-+. .|++. .+ =|+  -+-+.
T Consensus       124 ~~~~~d~~~vl~~l~~~~i~~tAwe~~~~~~~e~G~iy~ry~pdir~kvlN~~lgl~DvV-aRl~~-~~~tG~eevRg~~  201 (229)
T TIGR01618       124 DLYFLDLLTVLKELKNKNIYVTAWEDTNQLSLESGQIYNRYLPDIREKVLNAFLGLTDVV-ARLVK-NAKTGEEEVRGFI  201 (229)
T ss_pred             HHHHHHHHHHHHHCCCCEEEEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCEE-EEEEE-CCCCCHHHCCCEE
T ss_conf             899999999998558987999876566753401146687666775478876550333234-56765-6888811313235


Q ss_pred             CCCCHHHHHCCC
Q ss_conf             976977985299
Q gi|254780953|r  165 TNDTKVGRQNNQ  176 (190)
Q Consensus       165 ~n~~~~~ra~NR  176 (190)
                      =..++..+|+||
T Consensus       202 L~~~~G~yAKNr  213 (229)
T TIGR01618       202 LDPSKGNYAKNR  213 (229)
T ss_pred             ECCCCCCCCCCC
T ss_conf             559987212110


No 123
>TIGR01892 AcOrn-deacetyl acetylornithine deacetylase (ArgE); InterPro: IPR010169   This entry represents a clade of acetylornithine deacetylases (argE) from proteobacteria, which catalyse the final step in arginine biosynthesis. The enzyme is closely related to and may share a common origin with dapE (succinyl-diaminopimelate desuccinylase), cpg2 (carboxypeptidase G2) and ACY1 (aminoacylase I), all of which are members of the metal-dependent aminoacylase family, ArgE/dapE/ACY1/CPG2/yscS .; GO: 0008270 zinc ion binding, 0008777 acetylornithine deacetylase activity, 0050897 cobalt ion binding, 0006526 arginine biosynthetic process, 0005737 cytoplasm.
Probab=35.54  E-value=15  Score=17.04  Aligned_cols=68  Identities=10%  Similarity=0.062  Sum_probs=34.9

Q ss_pred             CCHHHHHHHHH-H-HHHHHHCCCCEEEEEEECCCCCCHH-HHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCC
Q ss_conf             09999999999-9-9999858994899998037787200-1112258999999998885238745169999703458889
Q gi|254780953|r   88 LEKKFLPMLQL-I-ATILNKFPSTVIAIQSHTDSIGTLK-NNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPID  164 (190)
Q Consensus        88 l~~~~~~~L~~-i-a~~l~~~~~~~i~I~GHTD~~g~~~-~N~~LS~~RA~~V~~~L~~~g~~~~r~i~v~g~G~~~p~~  164 (190)
                      |.......++. + +++-...|...+.++-|.-..|-.- .|-.        +..+|.+.....+. ..++.||..-|..
T Consensus       275 l~~~l~~~~~~aldaq~~~~~p~~~~~~~~~~~~Pa~~~~~d~~--------~~~~~~~l~G~n~~-~~~V~YgtEAp~~  345 (386)
T TIGR01892       275 LLALLEKIAEEALDAQVKEKEPGFEVKVELLSAIPALELEPDAE--------LVAFLEKLAGANEA-AEVVSYGTEAPQF  345 (386)
T ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCCCCCHH--------HHHHHHHHCCCCCC-CCCCCCCCCCHHH
T ss_conf             98999999876666677441376503688743678889988738--------99999997088988-8635640341257


No 124
>PRK09915 putative outer membrane efflux protein MdtP; Provisional
Probab=34.82  E-value=34  Score=15.07  Aligned_cols=25  Identities=32%  Similarity=0.523  Sum_probs=15.2

Q ss_pred             HHHHHHHHH--HHHHHHHCCCCCCCCC
Q ss_conf             478999999--9999975147887654
Q gi|254780953|r    2 IKELGLSMF--IMTTISGCGLASREKK   26 (190)
Q Consensus         2 ~k~l~l~~~--~~~~l~g~~~~~~~~~   26 (190)
                      ||++.+..+  ++++++||+..+....
T Consensus         6 ~~r~~~~~~l~~~~lLagC~~~p~~~~   32 (488)
T PRK09915          6 LSRLLLCSILGSTTLISGCALVRKDSA   32 (488)
T ss_pred             HHHHHHHHHHHHHHHHCCCCCCCCCCC
T ss_conf             769999999999999752668999999


No 125
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=34.22  E-value=35  Score=15.02  Aligned_cols=25  Identities=16%  Similarity=0.259  Sum_probs=20.6

Q ss_pred             CHHHHHHHHHHHHHHHHCCCCCCCC
Q ss_conf             9478999999999997514788765
Q gi|254780953|r    1 MIKELGLSMFIMTTISGCGLASREK   25 (190)
Q Consensus         1 m~k~l~l~~~~~~~l~g~~~~~~~~   25 (190)
                      ||+++...++++++++||+......
T Consensus         1 m~~~~~~~~~~l~~~~~~~~~~~~~   25 (262)
T COG1729           1 MKSNLRLVLLGLSLLVGLAAPASAP   25 (262)
T ss_pred             CCHHHHHHHHHHHHHHHHCCCCCCC
T ss_conf             9026999999999987622533456


No 126
>PRK12700 flgH flagellar basal body L-ring protein; Reviewed
Probab=33.99  E-value=35  Score=15.00  Aligned_cols=21  Identities=19%  Similarity=0.471  Sum_probs=13.2

Q ss_pred             HHHHHHHHHHHHHCCCCCCCC
Q ss_conf             999999999997514788765
Q gi|254780953|r    5 LGLSMFIMTTISGCGLASREK   25 (190)
Q Consensus         5 l~l~~~~~~~l~g~~~~~~~~   25 (190)
                      +.+++.++++++||+..+..+
T Consensus         9 l~~~~~~~~ll~GCa~~~~~p   29 (230)
T PRK12700          9 LPVCAALLALAAGCAMIPPEP   29 (230)
T ss_pred             HHHHHHHHHHHHCCCCCCCCC
T ss_conf             999999999974446899998


No 127
>PRK10641 btuB vitamin B12/cobalamin outer membrane transporter; Provisional
Probab=33.65  E-value=16  Score=16.95  Aligned_cols=12  Identities=33%  Similarity=0.343  Sum_probs=8.5

Q ss_pred             CHHHHHHHHHHH
Q ss_conf             947899999999
Q gi|254780953|r    1 MIKELGLSMFIM   12 (190)
Q Consensus         1 m~k~l~l~~~~~   12 (190)
                      ||||+.|+.+++
T Consensus         1 ~~~~~~~~~~~~   12 (615)
T PRK10641          1 MIKKASLLTALS   12 (615)
T ss_pred             CCHHHHHHHHHH
T ss_conf             944899999998


No 128
>TIGR03511 GldH_lipo gliding motility-associated lipoprotein GldH. Members of this protein family are predicted lipoproteins, exclusive to the Bacteroidetes phylum (previously Cytophaga-Flavobacteria-Bacteroides). Members include GldH, a protein linked to a type of rapid surface gliding motility found in certain Bacteroidetes, such as Flavobacterium johnsoniae and Cytophaga hutchinsonii. Gliding motility appears closely linked to chitin utilization in the model species Flavobacterium johnsoniae. Not all Bacteroidetes with members of this protein family may have gliding motility.
Probab=32.40  E-value=20  Score=16.34  Aligned_cols=22  Identities=5%  Similarity=0.107  Sum_probs=17.2

