Query         gi|254780953|ref|YP_003065366.1| OmpA/MotB [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 190
No_of_seqs    126 out of 7161
Neff          9.4 
Searched_HMMs 23785
Date          Wed Jun  1 00:19:04 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780953.hhm -d /home/congqian_1/database/pdb/pdb70.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 3ldt_A Outer membrane protein, 100.0 1.3E-36 5.4E-41  223.0  13.2  144   42-187    19-164 (169)
  2 2k1s_A Inner membrane lipoprot 100.0 9.7E-36 4.1E-40  218.1  16.0  141   46-187     2-143 (149)
  3 3khn_A MOTB protein, putative; 100.0 1.7E-32 7.1E-37  200.0  15.6  132   54-186    27-164 (174)
  4 2zov_A Chemotaxis protein MOTB 100.0 8.2E-31 3.4E-35  190.6  13.7  124   60-186    50-182 (210)
  5 2zvy_A Chemotaxis protein MOTB 100.0 4.1E-30 1.7E-34  186.7  15.9  124   61-187    40-172 (183)
  6 1r1m_A Outer membrane protein  100.0 7.2E-31   3E-35  190.9   9.8  111   74-185    11-142 (164)
  7 2kgw_A Outer membrane protein  100.0 1.6E-30 6.9E-35  188.9  11.5  104   78-182    24-128 (129)
  8 3oon_A Outer membrane protein  100.0 1.1E-29 4.7E-34  184.2  12.0  121   61-184     2-123 (123)
  9 2hqs_H Peptidoglycan-associate 100.0 1.7E-29 7.1E-34  183.2  10.3  108   77-185     5-113 (118)
 10 2aiz_P Outer membrane protein  100.0 3.3E-29 1.4E-33  181.6  11.7  103   79-182    31-134 (134)
 11 3cyp_B Chemotaxis protein MOTB 100.0 3.7E-29 1.5E-33  181.4  11.9  108   79-187     4-118 (138)
 12 2zf8_A MOTY, component of sodi 100.0 7.5E-30 3.2E-34  185.2   7.9  108   79-188   163-272 (278)
 13 1rbl_M Ribulose 1,5 bisphospha  49.2      12 0.00051   16.4   3.7   29   91-119    66-94  (109)
 14 1svd_M Ribulose bisphosphate c  44.3      15 0.00061   15.9   3.8   25   92-116    69-93  (110)
 15 1wdd_S Ribulose bisphosphate c  35.9      20 0.00084   15.2   3.7   30   91-120    78-107 (128)
 16 2o66_A PII protein; regulation  34.4      21 0.00089   15.0   4.4   31  132-162    23-53  (135)
 17 3g7n_A Lipase; hydrolase fold,  32.6      23 0.00095   14.9   8.7   61   92-167   107-167 (258)
 18 1tib_A Lipase; hydrolase(carbo  32.5      23 0.00096   14.9   8.4   60   93-169   122-181 (269)
 19 1w7f_A Beta-lactamase; hydrola  29.6      23 0.00099   14.8   2.1   23    2-24     11-33  (307)
 20 2xbp_A Nitrogen regulatory pro  28.9      26  0.0011   14.5   2.8   31  132-162    11-41  (113)
 21 1bxn_I Rubisco, protein (ribul  27.3      28  0.0012   14.3   4.2   32   91-122    60-91  (139)
 22 1gk8_I Ribulose bisphosphate c  26.6      29  0.0012   14.3   3.7   31   91-121    85-115 (140)
 23 2j9c_A GLNK1, hypothetical nit  26.5      29  0.0012   14.3   3.3   32  132-163    13-44  (119)
 24 2f2f_C CDT C, cytolethal diste  26.0      12  0.0005   16.4   0.1   22    2-24      1-22  (186)
 25 1bwv_S Rubisco, protein (ribul  25.9      30  0.0013   14.2   4.1   31   91-121    60-90  (138)
 26 3c9h_A ABC transporter, substr  23.9      29  0.0012   14.2   1.7   16    1-16      1-16  (355)
 27 3ce8_A Putative PII-like nitro  23.6      33  0.0014   13.9   3.5   48  135-183    36-84  (120)
 28 2ogh_A Eukaryotic translation   22.7      35  0.0015   13.8   2.2   25  133-157    84-108 (108)
 29 1lgy_A Lipase, triacylglycerol  21.2      37  0.0016   13.7   4.4   57   94-161   122-179 (269)
 30 2jep_A Xyloglucanase; family 5  20.5      39  0.0016   13.6   6.6   75   84-159   100-182 (395)
 31 2if1_A EIF1, SUI1; translation  20.4      33  0.0014   14.0   1.4   26  132-157   101-126 (126)

