HHsearch results for GI: 254780953 and protein with PDBid: 3khn_A

>3khn_A MOTB protein, putative; structural genomics, OMPA-like domain, PSI-2, protein structure initiative; 2.03A {Desulfovibrio vulgaris str}
Probab=100.00  E-value=1.7e-32  Score=200.01  Aligned_cols=132  Identities=22%  Similarity=0.279  Sum_probs=116.3

Q ss_pred             HHHHHCCCCCEEEEECCEEEEEECCCEECC-CHHHCCHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCC-----CHHHHH
Q ss_conf             999720178358860875899852211128-81310999999999999999858994899998037787-----200111
Q gi|254780953|r   54 FQMQLQDTGIVVSRIGDMITCYIPVHVSFV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIG-----TLKNNL  127 (190)
Q Consensus        54 l~~~~~~~~~~~~~~~~~~~~~~~~~~~f~-~~a~l~~~~~~~L~~ia~~l~~~~~~~i~I~GHTD~~g-----~~~~N~  127 (190)
                      +........+.+......+.+.++..++|. +++.|++++++.|+.++.+|+.+|...|.|+||||+.|     .+.+||
T Consensus        27 ~~~~~~~~~v~~~~~~~~~~i~l~~~v~F~~gs~~L~~~~~~~L~~la~~l~~~~~~~i~I~GHTD~~~~~~~~~~~~N~  106 (174)
T 3khn_A           27 FTVNGVEGVIGAVFDEGVITLRVPSEVLFAPGAVELAPGADRVLATLKDLFIRRREQNINIKGFTDDVQPSANARFKDNW  106 (174)
T ss_dssp             HHHTTCTTTCEEEEETTEEEEEEEHHHHBCTTCCSBCTTHHHHHHHHHHHHHHTTTCEEEEEEECCSCCCCTTSSCSSHH
T ss_pred             HHHHCCCCCEEEEEECCEEEEEECCCCEECCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCCCCCCCCHH
T ss_conf             98614667469998599899993588400799753497699999999999977899589999981787755566721047


Q ss_pred             HHHHHHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCCCCCHHHHHCCCCEEEEEECCH
Q ss_conf             22589999999988852387451699997034588899769779852991699993010
Q gi|254780953|r  128 LISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRG  186 (190)
Q Consensus       128 ~LS~~RA~~V~~~L~~~g~~~~r~i~v~g~G~~~p~~~n~~~~~ra~NRRVei~i~~~~  186 (190)
                      .||.+||.+|+.||+..|+++.| |.+.|||+++|+++|+++++|++||||||+|.+|.
T Consensus       107 ~LS~~RA~aV~~~L~~~gi~~~r-i~~~g~G~~~P~~~n~~~~~~~~NRRVei~i~~~~  164 (174)
T 3khn_A          107 EVSALRSVNVLRYFLGAGIEPAR-LTATGLGELDPLFPNTSDENRARNRRVEFVLERRV  164 (174)
T ss_dssp             HHHHHHHHHHHHHHHHTTCCGGG-EEEEEEETSSCSSCSSSHHHHHHHSEEEEEEEC--
T ss_pred             HHHHHHHHHHHHHHHHCCCCHHE-EEEEEEECCCCCCCCCCHHHHHHCCCEEEEEEECC
T ss_conf             89999999999999984999533-99999825677899929789987497899998534