Q ss_pred             CHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             9478999999999997514788
Q gi|254780953|r    1 MIKELGLSMFIMTTISGCGLAS   22 (190)
Q Consensus         1 m~k~l~l~~~~~~~l~g~~~~~   22 (190)
                      |||+..+.+++++++++|....
T Consensus         3 ~~~~~i~~~l~~~ll~SC~~~~   24 (156)
T TIGR03511         3 LVRNSISFFLGACVLVSCTENT   24 (156)
T ss_pred             HHHHHHHHHHHHHHEEEECCCC
T ss_conf             6854499999999707638996


No 129
>PRK10053 hypothetical protein; Provisional
Probab=32.29  E-value=38  Score=14.83  Aligned_cols=59  Identities=17%  Similarity=0.087  Sum_probs=26.9

Q ss_pred             CCCCEEEEECCEEEEEECCCEEC-CCHHHCCHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCC
Q ss_conf             17835886087589985221112-881310999999999999999858994899998037787
Q gi|254780953|r   60 DTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIG  121 (190)
Q Consensus        60 ~~~~~~~~~~~~~~~~~~~~~~f-~~~a~l~~~~~~~L~~ia~~l~~~~~~~i~I~GHTD~~g  121 (190)
                      .++..+...|+-+.-.-.+.+.| +.+-++.-+--   +++=.-..-.|+..|.|.|--|..-
T Consensus        59 ~Dda~V~L~GnIv~~lg~d~Y~FrD~TG~I~VeId---~~~W~G~~VtP~d~V~I~GeVDke~  118 (130)
T PRK10053         59 HDGATVSLRGNLIDHKGDDRYVFRDKSGEINVIIP---AAVFDGREVQPDQMININGSLDKKS  118 (130)
T ss_pred             CCCCEEEEEEEEEEECCCCEEEEECCCCCEEEEEC---HHHCCCCCCCCCCEEEEEEEECCCC
T ss_conf             69984999888886148834899779975999967---7774897859998789988972566


No 130
>PRK09837 copper/silver efflux system outer membrane protein CusC; Provisional
Probab=32.09  E-value=38  Score=14.82  Aligned_cols=23  Identities=26%  Similarity=0.416  Sum_probs=16.0

Q ss_pred             CHHHHHHHHHHHHHHHHCCCCCC
Q ss_conf             94789999999999975147887
Q gi|254780953|r    1 MIKELGLSMFIMTTISGCGLASR   23 (190)
Q Consensus         1 m~k~l~l~~~~~~~l~g~~~~~~   23 (190)
                      |..+-++.++++++++||+..+.
T Consensus         1 ~~~~rll~l~~~l~L~gC~~~P~   23 (460)
T PRK09837          1 MSPCKLLPFCVALALTGCSLAPD   23 (460)
T ss_pred             CCHHHHHHHHHHHHHCCCCCCCC
T ss_conf             97578999999999824778999


No 131
>PRK10533 putative lipoprotein; Provisional
Probab=31.71  E-value=35  Score=15.02  Aligned_cols=23  Identities=17%  Similarity=0.226  Sum_probs=17.1

Q ss_pred             HHHHHHHHHHHHHHHCCCCCCCC
Q ss_conf             78999999999997514788765
Q gi|254780953|r    3 KELGLSMFIMTTISGCGLASREK   25 (190)
Q Consensus         3 k~l~l~~~~~~~l~g~~~~~~~~   25 (190)
                      |++.+++.+++++++|+......
T Consensus         4 ~~~~ll~PlallLSACttV~Pa~   26 (171)
T PRK10533          4 SKLALLLPCALLLSACTTVTPAY   26 (171)
T ss_pred             CHHHHHHHHHHHHHHHCCCCHHH
T ss_conf             20389999999998722476114


No 132
>PRK10397 hypothetical protein; Provisional
Probab=31.43  E-value=30  Score=15.42  Aligned_cols=24  Identities=17%  Similarity=0.385  Sum_probs=16.1

Q ss_pred             HHHHHHHHHHHHHHHHCCCCCCCCC
Q ss_conf             4789999999999975147887654
Q gi|254780953|r    2 IKELGLSMFIMTTISGCGLASREKK   26 (190)
Q Consensus         2 ~k~l~l~~~~~~~l~g~~~~~~~~~   26 (190)
                      ||++++ ...+++++||.....-..
T Consensus         1 mkk~~~-~g~~l~LsGCa~v~nY~~   24 (137)
T PRK10397          1 MKKLAI-AGALMLLAGCAEVENYNN   24 (137)
T ss_pred             CCHHHH-HHHHHHHHCCCCCCCHHH
T ss_conf             912467-789999735324410665


No 133
>COG3218 ABC-type uncharacterized transport system, auxiliary component [General function prediction only]
Probab=31.26  E-value=22  Score=16.15  Aligned_cols=22  Identities=23%  Similarity=0.478  Sum_probs=16.6

Q ss_pred             CHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             9478999999999997514788
Q gi|254780953|r    1 MIKELGLSMFIMTTISGCGLAS   22 (190)
Q Consensus         1 m~k~l~l~~~~~~~l~g~~~~~   22 (190)
                      |.++++..+.++++|.||....
T Consensus         9 ~~~~l~~~la~~a~L~gC~~~~   30 (205)
T COG3218           9 RRLSLAAALALAATLAGCGPEA   30 (205)
T ss_pred             HHHHHHHHHHHHHHHHCCCCCC
T ss_conf             9999999999999972347778


No 134
>PRK09973 putative outer membrane lipoprotein; Provisional
Probab=30.71  E-value=20  Score=16.40  Aligned_cols=23  Identities=17%  Similarity=0.312  Sum_probs=14.6

Q ss_pred             CHHHHHH--HHHHHHHHHHCCCCCC
Q ss_conf             9478999--9999999975147887
Q gi|254780953|r    1 MIKELGL--SMFIMTTISGCGLASR   23 (190)
Q Consensus         1 m~k~l~l--~~~~~~~l~g~~~~~~   23 (190)
                      |.+++.+  +++..++++||+..+.
T Consensus         1 mrtk~vlGaviLaS~LLaGCsn~~k   25 (85)
T PRK09973          1 MKTIFTVGAVVLATCLLSGCVNEQK   25 (85)
T ss_pred             CCCEEHHHHHHHHHHHHHCCCCHHH
T ss_conf             9602110699999999981555588


No 135
>pfam06788 UPF0257 Uncharacterized protein family (UPF0257).
Probab=30.65  E-value=22  Score=16.14  Aligned_cols=22  Identities=23%  Similarity=0.499  Sum_probs=16.8

Q ss_pred             HHHHHHHHHHHHHHHHCCCCCC
Q ss_conf             4789999999999975147887
Q gi|254780953|r    2 IKELGLSMFIMTTISGCGLASR   23 (190)
Q Consensus         2 ~k~l~l~~~~~~~l~g~~~~~~   23 (190)
                      ||+..++++++++|+||.....
T Consensus         1 ~k~~~~~~~la~~LsgCD~~~a   22 (236)
T pfam06788         1 VKKYLLVMLLALVLTGCDNPDA   22 (236)
T ss_pred             CCCHHHHHHHHHHEECCCCCCC
T ss_conf             9401368878772125578887