No 1  
>3ldt_A Outer membrane protein, OMPA family protein; OMPA-like domain, PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.30A {Legionella pneumophila}
Probab=100.00  E-value=1.3e-36  Score=223.02  Aligned_cols=144  Identities=28%  Similarity=0.421  Sum_probs=128.9

Q ss_pred             HHHHHHHHHHHHHHHHHCCCCCEEEEECCEEEEEECCCEECC-CHHHCCHHHHHHHHHHHHHHHHCCCCEEEEEEECCCC
Q ss_conf             012337888999999720178358860875899852211128-8131099999999999999985899489999803778
Q gi|254780953|r   42 RFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSI  120 (190)
Q Consensus        42 ~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~f~-~~a~l~~~~~~~L~~ia~~l~~~~~~~i~I~GHTD~~  120 (190)
                      ....+++.. .++...+...++.+...++.+.+.++..++|+ +++.|+++++..|++|+.+|+++|+..|.|+||||+.
T Consensus        19 ~~~~~~d~~-~~~~~~l~~~~v~v~~~~~~~~v~l~~~v~F~~~s~~l~~~~~~~L~~ia~~L~~~p~~~i~I~GhTD~~   97 (169)
T 3ldt_A           19 VASIYRDSK-RKIIRDLQKQDIQYVEYGDTRTLIIPTDKYFMFSSPRLNEICYPGLNNVIRLLNFYPQSTIYVAGFTDNV   97 (169)
T ss_dssp             TTHHHHHHH-HHHHHHHHHTTCEEEEETTEEEEEEETTTCCC-CCHHHHHHHCHHHHHHHHHHTTCTTSCEEEEEECTTS
T ss_pred             HHHHHHHHH-HHHHHHHHCCCCEEEEECCEEEEEECCCCEECCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEEEEECCCC
T ss_conf             764329999-9999998539937999699899990688347299642698899999999999997899579999973898


Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCCCCCHHHHHCCCCEEEEEEC-CHH
Q ss_conf             7200111225899999999888523874516999970345888997697798529916999930-101
Q gi|254780953|r  121 GTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP-RGN  187 (190)
Q Consensus       121 g~~~~N~~LS~~RA~~V~~~L~~~g~~~~r~i~v~g~G~~~p~~~n~~~~~ra~NRRVei~i~~-~~~  187 (190)
                      |++.|||.||++||.+|++||+.+|+++.| |.+.|||+++|+++|+++++|++||||||.|++ +|+
T Consensus        98 g~~~~N~~LS~~RA~~V~~~L~~~Gv~~~r-i~~~G~G~~~Pv~~n~t~egra~NRRVei~i~~~~g~  164 (169)
T 3ldt_A           98 GSRSHKRKLSQAQAETMMTFLWANGIAAKR-LKAEGYGDKNAISDNAIIHGSAQNRRIEIQWFTSEGH  164 (169)
T ss_dssp             CCC--CHHHHHHHHHHHHHHHHHTTCCTTT-EEECCTTCTTSCCCTTTSCGGGGTSEEEEEEECCCC-
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHCCCCHHH-EEEEEECCCCCCCCCCCHHHHHHCCCEEEEEEECCCC
T ss_conf             976675779999999999999985999799-8999975668679993988998549889999958987


No 2  
>2k1s_A Inner membrane lipoprotein YIAD; abbababab, OMPA, alpha beta, palmitate, transmembrane, structural genomics, PSI-2; NMR {Escherichia coli K12}
Probab=100.00  E-value=9.7e-36  Score=218.14  Aligned_cols=141  Identities=33%  Similarity=0.502  Sum_probs=133.7

