HHsearch alignment of GI: 254780953 and MMDB domain: 3cyp_B_

>3cyp_B (B:) Chemotaxis protein MOTB; bacterial flagellar motor, peptidoglycan binding, bacterial flagellum, flagellar rotation, inner membrane, membrane; 1.60A {Helicobacter pylori} PDB: 3cyq_B*
Probab=99.96  E-value=1.5e-28  Score=178.77  Aligned_cols=109  Identities=27%  Similarity=0.413  Sum_probs=100.1

Q ss_pred             CCEECC-CHHH-CCHHHHHHHHHHHHHHHHCCC-CEEEEEEECCCC----CCHHHHHHHHHHHHHHHHHHHHHHCCCCCC
Q ss_conf             211128-8131-099999999999999985899-489999803778----720011122589999999988852387451
Q gi|254780953|r   78 VHVSFV-SEVF-LEKKFLPMLQLIATILNKFPS-TVIAIQSHTDSI----GTLKNNLLISQERADVIKSYLIQRGVSSNR  150 (190)
Q Consensus        78 ~~~~f~-~~a~-l~~~~~~~L~~ia~~l~~~~~-~~i~I~GHTD~~----g~~~~N~~LS~~RA~~V~~~L~~~g~~~~r  150 (190)
                      +.+||+ +++. |+++++..|++|+.+|+.+|+ ..|.|+||||+.    |++.+||.||.+||.+|+.||+..|+++.|
T Consensus         3 ~~v~F~~~ss~~l~~~~~~~l~~ia~~l~~~~~~~~I~I~GhtD~~~~~~g~~~~N~~LS~~RA~~V~~~l~~~gi~~~r   82 (138)
T 3cyp_B            3 DPFTFENATSDAINQDMMLYIERIAKIIQKLPKRVHINVRGFTDDTPLVKTRFKSHYELAANRAYRVMKVLIQYGVNPNQ   82 (138)
T ss_dssp             CCEECSSTTCCCCCHHHHHHHHHHHHHHTTSCTTCEEEEEEECCCCCC----CCSHHHHHHHHHHHHHHHHHHTTCCGGG
T ss_pred             CCEECCCCCHHHCCHHHHHHHHHHHHHHHHCCCCEEEEEEEEECCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCE
T ss_conf             86663899624339989999999999999689970899998608988777870779999999999999999985999565


Q ss_pred             EEEEEEECCCCCCCCCCCHHHHHCCCCEEEEEECCHH
Q ss_conf             6999970345888997697798529916999930101
Q gi|254780953|r  151 FISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGN  187 (190)
Q Consensus       151 ~i~v~g~G~~~p~~~n~~~~~ra~NRRVei~i~~~~~  187 (190)
                       |.+.|||+.+|+++|+++++|++||||||.|.+...
T Consensus        83 -i~~~g~G~~~p~~~~~~~~~~~~NRRVei~i~~~~~  118 (138)
T 3cyp_B           83 -LSFSSYGSTNPIAPNDSLENRMKNNRVEIFFSTDAN  118 (138)
T ss_dssp             -EEEEECTTCSCSSCTTSHHHHHHHSEEEEEEEEEHH
T ss_pred             -EEEEEECCCCCCCCCCCHHHHHHCCCEEEEEECCHH
T ss_conf             -999984556767999397899724968999970827