No 136
>PRK02889 tolB translocation protein TolB; Provisional
Probab=30.59  E-value=41  Score=14.67  Aligned_cols=27  Identities=19%  Similarity=0.423  Sum_probs=18.0

Q ss_pred             CHHHHHHHHHHHHHHHHCCCCCCCCCC
Q ss_conf             947899999999999751478876544
Q gi|254780953|r    1 MIKELGLSMFIMTTISGCGLASREKKK   27 (190)
Q Consensus         1 m~k~l~l~~~~~~~l~g~~~~~~~~~~   27 (190)
                      ||++|.+.++++++|..|+..+..+..
T Consensus         3 ~~~~l~~~~~~~~~l~~~~~~A~A~L~   29 (430)
T PRK02889          3 LMTKLGLRALVASCLIAAGGAAHAQLN   29 (430)
T ss_pred             HHHHHHHHHHHHHHHHHCCCCCEEEEE
T ss_conf             799899999999999862102027899


No 137
>PRK10290 superoxide dismutase; Provisional
Probab=30.39  E-value=41  Score=14.65  Aligned_cols=22  Identities=23%  Similarity=0.462  Sum_probs=12.1

Q ss_pred             HHHHHHHHHHHHHHHHCCCCCC
Q ss_conf             4789999999999975147887
Q gi|254780953|r    2 IKELGLSMFIMTTISGCGLASR   23 (190)
Q Consensus         2 ~k~l~l~~~~~~~l~g~~~~~~   23 (190)
                      ||++.++++++++.++|.....
T Consensus         1 mk~~~~~~~~l~~~~~~~a~~~   22 (173)
T PRK10290          1 MKRFSLAILALVVCTGAQAASE   22 (173)
T ss_pred             CCHHHHHHHHHHHHHHHHHCCC
T ss_conf             9107999999999766651446


No 138
>KOG2534 consensus
Probab=30.37  E-value=26  Score=15.79  Aligned_cols=15  Identities=20%  Similarity=0.558  Sum_probs=12.8

Q ss_pred             CCCCEEEEEECCHHH
Q ss_conf             299169999301011
Q gi|254780953|r  174 NNQRIEIQIFPRGNI  188 (190)
Q Consensus       174 ~NRRVei~i~~~~~~  188 (190)
                      .+|||+|++.|.++.
T Consensus       273 ~~rRvDivv~P~~~~  287 (353)
T KOG2534         273 KARRVDIVVCPYDEF  287 (353)
T ss_pred             CEEEEEEEEECHHHC
T ss_conf             103667899665771


No 139
>pfam08085 Entericidin Entericidin EcnA/B family. This family consists of the entericidin antidote/toxin peptides. The entericidin locus is activated in stationary phase under high osmolarity conditions by rho-S and simultaneously repressed by the osmoregulatory EnvZ/OmpR signal transduction pathway. The entericidin locus encodes tandem paralogous genes (ecnAB) and directs the synthesis of two small cell-envelope lipoproteins which can maintain plasmids in bacterial population by means of post-segregational killing.
Probab=30.04  E-value=41  Score=14.66  Aligned_cols=21  Identities=24%  Similarity=0.482  Sum_probs=10.0

Q ss_pred             CHHHHHHHHHH---HHHHHHCCCC
Q ss_conf             94789999999---9999751478
Q gi|254780953|r    1 MIKELGLSMFI---MTTISGCGLA   21 (190)
Q Consensus         1 m~k~l~l~~~~---~~~l~g~~~~   21 (190)
                      |+|.+.+.+++   +++++||-+.
T Consensus         1 Mk~~~~~~~~l~~~~~~lagCNTv   24 (42)
T pfam08085         1 MKKLIALLLALLLLALVLAGCNTV   24 (42)
T ss_pred             CHHHHHHHHHHHHHHHHHHCCHHH
T ss_conf             923699999999999998612221


No 140
>cd00307 RuBisCO_small_like Ribulose bisphosphate carboxylase/oxygenase (Rubisco), small subunit and related proteins. Rubisco is a bifunctional enzyme catalyzes the initial steps of two opposing metabolic pathways: photosynthetic carbon fixation and the competing process of photorespiration. Rubisco Form I, present in plants and green algae, is composed of eight large and eight small subunits. The nearly identical small subunits are encoded by a family of nuclear genes. After translation, the small subunits are translocated across the chloroplast membrane, where an N-terminal signal peptide is cleaved off. While the large subunits contain the catalytic activities, it has been shown that the small subunits are important for catalysis by enhancing the catalytic rate through inducing conformational changes in the large subunits. This superfamily also contains specific proteins from cyanobacteria. CcmM plays a role in a CO2 concentrating mechanism, which cyanobacteria need to to overcome t
Probab=29.43  E-value=42  Score=14.55  Aligned_cols=30  Identities=10%  Similarity=0.186  Sum_probs=25.1

Q ss_pred             HHHHHHHHHHHHHHHHCCCCEEEEEEECCC
Q ss_conf             999999999999998589948999980377
Q gi|254780953|r   90 KKFLPMLQLIATILNKFPSTVIAIQSHTDS  119 (190)
Q Consensus        90 ~~~~~~L~~ia~~l~~~~~~~i~I~GHTD~  119 (190)
                      .+..++|.+|...++.+|+..|++.|.-..
T Consensus        42 t~~~qVl~el~~c~~~~p~~YVRlig~D~~   71 (84)
T cd00307          42 RSEAQVLAALEACLAEHPGEYVRLIGIDPK   71 (84)
T ss_pred             CCHHHHHHHHHHHHHHCCCCEEEEEEECCC
T ss_conf             999999999999998798676999997275


No 141
>pfam12000 DUF3495 Domain of unknown function (DUF3495). This presumed domain is functionally uncharacterized. This domain is found in bacteria. This domain is about 170 amino acids in length. This domain is found associated with pfam00534. This domain has a single completely conserved residue G that may be functionally important.
Probab=29.35  E-value=43  Score=14.55  Aligned_cols=37  Identities=8%  Similarity=0.159  Sum_probs=15.7

Q ss_pred             HHHHHHHHHHHHHHHHHH---HHHCCCCCCEEEEEEECCC
Q ss_conf             011122589999999988---8523874516999970345
Q gi|254780953|r  124 KNNLLISQERADVIKSYL---IQRGVSSNRFISVRGFAYK  160 (190)
Q Consensus       124 ~~N~~LS~~RA~~V~~~L---~~~g~~~~r~i~v~g~G~~  160 (190)
                      ..+++....|+++|++.+   .++|..|+-++.-.|.||.
T Consensus        40 ~~~~E~~~~rg~av~~aa~~L~~~Gf~PDvIi~H~GWGe~   79 (172)
T pfam12000        40 LRDFEAAVIRGQAVARAARQLRAQGFRPDVIVAHPGWGET   79 (172)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEECCCCCCH
T ss_conf             2059999999999999999999749999989875876401


No 142
>PRK13619 psbV cytochrome c-550; Provisional
Probab=29.10  E-value=31  Score=15.33  Aligned_cols=51  Identities=8%  Similarity=0.092  Sum_probs=23.4