Q ss_pred             HHHHHHHHHHHHHCCCCCEEEEECCEEEEEECCCEECC-CHHHCCHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCHH
Q ss_conf             37888999999720178358860875899852211128-81310999999999999999858994899998037787200
Q gi|254780953|r   46 SLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLK  124 (190)
Q Consensus        46 ~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~f~-~~a~l~~~~~~~L~~ia~~l~~~~~~~i~I~GHTD~~g~~~  124 (190)
                      ++|..++.++..+...++.+...++.+.+.++..++|. +++.|+++++..|+.++..|+.+|+..|.|+||||..|+..
T Consensus         2 ~~d~~e~~Lr~~l~~~~v~v~~~~~~~~l~l~~~v~F~~~s~~L~~~~~~~L~~ia~~L~~~~~~~i~I~GhtD~~g~~~   81 (149)
T 2k1s_A            2 YMDVQEAKLRDKMRGTGVSVTRSGDNIILNMPNNVTFDSSSATLKPAGANTLTGVAMVLKEYPKTAVNVIGYTDSTGGHD   81 (149)
T ss_dssp             CSHHHHHHHHHHTTTTSCEEEEETTEEEEEEEHHHHBSSSSSCBCHHHHHHHHHHHHHHHHCTTEEEEEEEECCCTTCHH
T ss_pred             CHHHHHHHHHHHHCCCCCEEEEECCEEEEECCCCCEECCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEEEEEECCCCCHH
T ss_conf             77899999999862599679997999999868740542997226988999999999999648995799998807868955


Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCCCCCHHHHHCCCCEEEEEECCHH
Q ss_conf             111225899999999888523874516999970345888997697798529916999930101
Q gi|254780953|r  125 NNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGN  187 (190)
Q Consensus       125 ~N~~LS~~RA~~V~~~L~~~g~~~~r~i~v~g~G~~~p~~~n~~~~~ra~NRRVei~i~~~~~  187 (190)
                      +||.||.+||.+|+.||+..|+.+.| +.+.|||+++|+++|+++++|++||||||.|+|.-+
T Consensus        82 ~N~~LS~~RA~~V~~~L~~~Gi~~~r-l~~~g~G~~~P~~~~~~~~~~~~NRRVei~i~P~~~  143 (149)
T 2k1s_A           82 LNMRLSQQRADSVASALITQGVDASR-IRTQGLGPANPIASNSTAEGKAQNRRVEITLSPLLE  143 (149)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHTCCGGG-EEEEECTTTCCSSCSSSHHHHHHHSEEEEEEEECSS
T ss_pred             HHHHHHHHHHHHHHHHHHHCCCCHHE-EEEEEECCCCCCCCCCCHHHHHHCCCEEEEEECCCH
T ss_conf             73689999999999999985999325-999998675777999297789735979999971514


No 3  
>3khn_A MOTB protein, putative; structural genomics, OMPA-like domain, PSI-2, protein structure initiative; 2.03A {Desulfovibrio vulgaris str}
Probab=100.00  E-value=1.7e-32  Score=200.01  Aligned_cols=132  Identities=22%  Similarity=0.279  Sum_probs=116.3

Q ss_pred             HHHHHCCCCCEEEEECCEEEEEECCCEECC-CHHHCCHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCC-----CHHHHH
Q ss_conf             999720178358860875899852211128-81310999999999999999858994899998037787-----200111
Q gi|254780953|r   54 FQMQLQDTGIVVSRIGDMITCYIPVHVSFV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIG-----TLKNNL  127 (190)
Q Consensus        54 l~~~~~~~~~~~~~~~~~~~~~~~~~~~f~-~~a~l~~~~~~~L~~ia~~l~~~~~~~i~I~GHTD~~g-----~~~~N~  127 (190)
                      +........+.+......+.+.++..++|. +++.|++++++.|+.++.+|+.+|...|.|+||||+.|     .+.+||
T Consensus        27 ~~~~~~~~~v~~~~~~~~~~i~l~~~v~F~~gs~~L~~~~~~~L~~la~~l~~~~~~~i~I~GHTD~~~~~~~~~~~~N~  106 (174)
T 3khn_A           27 FTVNGVEGVIGAVFDEGVITLRVPSEVLFAPGAVELAPGADRVLATLKDLFIRRREQNINIKGFTDDVQPSANARFKDNW  106 (174)
T ss_dssp             HHHTTCTTTCEEEEETTEEEEEEEHHHHBCTTCCSBCTTHHHHHHHHHHHHHHTTTCEEEEEEECCSCCCCTTSSCSSHH
T ss_pred             HHHHCCCCCEEEEEECCEEEEEECCCCEECCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCCCCCCCCHH
T ss_conf             98614667469998599899993588400799753497699999999999977899589999981787755566721047