Q ss_pred             HHHHHHHHHHHHHHCCCCE----EEEEEECCCCCC--HHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9999999999998589948----999980377872--001112258999999998885
Q gi|254780953|r   92 FLPMLQLIATILNKFPSTV----IAIQSHTDSIGT--LKNNLLISQERADVIKSYLIQ  143 (190)
Q Consensus        92 ~~~~L~~ia~~l~~~~~~~----i~I~GHTD~~g~--~~~N~~LS~~RA~~V~~~L~~  143 (190)
                      .+..+..+.++|+. |...    =.-+=|-.-.-+  +..=..|+..--.+++.|+.-
T Consensus        91 ~RDni~~LVdYmk~-PtsYDG~~siae~HPs~~saDifp~MR~ltddDL~~iAG~ILv  147 (161)
T PRK13619         91 PRDNVLALVDYLKH-PTSYDGEDDYSELHPNVSRPDIFPELRNFTEDDVYDVAGYMLV  147 (161)
T ss_pred             CCCCHHHHHHHHHC-CCCCCCHHHHHHHCCCCCCCHHHHHHHCCCHHHHHHHHHHEEE
T ss_conf             83238999999529-9765653579885878655213276624888899998656253


No 143
>pfam07269 consensus
Probab=28.86  E-value=37  Score=14.86  Aligned_cols=20  Identities=20%  Similarity=0.428  Sum_probs=11.4

Q ss_pred             HHHHHHHHHHHHHHHHCCCCCC
Q ss_conf             4789999999999975147887
Q gi|254780953|r    2 IKELGLSMFIMTTISGCGLASR   23 (190)
Q Consensus         2 ~k~l~l~~~~~~~l~g~~~~~~   23 (190)
                      ||...+  ++++.++||.++..
T Consensus         1 MKy~ll--~l~l~LAgC~T~d~   20 (55)
T pfam07269         1 MKYCLL--LLILALAGCQTNDV   20 (55)
T ss_pred             CHHHHH--HHHHHHHHCCCCCC
T ss_conf             901499--99999875114671


No 144
>TIGR02544 III_secr_YscJ type III secretion apparatus lipoprotein, YscJ/HrcJ family; InterPro: IPR003282 Secretion of virulence factors in Gram-negative bacteria involves transportation of the protein across two membranes to reach the cell exterior. There have been four secretion systems described in animal enteropathogens such as Salmonella and Yersinia, with further sequence similarities in plant pathogens like Ralstonia and Erwinia.   The type III secretion system is of great interest as it is used to transport virulence factors from the pathogen directly into the host cell  and is only triggered when the bacterium comes into close contact with the host. The protein subunits of the system are very similar to those of bacterial flagellar biosynthesis . However, while the latter forms a ring structure to allow secretion of flagellin and is an integral part of the flagellum itself, type III subunits in the outer membrane translocate secreted proteins through a channel-like structure.    One of the outer membrane protein subunit families, termed "K" here for nomenclature purposes, aids in the structural assembly of the invasion complex . It is also described as a lipoprotein. Members of this family include the Salmonella PrgK and SsaJ genes, MxiJ from Shigella, YscJ from Yersinia, and from the plant enteropathogens NolT (Rhizobium) and HrcJ Erwinia). The flagellar M-ring protein FliF also shares a low level of similarity, presumably due to evolution of the type III secretion system from the flagellar biosynthetic pathway.; GO: 0009306 protein secretion.
Probab=28.84  E-value=37  Score=14.90  Aligned_cols=19  Identities=16%  Similarity=0.511  Sum_probs=14.4

Q ss_pred             HHHHHHHHHHHHHHHCCCC
Q ss_conf             7899999999999751478
Q gi|254780953|r    3 KELGLSMFIMTTISGCGLA   21 (190)
Q Consensus         3 k~l~l~~~~~~~l~g~~~~   21 (190)
                      +..+++++++++|+||...
T Consensus         2 ~~~~~~~~l~llL~GC~~~   20 (203)
T TIGR02544         2 RRKLLLLLLLLLLTGCKVD   20 (203)
T ss_pred             HHHHHHHHHHHHHHCCCCE
T ss_conf             3588999999997178740


No 145
>pfam10671 TcpQ Toxin co-regulated pilus biosynthesis protein Q. The toxin-coregulated pilus (TCP) of Vibrio cholerae and the soluble TcpF protein that is secreted via the TCP biogenesis apparatus are essential for intestinal colonisation in the disease of cholera. TcpQ is part of an outer membrane complex of the TCP biogenesis apparatus, comprised of TcpC and TcpQ, and the TcpQ is required for proper localisation of TcpC to the outer membrane.
Probab=28.64  E-value=20  Score=16.39  Aligned_cols=25  Identities=28%  Similarity=0.356  Sum_probs=19.5

Q ss_pred             CHHHHHHHHHHHHHHHHCCCCCCCC
Q ss_conf             9478999999999997514788765
Q gi|254780953|r    1 MIKELGLSMFIMTTISGCGLASREK   25 (190)
Q Consensus         1 m~k~l~l~~~~~~~l~g~~~~~~~~   25 (190)
                      |+|+..+.+.++..++||++...-.
T Consensus         1 mkknyii~~~iaii~sgcssieslk   25 (178)
T pfam10671         1 MKKNYIIGACIAIILSGCSSIESLK   25 (178)
T ss_pred             CCCCEEEHHHHHHHHCCCCCHHHHC
T ss_conf             9752431545999965763023320


No 146
>PRK00031 lolA outer-membrane lipoprotein carrier protein; Reviewed
Probab=28.56  E-value=36  Score=14.93  Aligned_cols=20  Identities=10%  Similarity=0.240  Sum_probs=11.6

Q ss_pred             HHHHHHHHHHHHHHHHCCCC
Q ss_conf             47899999999999751478
Q gi|254780953|r    2 IKELGLSMFIMTTISGCGLA   21 (190)
Q Consensus         2 ~k~l~l~~~~~~~l~g~~~~   21 (190)
                      ||++.+++++++++.+|.+.
T Consensus         1 mk~~~~~~~~~~~l~~~~~~   20 (201)
T PRK00031          1 MKKLLIAALLAAALVASSAF   20 (201)
T ss_pred             CCHHHHHHHHHHHHHHHHHC
T ss_conf             91599999999998776645


No 147
>COG4314 NosL Predicted lipoprotein involved in nitrous oxide reduction [Energy production and conversion]
Probab=28.39  E-value=44  Score=14.45  Aligned_cols=23  Identities=22%  Similarity=0.369  Sum_probs=15.9

Q ss_pred             CHHHHHHHHHHHHHHHHCCCCCC
Q ss_conf             94789999999999975147887
Q gi|254780953|r    1 MIKELGLSMFIMTTISGCGLASR   23 (190)
Q Consensus         1 m~k~l~l~~~~~~~l~g~~~~~~   23 (190)
                      |++-|+..+++.++++||..+..
T Consensus         1 mkr~Lla~la~~~llAgC~~~ed   23 (176)
T COG4314           1 MKRTLLAILAVTALLAGCRQAED   23 (176)
T ss_pred             CCHHHHHHHHHHHHHHHCCHHHC
T ss_conf             94037999999999875343113


No 148
>cd00519 Lipase_3 Lipase (class 3).  Lipases are esterases that can hydrolyze long-chain acyl-triglycerides into di- and monoglycerides, glycerol, and free fatty acids at a water/lipid interface.  A typical feature of lipases is "interfacial activation," the process of becoming active at the lipid/water interface, although several examples of lipases have been identified that do not undergo interfacial activation .  The active site of a lipase contains a catalytic triad consisting of Ser - His - Asp/Glu, but unlike most serine proteases, the active site is buried inside the structure.  A "lid" or "flap" covers the active site, making it inaccessible to solvent and substrates. The lid opens during the process of interfacial activation, allowing the lipid substrate access to the active site.
Probab=27.81  E-value=45  Score=14.39  Aligned_cols=65  Identities=20%  Similarity=0.294  Sum_probs=41.4

Q ss_pred             HHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCCCCCHH
Q ss_conf             99999999999998589948999980377872001112258999999998885238745169999703458889976977
Q gi|254780953|r   91 KFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKV  170 (190)
Q Consensus        91 ~~~~~L~~ia~~l~~~~~~~i~I~GHTD~~g~~~~N~~LS~~RA~~V~~~L~~~g~~~~r~i~v~g~G~~~p~~~n~~~~  170 (190)
                      -....+..+...++++|+.+|.|.||.           |+-.=|.-..-+|..++. .. .+.+..||.  |..-|..-.
T Consensus       110 ~~~~~~~~~~~~~~~~p~~~i~vTGHS-----------LGgalA~L~a~~l~~~~~-~~-~~~~~tfG~--Prvgn~~fa  174 (229)
T cd00519         110 LYNQVLPELKSALKQYPDYKIIVTGHS-----------LGGALASLLALDLRLRGP-GS-DVTVYTFGQ--PRVGNAAFA  174 (229)
T ss_pred             HHHHHHHHHHHHHHHCCCCEEEEECCC-----------CHHHHHHHHHHHHHHHCC-CC-CEEEEEECC--CCCCCHHHH
T ss_conf             999999999999987899569996467-----------068999999999997179-99-707999479--975789999


No 149
>PRK13684 Ycf48-like protein; Provisional
Probab=27.58  E-value=46  Score=14.37  Aligned_cols=20  Identities=25%  Similarity=0.408  Sum_probs=15.5

Q ss_pred             HHHHHHHHHHHHHHHHCCCC
Q ss_conf             47899999999999751478
Q gi|254780953|r    2 IKELGLSMFIMTTISGCGLA   21 (190)
Q Consensus         2 ~k~l~l~~~~~~~l~g~~~~   21 (190)
                      .+++.+++++++++++|..+
T Consensus         8 ~~~l~l~~~~~~~~~~c~~~   27 (333)
T PRK13684          8 LLNLLLLLALGLVLSGCSTT   27 (333)
T ss_pred             HHHHHHHHHHHHHHCCCCCC
T ss_conf             99999999999863223566


No 150
>PRK11162 mltA murein transglycosylase A; Provisional
Probab=27.44  E-value=46  Score=14.35  Aligned_cols=30  Identities=13%  Similarity=0.361  Sum_probs=19.1

Q ss_pred             CHHHHHHHHHHHHHHHHCCCCCCCCCCCCCC
Q ss_conf             9478999999999997514788765444445
Q gi|254780953|r    1 MIKELGLSMFIMTTISGCGLASREKKKVFLH   31 (190)
Q Consensus         1 m~k~l~l~~~~~~~l~g~~~~~~~~~~~~~~   31 (190)
                      |.|.+ +..+++++++||++.+.+..+.+..
T Consensus         2 ~~~~~-~~~~~~~~l~~c~~~p~~~g~qy~~   31 (362)
T PRK11162          2 WVKYL-LMGIVVALLAACSSKPTDRGQQYKD   31 (362)
T ss_pred             HHHHH-HHHHHHHHHHHHCCCCCCCCCCCCC
T ss_conf             58999-9999999997604798766755557


No 151
>PRK10877 thiol:disulfide interchange protein DsbC; Provisional
Probab=27.34  E-value=46  Score=14.34  Aligned_cols=22  Identities=27%  Similarity=0.297  Sum_probs=14.1

Q ss_pred             CHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             9478999999999997514788
Q gi|254780953|r    1 MIKELGLSMFIMTTISGCGLAS   22 (190)
Q Consensus         1 m~k~l~l~~~~~~~l~g~~~~~   22 (190)
                      |+|+|++..++++.+++.+.+.
T Consensus         1 mkk~l~~~~~l~~~~s~~a~aD   22 (232)
T PRK10877          1 MKKGFMLFTLLAAAFSGFAHAD   22 (232)
T ss_pred             CCHHHHHHHHHHHHHHHHHHCC
T ss_conf             9266999999999986252437


No 152
>KOG4569 consensus
Probab=27.21  E-value=47  Score=14.33  Aligned_cols=57  Identities=14%  Similarity=0.219  Sum_probs=40.0

Q ss_pred             HHHHHHHHHHHHHCCCCEEEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEEECCC
Q ss_conf             99999999999858994899998037787200111225899999999888523874516999970345
Q gi|254780953|r   93 LPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYK  160 (190)
Q Consensus        93 ~~~L~~ia~~l~~~~~~~i~I~GHTD~~g~~~~N~~LS~~RA~~V~~~L~~~g~~~~r~i~v~g~G~~  160 (190)
                      ..+.+.+...+..+|+..|.|-||+.           ...=|.-.+.+++.+|...++.+.+.-||.=
T Consensus       155 ~~~~~~~~~L~~~~~~~~i~vTGHSL-----------GgAlA~laa~~i~~~~~~~~~~v~v~tFG~P  211 (336)
T KOG4569         155 SGLDAELRRLIELYPNYSIWVTGHSL-----------GGALASLAALDLVKNGLKTSSPVKVYTFGQP  211 (336)
T ss_pred             HHHHHHHHHHHHHCCCCEEEEEECCC-----------CHHHHHHHHHHHHHCCCCCCCCEEEEEECCC
T ss_conf             88999999999868996799940687-----------0898999999999727665664599991699


No 153
>PRK10672 rare lipoprotein A; Provisional
Probab=26.60  E-value=48  Score=14.26  Aligned_cols=26  Identities=12%  Similarity=0.109  Sum_probs=20.7

Q ss_pred             CHHHHHHHHHHHHHHHHCCCCCCCCC
Q ss_conf             94789999999999975147887654
Q gi|254780953|r    1 MIKELGLSMFIMTTISGCGLASREKK   26 (190)
Q Consensus         1 m~k~l~l~~~~~~~l~g~~~~~~~~~   26 (190)
                      |-|.-.++.+...+|+||.+......
T Consensus         1 mr~~wl~~~~~~~ll~~c~~~~~~~~   26 (369)
T PRK10672          1 MRKQWLGICIAAGLLAACTSDDGQQQ   26 (369)
T ss_pred             CCHHHHHHHHHHHHHHHCCCCCCCCC
T ss_conf             93335899999999865258864556


No 154
>TIGR03044 PS_II_psb27 photosystem II protein Psb27. Members of this family are the Psb27 protein of the cyanobacterial photosynthetic supracomplex, photosystem II. Although most protein components of both cyanobacterial and chloroplast versions of photosystem II are closely related and described together by single HMM families, this family is strictly bacterial. Some uncharacterized proteins with highly divergent sequences, from Arabidopsis, score between trusted and noise cutoffs for this model but are not at this time assigned as functionally equivalent photosystem II proteins.
Probab=26.57  E-value=48  Score=14.26  Aligned_cols=21  Identities=19%  Similarity=0.358  Sum_probs=14.0