Q ss_pred             HHHHHHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCCCCCHHHHHCCCCEEEEEECCH
Q ss_conf             22589999999988852387451699997034588899769779852991699993010
Q gi|254780953|r  128 LISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRG  186 (190)
Q Consensus       128 ~LS~~RA~~V~~~L~~~g~~~~r~i~v~g~G~~~p~~~n~~~~~ra~NRRVei~i~~~~  186 (190)
                      .||.+||.+|+.||+..|+++.| |.+.|||+++|+++|+++++|++||||||+|.+|.
T Consensus       107 ~LS~~RA~aV~~~L~~~gi~~~r-i~~~g~G~~~P~~~n~~~~~~~~NRRVei~i~~~~  164 (174)
T 3khn_A          107 EVSALRSVNVLRYFLGAGIEPAR-LTATGLGELDPLFPNTSDENRARNRRVEFVLERRV  164 (174)
T ss_dssp             HHHHHHHHHHHHHHHHTTCCGGG-EEEEEEETSSCSSCSSSHHHHHHHSEEEEEEEC--
T ss_pred             HHHHHHHHHHHHHHHHCCCCHHE-EEEEEEECCCCCCCCCCHHHHHHCCCEEEEEEECC
T ss_conf             89999999999999984999533-99999825677899929789987497899998534


No 4  
>2zov_A Chemotaxis protein MOTB; 2-layer sandwich, bacterial flagellum, cell projection, flagellar rotation, inner membrane, membrane; 2.00A {Salmonella typhimurium}
Probab=99.97  E-value=8.2e-31  Score=190.60  Aligned_cols=124  Identities=20%  Similarity=0.309  Sum_probs=107.0

Q ss_pred             CCCCEEEEECCEEEEEE---CCCEECC-CHHHCCHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCC-----HHHHHHHH
Q ss_conf             17835886087589985---2211128-813109999999999999998589948999980377872-----00111225
Q gi|254780953|r   60 DTGIVVSRIGDMITCYI---PVHVSFV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGT-----LKNNLLIS  130 (190)
Q Consensus        60 ~~~~~~~~~~~~~~~~~---~~~~~f~-~~a~l~~~~~~~L~~ia~~l~~~~~~~i~I~GHTD~~g~-----~~~N~~LS  130 (190)
                      ...+.+....+++.+.+   +..++|. +++.|+++++..|++|+.+|+.+|+ .|.|+||||+.|.     +.+||+||
T Consensus        50 ~~~~~i~~~~~gl~i~i~d~~~~vlF~~gsa~l~~~~~~~L~~ia~~l~~~p~-~i~I~GHTD~~~~~~~~~~~sN~~LS  128 (210)
T 2zov_A           50 RPHLKIDLVQEGLRIQIIDSQNRPMFKTGSAEVEPYMRDILRAIAPVLNGIPN-RISLAGHTDDFPYANGEKGYSNWELS  128 (210)
T ss_dssp             GGGEEEEEETTEEEEEEECCSSSCSBCTTSCCBCHHHHHHHHHHHHHHTTSCC-CEEEEEEEECSCCCSSCSSCCHHHHH
T ss_pred             HCCCEEEECCCCEEEEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCC-EEEEEEECCCCCCCCCCCCCHHHHHH
T ss_conf             23735898169518999848998476899743598899999999999973585-69999864887644577643067899


Q ss_pred             HHHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCCCCCHHHHHCCCCEEEEEECCH
Q ss_conf             89999999988852387451699997034588899769779852991699993010
Q gi|254780953|r  131 QERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRG  186 (190)
Q Consensus       131 ~~RA~~V~~~L~~~g~~~~r~i~v~g~G~~~p~~~n~~~~~ra~NRRVei~i~~~~  186 (190)
                      .+||.+|+.||+..|+++++++++.|||+++|+.+|+  +++++||||||+|+++.
T Consensus       129 ~~RA~aV~~~L~~~g~~~~~~l~v~G~G~~~P~~~~~--~~~a~NRRVEI~il~~~  182 (210)
T 2zov_A          129 ADRANASRRELVAGGLDNGKVLRVVGMAATMRLSDRG--PDDAINRRISLLVLNKQ  182 (210)
T ss_dssp             HHHHHHHHHHHHHTTCCTTCEEEEEEECCC-----------CCCEEEEEEEEECHH
T ss_pred             HHHHHHHHHHHHHCCCCCCCEEEEEEECCCCCCCCCC--CCHHHCCCEEEEEECCH
T ss_conf             9999999999998599804589999867887899799--66487298899997856


No 5  
>2zvy_A Chemotaxis protein MOTB; 2-layer sandwich, bacterial flagellum, cell inner membrane, cell membrane, flagellar rotation, membrane; 1.75A {Salmonella typhimurium} PDB: 2zvz_A
Probab=99.97  E-value=4.1e-30  Score=186.69  Aligned_cols=124  Identities=20%  Similarity=0.330  Sum_probs=107.4

Q ss_pred             CCCEEEEECCEEEEEE---CCCEECC-CHHHCCHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCHH-----HHHHHHH
Q ss_conf             7835886087589985---2211128-81310999999999999999858994899998037787200-----1112258
Q gi|254780953|r   61 TGIVVSRIGDMITCYI---PVHVSFV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLK-----NNLLISQ  131 (190)
Q Consensus        61 ~~~~~~~~~~~~~~~~---~~~~~f~-~~a~l~~~~~~~L~~ia~~l~~~~~~~i~I~GHTD~~g~~~-----~N~~LS~  131 (190)
                      ..+.+....+++.+.+   +..+||+ +++.|+|+++..|+.||.+|+.+|+ .|.|+||||+.|...     +||.||.
T Consensus        40 ~~i~i~~~~~gl~i~i~~~~~~~lF~~gsa~l~~~~~~~L~~ia~~l~~~~~-~i~I~GHTD~~~~~~~~~~~~N~~LS~  118 (183)
T 2zvy_A           40 PHLKIDLVQEGLRIQIIDSQNRPMFKTGSAEVEPYMRDILRAIAPVLNGIPN-RISLAGHTDDFPYANGEKGYSNWELSA  118 (183)
T ss_dssp             GGEEEEEETTEEEEEEECCSSSCSBCTTCCSBCHHHHHHHHHHHHHHTTSCC-CEEEEEECCSSCTTCSTTSSCHHHHHH
T ss_pred             HCCEEEEECCCCEEEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCC-EEEEEEECCCCCCCCCCCCCCHHHHHH
T ss_conf             0625898079618999868998686999733698799999999999973486-699998628877556776431468999


Q ss_pred             HHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCCCCCHHHHHCCCCEEEEEECCHH
Q ss_conf             99999999888523874516999970345888997697798529916999930101
Q gi|254780953|r  132 ERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGN  187 (190)
Q Consensus       132 ~RA~~V~~~L~~~g~~~~r~i~v~g~G~~~p~~~n~~~~~ra~NRRVei~i~~~~~  187 (190)
                      +||.+|+.||+..|++++|++++.|||+.+|+.++++  ++++||||||+|+++..
T Consensus       119 ~RA~aV~~~L~~~Gv~~~r~l~~~G~g~~~p~~~~~~--~~~~NRRVeI~il~~~~  172 (183)
T 2zvy_A          119 DRANASRRELVAGGLDNGKVLRVVGMAATMRLSDRGP--DDAINRRISLLVLNKQA  172 (183)
T ss_dssp             HHHHHHHHHHHHTTCCTTCEEEEEECTTTTCSSCSST--TGGGGSEEEEEEECHHH
T ss_pred             HHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCCCCC--CHHHHCCEEEEEECCHH
T ss_conf             9999999999980899668899999577777998996--20650988999989678


No 6  
>1r1m_A Outer membrane protein class 4; 1.90A {Neisseria meningitidis} SCOP: d.79.7.1
Probab=99.97  E-value=7.2e-31  Score=190.90  Aligned_cols=111  Identities=23%  Similarity=0.292  Sum_probs=103.0

Q ss_pred             EEECCCEECC-CHHHCCHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCEE
Q ss_conf             9852211128-813109999999999999998589948999980377872001112258999999998885238745169
Q gi|254780953|r   74 CYIPVHVSFV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFI  152 (190)
Q Consensus        74 ~~~~~~~~f~-~~a~l~~~~~~~L~~ia~~l~~~~~~~i~I~GHTD~~g~~~~N~~LS~~RA~~V~~~L~~~g~~~~r~i  152 (190)
                      +.++..++|+ +++.|+++++..|+.|+.+|+.+|...|.|+||||+.|+.+|||.||++||++|++||+..|+.+.| |
T Consensus        11 i~l~~~v~F~~~s~~L~~~~~~~L~~ia~~l~~~~~~~I~I~GhtD~~G~~~~N~~LS~~RA~aV~~~L~~~Gi~~~r-i   89 (164)
T 1r1m_A           11 ISLSAKTLFGFDKDSLRAEAQDNLKVLAQRLSRTNIQSVRVEGHTDFMGSDKYNQALSERRAYVVANNLVSNGVPVSR-I   89 (164)
T ss_dssp             EEEEHHHHHTTSSSCCCHHHHHHHHHHHHHHTTSCEEEEEEEEECCSSSCHHHHHHHHHHHHHHHHHHHHHTTCCGGG-E
T ss_pred             EEECCCEEECCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEEEEEECCCCCHHHHHHHHHHHHHHHHHHHHHCCCCHHH-E
T ss_conf             997773357289743698999999999999977898189999981898985562699999999999999985999899-8