Q ss_pred             HHHHHHHHHHHHHHHCCCCCC
Q ss_conf             789999999999975147887
Q gi|254780953|r    3 KELGLSMFIMTTISGCGLASR   23 (190)
Q Consensus         3 k~l~l~~~~~~~l~g~~~~~~   23 (190)
                      +-+.+.+.++++++||+.++.
T Consensus        10 ~alal~L~~~l~l~~cs~a~~   30 (135)
T TIGR03044        10 AALALVLGLCLLLTACSGAAK   30 (135)
T ss_pred             HHHHHHHHHHHHHHCCCCCCC
T ss_conf             999999999999734567776


No 155
>PRK13614 lipoprotein LpqB; Provisional
Probab=25.12  E-value=51  Score=14.11  Aligned_cols=23  Identities=26%  Similarity=0.449  Sum_probs=18.2

Q ss_pred             HHHHHHHHHHHHHHHCCCCCCCC
Q ss_conf             78999999999997514788765
Q gi|254780953|r    3 KELGLSMFIMTTISGCGLASREK   25 (190)
Q Consensus         3 k~l~l~~~~~~~l~g~~~~~~~~   25 (190)
                      ..+.|+.+++++|+||++.+..-
T Consensus         9 ~~~~ll~~~~v~LagCasiP~sg   31 (573)
T PRK13614          9 ASLALLVLLGVTLSACAQIPRSG   31 (573)
T ss_pred             HHHHHHHHHHHHHHHHCCCCCCC
T ss_conf             79999999998865404699998


No 156
>pfam02169 LPP20 LPP20 lipoprotein precursor.
Probab=24.36  E-value=39  Score=14.76  Aligned_cols=25  Identities=32%  Similarity=0.489  Sum_probs=19.6

Q ss_pred             HHHHHHHHHHHHHHHHCCCCCCCCC
Q ss_conf             4789999999999975147887654
Q gi|254780953|r    2 IKELGLSMFIMTTISGCGLASREKK   26 (190)
Q Consensus         2 ~k~l~l~~~~~~~l~g~~~~~~~~~   26 (190)
                      .|.|.+....++++.||+..+..-.
T Consensus         5 kKiL~~sVvAA~~~vGC~~~~k~Gv   29 (168)
T pfam02169         5 KKILGMSVIAAMVIVGCSHAPKSGI   29 (168)
T ss_pred             HHHHHHHHHHHHHEEECCCCCCCCC
T ss_conf             8987443777864021578986573


No 157
>CHL00130 rbcS ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit; Reviewed
Probab=23.76  E-value=54  Score=13.96  Aligned_cols=33  Identities=12%  Similarity=0.080  Sum_probs=27.9

Q ss_pred             HHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCH
Q ss_conf             999999999999985899489999803778720
Q gi|254780953|r   91 KFLPMLQLIATILNKFPSTVIAIQSHTDSIGTL  123 (190)
Q Consensus        91 ~~~~~L~~ia~~l~~~~~~~i~I~GHTD~~g~~  123 (190)
                      +...+|.+|...-+.+|+..|+|.|+-...+-.
T Consensus        60 D~~~Vl~Ei~~Crka~P~~yIRvigFDn~rq~Q   92 (138)
T CHL00130         60 DPAAVMFEINACRKAKPNGYIKLVAFDATRGVE   92 (138)
T ss_pred             CHHHHHHHHHHHHHHCCCCEEEEEEEECCCCEE
T ss_conf             999999999999987998579999871776368


No 158
>TIGR02722 lp_ uncharacterized lipoprotein; InterPro: IPR014094   Members of this protein family are restricted to the Proteobacteria, and all are predicted lipoproteins. In genomes that contain the thiK gene for the salvage enzyme thiamin kinase, the member of this family is encoded nearby..
Probab=23.62  E-value=55  Score=13.94  Aligned_cols=18  Identities=22%  Similarity=0.346  Sum_probs=14.6

Q ss_pred             HHHHHHHHHHHHHCCCCC
Q ss_conf             999999999997514788
Q gi|254780953|r    5 LGLSMFIMTTISGCGLAS   22 (190)
Q Consensus         5 l~l~~~~~~~l~g~~~~~   22 (190)
                      |.++++++++++||...-
T Consensus         6 l~~~~~~Al~L~GC~~~~   23 (215)
T TIGR02722         6 LIFVALLALLLSGCVSQR   23 (215)
T ss_pred             HHHHHHHHHHHHCCCCCC
T ss_conf             899999999985468872


No 159
>COG4607 CeuA ABC-type enterochelin transport system, periplasmic component [Inorganic ion transport and metabolism]
Probab=23.15  E-value=56  Score=13.89  Aligned_cols=23  Identities=22%  Similarity=0.385  Sum_probs=18.1

Q ss_pred             CHHHHHHHHHHHHHHHHCCCCCC
Q ss_conf             94789999999999975147887
Q gi|254780953|r    1 MIKELGLSMFIMTTISGCGLASR   23 (190)
Q Consensus         1 m~k~l~l~~~~~~~l~g~~~~~~   23 (190)
                      |.+.++++.+.++++++|+....
T Consensus         2 ~~~~~~~a~~~~lll~ac~~~~~   24 (320)
T COG4607           2 MLRLLYLAACVALLLTACSPNSS   24 (320)
T ss_pred             CCHHHHHHHHHHHHHHHHCCCCC
T ss_conf             41216999999999987267863


No 160
>PRK13799 unknown domain/N-carbamoyl-L-amino acid hydrolase fusion protein; Provisional
Probab=23.11  E-value=56  Score=13.88  Aligned_cols=80  Identities=15%  Similarity=0.018  Sum_probs=63.0

Q ss_pred             HHCCHHHHHHHHHHHHHHHH---------------------CCCC-EEEEEEECCCCCCH-HHHHHHHHHHHHHHHHHHH
Q ss_conf             31099999999999999985---------------------8994-89999803778720-0111225899999999888
Q gi|254780953|r   86 VFLEKKFLPMLQLIATILNK---------------------FPST-VIAIQSHTDSIGTL-KNNLLISQERADVIKSYLI  142 (190)
Q Consensus        86 a~l~~~~~~~L~~ia~~l~~---------------------~~~~-~i~I~GHTD~~g~~-~~N~~LS~~RA~~V~~~L~  142 (190)
                      .+|+|.-+...++|+.+|+.                     .|+. .|.+-.|.|+++.- .|--.|.--=+..+...|.
T Consensus       207 ~ylt~~h~~~~~~~~~wMr~aG~deV~IDAvGNl~GR~eG~~p~ap~l~~GSHlDTVpnGG~yDG~LGVla~le~v~~L~  286 (591)
T PRK13799        207 TYLSDAHRACANQISDWMRDAGFDEVEIDAVGNVVGRYKAADDDAKTLITGSHYDTVRNGGKYDGREGIFLAIACVKELH  286 (591)
T ss_pred             EECCHHHHHHHHHHHHHHHHCCCCEEEECCCCCEEEEECCCCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHH
T ss_conf             96499999999999999998099779986775468880379999988888776036778865771899999999999999


Q ss_pred             HHCCCCCCEEEEEEECCCCCCCC
Q ss_conf             52387451699997034588899
Q gi|254780953|r  143 QRGVSSNRFISVRGFAYKYPIDT  165 (190)
Q Consensus       143 ~~g~~~~r~i~v~g~G~~~p~~~  165 (190)
                      .+|..+.+-|.|.+|.+....-.
T Consensus       287 e~g~~~~~~iEVV~F~dEEGsRF  309 (591)
T PRK13799        287 EQGERLPFHFEVIAFAEEEGQRF  309 (591)
T ss_pred             HHCCCCCCCEEEEEECCCCCCCC
T ss_conf             80999999869998746677667