Q ss_pred             EEEEECCCCCCCCCCCHHHHHC--------------------CCCEEEEEECC
Q ss_conf             9997034588899769779852--------------------99169999301
Q gi|254780953|r  153 SVRGFAYKYPIDTNDTKVGRQN--------------------NQRIEIQIFPR  185 (190)
Q Consensus       153 ~v~g~G~~~p~~~n~~~~~ra~--------------------NRRVei~i~~~  185 (190)
                      .+.|||+++|+++|.++.++++                    ||||||.|.+-
T Consensus        90 ~~~g~Ge~~P~~~n~t~~~~a~~~~~~~~~~~r~~~i~~~~~NRRVEi~v~~~  142 (164)
T 1r1m_A           90 SAVGLGESQAQMTQVCEAEVAKLGAKVSKAKKREALIACIEPDRRVDVKIRSI  142 (164)
T ss_dssp             EEEECTTTTCCCHHHHHHHHHTCCSSCCSSHHHHHHHHHTGGGSEEEEEEEEE
T ss_pred             EEEEECCCCCCCCCCCHHHHHHCCCCCHHHHHHHHHHHCCCCCCCEEEEEECC
T ss_conf             99997676888989797887421441000000466653037889889999614


No 7  
>2kgw_A Outer membrane protein A; OMPA- like, cell membrane, transmembrane; NMR {Mycobacterium tuberculosis}
Probab=99.97  E-value=1.6e-30  Score=188.91  Aligned_cols=104  Identities=30%  Similarity=0.469  Sum_probs=99.0

Q ss_pred             CCEECC-CHHHCCHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEE
Q ss_conf             211128-8131099999999999999985899489999803778720011122589999999988852387451699997
Q gi|254780953|r   78 VHVSFV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRG  156 (190)
Q Consensus        78 ~~~~f~-~~a~l~~~~~~~L~~ia~~l~~~~~~~i~I~GHTD~~g~~~~N~~LS~~RA~~V~~~L~~~g~~~~r~i~v~g  156 (190)
                      ..++|+ +++.|+++++..|+.|+.+|+.+|+..|.|+||||+.|+.+|||.||++||.+|++||+.+|+.+.| |.+.|
T Consensus        24 ~~i~F~~gs~~l~~~~~~~L~~la~~l~~~~~~~i~I~GhtD~~g~~~~n~~LS~~RA~aV~~~L~~~Gv~~~r-i~~~g  102 (129)
T 2kgw_A           24 GPIAFGNDGASLIPADYEILNRVADKLKACPDARVTINGYTDNTGSEGINIPLSAQRAKIVADYLVARGVAGDH-IATVG  102 (129)
T ss_dssp             SCBCCCTTSSCCCHHHHHHHHHHHHHHHTCTTSCEEEEECCCTTSCHHHHHHHHHHHHHHHHHHHHHHTCCGGG-EEEEE
T ss_pred             CCEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCEEEEEEEECCCCCHHHCHHHHHHHHHHHHHHHHHCCCCHHH-EEEEE
T ss_conf             71486499732598899999999999997899479999981798881025379999999999999985999899-89999


Q ss_pred             ECCCCCCCCCCCHHHHHCCCCEEEEE
Q ss_conf             03458889976977985299169999
Q gi|254780953|r  157 FAYKYPIDTNDTKVGRQNNQRIEIQI  182 (190)
Q Consensus       157 ~G~~~p~~~n~~~~~ra~NRRVei~i  182 (190)
                      ||+++|+++|.++++|++||||||+|
T Consensus       103 ~G~~~p~~~~~~~~~~~~NRRVei~v  128 (129)
T 2kgw_A          103 LGSVNPIASNATPEGRAKNRRVEIVV  128 (129)
T ss_dssp             CTTCSCCSCTTSHHHHHHHSCEEEEE
T ss_pred             ECCCCCCCCCCCHHHHHHCCCEEEEE
T ss_conf             74557679993988998539589997


No 8  
>3oon_A Outer membrane protein (TPN50); protein structure initiative, PSI-2, structural genomics, MI center for structural genomics, MCSG; 1.79A {Borrelia burgdorferi}
Probab=99.96  E-value=1.1e-29  Score=184.25  Aligned_cols=121  Identities=26%  Similarity=0.381  Sum_probs=106.7

Q ss_pred             CCCEEEEECCEEEEEECCCEEC-CCHHHCCHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             7835886087589985221112-881310999999999999999858994899998037787200111225899999999
Q gi|254780953|r   61 TGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKS  139 (190)
Q Consensus        61 ~~~~~~~~~~~~~~~~~~~~~f-~~~a~l~~~~~~~L~~ia~~l~~~~~~~i~I~GHTD~~g~~~~N~~LS~~RA~~V~~  139 (190)
                      ..+.++..+..+.+..  .++| ++++.|+++++..|+.++..|+.+|+..|.|+||||+.|+.+|||.||.+||.+|++
T Consensus         2 ~~v~v~~~~~~i~~~~--~i~F~~~s~~l~~~~~~~L~~ia~~l~~~~~~~I~I~Ghtd~~g~~~~N~~LS~~RA~aV~~   79 (123)
T 3oon_A            2 AAIEVEKNNKGINLSF--DIEFYPNSFQILQKEYKKIDLIAKLLEKFKKNNILIEGHTEQFGLEEEMHELSEKRARAIGN   79 (123)
T ss_dssp             CCCEEEEETTEEEEEE--EEEBCTTSCCBCGGGHHHHHHHHHHHHHSCSCCEEEEECCCSCCCHHHHHHHHHHHHHHHHH
T ss_pred             CCEEEEECCCEEEEEE--EEEECCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEEEEEECCCCCHHHHHHHHHHHHHHHHH
T ss_conf             9779997587799777--86866998327998999999999999868995699999817987555647999999999999


Q ss_pred             HHHHHCCCCCCEEEEEEECCCCCCCCCCCHHHHHCCCCEEEEEEC
Q ss_conf             888523874516999970345888997697798529916999930
Q gi|254780953|r  140 YLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP  184 (190)
Q Consensus       140 ~L~~~g~~~~r~i~v~g~G~~~p~~~n~~~~~ra~NRRVei~i~~  184 (190)
                      ||+..|+.+..+|.+.|||+.+|++++++ ++|++||||||.|+.
T Consensus        80 ~L~~~g~~~~~ri~~~g~Ge~~p~~~~~~-~~~~~NRRVei~i~~  123 (123)
T 3oon_A           80 YLIKMKVKDKDQILFKGWGSQKPKYPKSS-PLKAKNRRVEITILN  123 (123)
T ss_dssp             HHHHTTSSCGGGEEEEECTTCC-----------CCEEEEEEEEEC
T ss_pred             HHHHCCCCCCCEEEEEEEECCCCCCCCCC-CCHHHCCCEEEEEEC
T ss_conf             99985999876899999834774699988-366871989999979


No 9  
>2hqs_H Peptidoglycan-associated lipoprotein; TOLB, PAL, TOL, transport protein/lipoprotein complex; 1.50A {Escherichia coli} SCOP: d.79.7.1 PDB: 2w8b_C 1oap_A
Probab=99.96  E-value=1.7e-29  Score=183.24  Aligned_cols=108  Identities=25%  Similarity=0.387  Sum_probs=101.3

Q ss_pred             CCCEECC-CHHHCCHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEE
Q ss_conf             2211128-813109999999999999998589948999980377872001112258999999998885238745169999
Q gi|254780953|r   77 PVHVSFV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVR  155 (190)
Q Consensus        77 ~~~~~f~-~~a~l~~~~~~~L~~ia~~l~~~~~~~i~I~GHTD~~g~~~~N~~LS~~RA~~V~~~L~~~g~~~~r~i~v~  155 (190)
                      ...+||+ +++.|+++++..|+.++..|+.+|+..|.|+||||..|+..|||.||++||.+|++||+..|+++.| |.+.
T Consensus         5 ~~~VyF~~~s~~l~~~~~~~L~~ia~~L~~~p~~~i~I~GhtD~~g~~~~N~~LS~~RA~~V~~~L~~~Gi~~~r-I~~~   83 (118)
T 2hqs_H            5 NNIVYFDLDKYDIRSDFAQMLDAHANFLRSNPSYKVTVEGHADERGTPEYNISLGERRANAVKMYLQGKGVSADQ-ISIV   83 (118)
T ss_dssp             CSEEECCTTCCCCCGGGHHHHHHHHHHHHHCTTCCEEEEECCCSSSCHHHHHHHHHHHHHHHHHHHHHTTCCGGG-EEEE
T ss_pred             CCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCE-EEEE
T ss_conf             989994089760799899999999999977899199999972899876566779999999999999984998046-9999