No 161
>PRK10781 rcsF outer membrane lipoprotein; Reviewed
Probab=22.72  E-value=57  Score=13.84  Aligned_cols=22  Identities=23%  Similarity=0.655  Sum_probs=15.0

Q ss_pred             HHHHHHHHHHHHHHHHCCCCCCC
Q ss_conf             47899999999999751478876
Q gi|254780953|r    2 IKELGLSMFIMTTISGCGLASRE   24 (190)
Q Consensus         2 ~k~l~l~~~~~~~l~g~~~~~~~   24 (190)
                      |+-|.+ .|++++++||+.-...
T Consensus         1 MR~lpi-~llal~ltGCs~l~~~   22 (133)
T PRK10781          1 MRALPI-CLLALMLTGCSMLSRS   22 (133)
T ss_pred             CCHHHH-HHHHHHHHCCCCCCCC
T ss_conf             920899-9999998431344548


No 162
>CHL00133 psbV photosystem II cytochrome c550; Validated
Probab=22.70  E-value=43  Score=14.54  Aligned_cols=51  Identities=8%  Similarity=0.101  Sum_probs=25.5

Q ss_pred             HHHHHHHHHHHHHHCCCCE----EEEEEECCCCCC--HHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9999999999998589948----999980377872--001112258999999998885
Q gi|254780953|r   92 FLPMLQLIATILNKFPSTV----IAIQSHTDSIGT--LKNNLLISQERADVIKSYLIQ  143 (190)
Q Consensus        92 ~~~~L~~ia~~l~~~~~~~----i~I~GHTD~~g~--~~~N~~LS~~RA~~V~~~L~~  143 (190)
                      .+..+..+.++|+. |...    =.-+=|-.-.-+  +..=..|+..--.+++.|+.-
T Consensus        91 ~RDni~~LVdYmkn-PtsYDG~~siae~HPs~~saDifp~mR~ltddDL~~iag~IL~  147 (163)
T CHL00133         91 PRDNIEALVDYMKN-PTSYDGLESIAEIHPSIKSADIFPKMRSLTDEDLFAIAGHILL  147 (163)
T ss_pred             CCCCHHHHHHHHHC-CCCCCCHHHHHHHCCCCCCCHHHHHHHCCCHHHHHHHHHHHEE
T ss_conf             83338999999529-9875645579885878655202276624888899998777501


No 163
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW; InterPro: IPR013360    Proteins in this entry are designated PilF  and PilW . This outer membrane protein is required both for pilus stability and for pilus functions such as adherence to human cells. Members of this family contain copies of the TPR (tetratricopeptide repeat) domain..
Probab=22.15  E-value=59  Score=13.77  Aligned_cols=16  Identities=19%  Similarity=0.661  Sum_probs=13.3

Q ss_pred             HHHHHHHHHHHCCCCC
Q ss_conf             9999999997514788
Q gi|254780953|r    7 LSMFIMTTISGCGLAS   22 (190)
Q Consensus         7 l~~~~~~~l~g~~~~~   22 (190)
                      ++++++++++||+++.
T Consensus         1 ~~l~~~~~l~GC~~~~   16 (247)
T TIGR02521         1 LALVLLLALTGCVTTP   16 (247)
T ss_pred             CHHHHHHHHHCCCCCC
T ss_conf             3887846785157887


No 164
>PRK09861 cytoplasmic membrane lipoprotein-28; Provisional
Probab=22.11  E-value=59  Score=13.77  Aligned_cols=21  Identities=14%  Similarity=0.283  Sum_probs=13.3

Q ss_pred             HHHHHHHHHHHHHHCCCCCCC
Q ss_conf             899999999999751478876
Q gi|254780953|r    4 ELGLSMFIMTTISGCGLASRE   24 (190)
Q Consensus         4 ~l~l~~~~~~~l~g~~~~~~~   24 (190)
                      .....++..++++||+.++.+
T Consensus        10 ~~a~ll~~~~~l~~C~~~~~~   30 (272)
T PRK09861         10 AGAALLLAGILLAGCDQSSSD   30 (272)
T ss_pred             HHHHHHHHHHHHHHCCCCCCC
T ss_conf             999999999998745897678


No 165
>PRK12789 flgI flagellar basal body P-ring protein; Reviewed
Probab=22.02  E-value=53  Score=14.01  Aligned_cols=17  Identities=24%  Similarity=0.339  Sum_probs=11.7

Q ss_pred             CHHHHHHHHHHHHHHHH
Q ss_conf             94789999999999975
Q gi|254780953|r    1 MIKELGLSMFIMTTISG   17 (190)
Q Consensus         1 m~k~l~l~~~~~~~l~g   17 (190)
                      |||++++.+++.+++..
T Consensus         1 m~~~~~~~~~~~l~~~~   17 (367)
T PRK12789          1 MIRRLLLAVLLALLAGP   17 (367)
T ss_pred             CHHHHHHHHHHHHHHCC
T ss_conf             90899999999998553


No 166
>pfam03032 Brevenin Brevenin/esculentin/gaegurin/rugosin family. This family contains a number of defence peptides secreted from the skin of amphibians, including the opiate-like dermorphins and deltorphins, and the antimicrobial dermoseptins and temporins.
Probab=21.93  E-value=59  Score=13.77  Aligned_cols=20  Identities=30%  Similarity=0.536  Sum_probs=11.2

Q ss_pred             CHHHHHHHHHH-HHHHHHCCC
Q ss_conf             94789999999-999975147
Q gi|254780953|r    1 MIKELGLSMFI-MTTISGCGL   20 (190)
Q Consensus         1 m~k~l~l~~~~-~~~l~g~~~   20 (190)
                      |+|.+++.+|+ ++.++-|-.
T Consensus         3 lKKSlll~fFLG~islSlCe~   23 (46)
T pfam03032         3 LKKSLLLVLFLGLVSLSLCEE   23 (46)
T ss_pred             CCHHHHHHHHHHHHHHHHHHH
T ss_conf             105389999986514765244


No 167
>COG2834 LolA Outer membrane lipoprotein-sorting protein [Cell envelope biogenesis, outer membrane]
Probab=21.80  E-value=56  Score=13.90  Aligned_cols=22  Identities=27%  Similarity=0.389  Sum_probs=14.5

Q ss_pred             CHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             9478999999999997514788
Q gi|254780953|r    1 MIKELGLSMFIMTTISGCGLAS   22 (190)
Q Consensus         1 m~k~l~l~~~~~~~l~g~~~~~   22 (190)
                      |++.++..++.+++++||+...
T Consensus         5 ~~~~~~~~~l~~~f~~~~~~~~   26 (211)
T COG2834           5 MMKLLLALALLLLFLSACAQAG   26 (211)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHH
T ss_conf             8999999999999988887745


No 168
>pfam09961 DUF2195 Uncharacterized protein conserved in bacteria (DUF2195). This domain, found in various hypothetical bacterial proteins, has no known function.
Probab=21.55  E-value=60  Score=13.70  Aligned_cols=54  Identities=13%  Similarity=0.004  Sum_probs=36.5

Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCCCCCHHHHHCCCCEEEEEE
Q ss_conf             20011122589999999988852387451699997034588899769779852991699993
Q gi|254780953|r  122 TLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIF  183 (190)
Q Consensus       122 ~~~~N~~LS~~RA~~V~~~L~~~g~~~~r~i~v~g~G~~~p~~~n~~~~~ra~NRRVei~i~  183 (190)
                      |.--++.+|..++..++.+|. +|..+-+.-    -+-+-|++   ++.+.+.||+|.+.+-
T Consensus        63 SAL~~Y~s~v~~~~g~~~~LQ-~G~~~~~~~----~~rtl~LA---sd~~l~~dr~v~l~lg  116 (121)
T pfam09961        63 SALVRYQSLVEFARGSRLVLQ-EGLFNLAKS----QGRTLPLA---TDAALVFDGRLALRLG  116 (121)
T ss_pred             HHHHHHHHHHHHHHHHHHHHH-HHHHHHHHC----CCEEEEEE---CCHHHHCCCEEEEEEE
T ss_conf             899999999887277899999-760665415----86479975---3744513870799983


No 169
>PHA00407 phage lambda Rz1-like protein
Probab=21.55  E-value=60  Score=13.70  Aligned_cols=21  Identities=38%  Similarity=0.681  Sum_probs=14.9

Q ss_pred             HHHHHHHHHHHHHCCCCCCCC
Q ss_conf             999999999997514788765
Q gi|254780953|r    5 LGLSMFIMTTISGCGLASREK   25 (190)
Q Consensus         5 l~l~~~~~~~l~g~~~~~~~~   25 (190)
                      +.+.+.++..++||++.+...
T Consensus        36 IGlllicv~tISGCaSes~lp   56 (84)
T PHA00407         36 IGLLLICVATISGCASESKLP   56 (84)
T ss_pred             HHHHHHHHHHHHHHHHCCCCC
T ss_conf             999999999976665025699


No 170
>PRK10796 LPS-assembly lipoprotein RlpB; Provisional
Probab=21.12  E-value=62  Score=13.65  Aligned_cols=54  Identities=19%  Similarity=0.242  Sum_probs=22.8

Q ss_pred             HHHHHHHHHCCCCCCCCCCCCCCCCCCC-CCCCCHHHHHHHHHHHHHHHHHCCCCCEEEE
Q ss_conf             9999999751478876544444555543-1111001233788899999972017835886
Q gi|254780953|r    9 MFIMTTISGCGLASREKKKVFLHKSNDT-DIVNKRFGSSLDKAEDEFQMQLQDTGIVVSR   67 (190)
Q Consensus         9 ~~~~~~l~g~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~   67 (190)
                      .+.+++++||+-.-......  +.+... ..........+   ...++..+...++.+..
T Consensus        10 ~lavll~agCGFhLRg~~~l--P~~l~tL~l~S~Dpys~L---tr~vr~qLr~~gV~lv~   64 (196)
T PRK10796         10 SLAVLVTAGCGWHLRGTTQV--PSEMKTMILDSGDPNGPL---SRAVRNQLRLNGVELLD   64 (196)
T ss_pred             HHHHHHHCCCCCEECCCCCC--CCCCCEEEEEECCCCCHH---HHHHHHHHHHCCCEEEC
T ss_conf             99999974767157689999--864445899804878679---99999999877958963


No 171
>COG4259 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=20.96  E-value=62  Score=13.63  Aligned_cols=24  Identities=29%  Similarity=0.566  Sum_probs=14.7

Q ss_pred             CHHHHHHH----HHHHHHHHHCCCCCCC
Q ss_conf             94789999----9999999751478876
Q gi|254780953|r    1 MIKELGLS----MFIMTTISGCGLASRE   24 (190)
Q Consensus         1 m~k~l~l~----~~~~~~l~g~~~~~~~   24 (190)
                      |+|-..+.    ++.+.+++||+..+..
T Consensus         1 M~~~ktlsr~al~~av~~LagC~~gpKs   28 (121)
T COG4259           1 MSKLKTLSRLALLLAVAALAGCGGGPKS   28 (121)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHCCCCCCC
T ss_conf             9514889999999999999880579864


No 172
>PHA02118 hypothetical protein
Probab=20.83  E-value=63  Score=13.61  Aligned_cols=25  Identities=28%  Similarity=0.570  Sum_probs=17.1

Q ss_pred             HHHHHHHHHHHHHHHHCCCCCCCCC
Q ss_conf             4789999999999975147887654
Q gi|254780953|r    2 IKELGLSMFIMTTISGCGLASREKK   26 (190)
Q Consensus         2 ~k~l~l~~~~~~~l~g~~~~~~~~~   26 (190)
                      ||-..|+.|...+|+||+....+..
T Consensus         5 lk~~~maa~~aa~~sgcg~~~~~~~   29 (202)
T PHA02118          5 LKMGIMAAFVSAALSGCGQANTDDT   29 (202)
T ss_pred             HHHHHHHHHHHHHHCCCCCCCCCCC
T ss_conf             5778999999999705565555653


No 173
>PRK09578 periplasmic multidrug efflux lipoprotein precursor; Reviewed
Probab=20.64  E-value=63  Score=13.59  Aligned_cols=22  Identities=23%  Similarity=0.644  Sum_probs=13.0

Q ss_pred             HHHHH-HHHHHHHHHHCCCCCCC
Q ss_conf             78999-99999999751478876
Q gi|254780953|r    3 KELGL-SMFIMTTISGCGLASRE   24 (190)
Q Consensus         3 k~l~l-~~~~~~~l~g~~~~~~~   24 (190)
                      +++.+ +++++++|+||+.....
T Consensus         7 ~~~~l~~l~~~~~L~gC~~~~~~   29 (385)
T PRK09578          7 RRLALAALVAAFALAGCGKGDSD   29 (385)
T ss_pred             HHHHHHHHHHHHHHHCCCCCCCC
T ss_conf             99999999999998167999878


No 174
>PRK12699 flgH flagellar basal body L-ring protein; Reviewed
Probab=20.16  E-value=65  Score=13.53  Aligned_cols=21  Identities=19%  Similarity=0.551  Sum_probs=14.1

Q ss_pred             HHHHHHHHHHHCCCCCCCCCC
Q ss_conf             999999999751478876544
Q gi|254780953|r    7 LSMFIMTTISGCGLASREKKK   27 (190)
Q Consensus         7 l~~~~~~~l~g~~~~~~~~~~   27 (190)
                      +.++++++++||+..+..+..
T Consensus        22 ~~~~~~~~l~gC~~~~~~p~~   42 (246)
T PRK12699         22 VLIVMLALVGGCSLPTPAPKV   42 (246)
T ss_pred             HHHHHHHHHCCCCCCCCCCCC
T ss_conf             999999986044689998767


No 175
>PRK13733 conjugal transfer protein TraV; Provisional
Probab=20.04  E-value=11  Score=17.75  Aligned_cols=26  Identities=27%  Similarity=0.226  Sum_probs=15.5

Q ss_pred             CHHHHHHH-HHHHHHHHHCCCCCCCCC
Q ss_conf             94789999-999999975147887654
Q gi|254780953|r    1 MIKELGLS-MFIMTTISGCGLASREKK   26 (190)
Q Consensus         1 m~k~l~l~-~~~~~~l~g~~~~~~~~~   26 (190)
                      |+|..++. +...++|+||+-...+-.
T Consensus         1 mk~~~~l~~l~~~llLtGCAG~nSdFd   27 (171)
T PRK13733          1 MKKISLLIPLLGTLLLSGCAGTNSEFE   27 (171)
T ss_pred             CCEEEEEHHHCCEEEEECCCCCCCCCC
T ss_conf             951675112026002602457775454


Done!