Q ss_pred             EECCCCCCCCCCCHHHHHCCCCEEEEEECC
Q ss_conf             703458889976977985299169999301
Q gi|254780953|r  156 GFAYKYPIDTNDTKVGRQNNQRIEIQIFPR  185 (190)
Q Consensus       156 g~G~~~p~~~n~~~~~ra~NRRVei~i~~~  185 (190)
                      |||+..|++++.++++|++||||||+++.-
T Consensus        84 g~G~~~p~~~~~~~~~~~~NRRVeiv~ik~  113 (118)
T 2hqs_H           84 SYGKEKPAVLGHDEAAYSKNRRAVLVYLEH  113 (118)
T ss_dssp             ECTTSSCSSCCSSHHHHHHHSEEEEECC--
T ss_pred             EECCCCCCCCCCCHHHHHHCCCEEEEEEEE
T ss_conf             974657778991977898659899999985


No 10 
>2aiz_P Outer membrane protein P6; alpha-beta sandwich; HET: UDP AMU DGL 6CL DAL; NMR {Haemophilus influenzae} SCOP: d.79.7.1
Probab=99.96  E-value=3.3e-29  Score=181.65  Aligned_cols=103  Identities=23%  Similarity=0.404  Sum_probs=97.7

Q ss_pred             CEECC-CHHHCCHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEEE
Q ss_conf             11128-81310999999999999999858994899998037787200111225899999999888523874516999970
Q gi|254780953|r   79 HVSFV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGF  157 (190)
Q Consensus        79 ~~~f~-~~a~l~~~~~~~L~~ia~~l~~~~~~~i~I~GHTD~~g~~~~N~~LS~~RA~~V~~~L~~~g~~~~r~i~v~g~  157 (190)
                      .+||+ +++.|+++++..|+.++.+|+.+|+..|.|+||||..|+..+|+.||++||++|+.||+..|+++.| |.+.||
T Consensus        31 ~i~F~~~s~~L~~~~~~~L~~ia~~l~~~~~~~i~I~GhtD~~g~~~~N~~LS~~RA~~V~~~L~~~Gi~~~r-I~~~g~  109 (134)
T 2aiz_P           31 TVYFGFDKYDITGEYVQILDAHAAYLNATPAAKVLVEGNTDERGTPEYNIALGQRRADAVKGYLAGKGVDAGK-LGTVSY  109 (134)
T ss_dssp             EEECCTTCCCCCHHHHHHHHHHHHHHHHSTTCCEEEEEECCSSSCHHHHHHHHHHHHHHHHHHHHHTTCCGGG-EEEEEC
T ss_pred             EEECCCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEEEEEECCCCCHHHCCCHHHHHHHHHHHHHHHCCCCCCE-EEEEEE
T ss_conf             0780699700599999999999999996899389999861686872327347999999999999974985137-988880


Q ss_pred             CCCCCCCCCCCHHHHHCCCCEEEEE
Q ss_conf             3458889976977985299169999
Q gi|254780953|r  158 AYKYPIDTNDTKVGRQNNQRIEIQI  182 (190)
Q Consensus       158 G~~~p~~~n~~~~~ra~NRRVei~i  182 (190)
                      |+++|+.++.++++|++||||||+.
T Consensus       110 G~~~P~~~~~~~~~~~~NRRVei~~  134 (134)
T 2aiz_P          110 GEEKPAVLGHDEAAYSKNRRAVLAY  134 (134)
T ss_dssp             TTTSCSSCSCSHHHHHHHSEEEEEC
T ss_pred             CCCCCCCCCCCHHHHHCCCCEEEEC
T ss_conf             5647678991977876339899959


No 11 
>3cyp_B Chemotaxis protein MOTB; bacterial flagellar motor, peptidoglycan binding, bacterial flagellum, flagellar rotation, inner membrane, membrane; 1.60A {Helicobacter pylori} PDB: 3cyq_B* 3imp_B
Probab=99.96  E-value=3.7e-29  Score=181.37  Aligned_cols=108  Identities=27%  Similarity=0.430  Sum_probs=96.3

Q ss_pred             CEEC-CCHH-HCCHHHHHHHHHHHHHHHHCCC-CEEEEEEECCCCC----CHHHHHHHHHHHHHHHHHHHHHHCCCCCCE
Q ss_conf             1112-8813-1099999999999999985899-4899998037787----200111225899999999888523874516
Q gi|254780953|r   79 HVSF-VSEV-FLEKKFLPMLQLIATILNKFPS-TVIAIQSHTDSIG----TLKNNLLISQERADVIKSYLIQRGVSSNRF  151 (190)
Q Consensus        79 ~~~f-~~~a-~l~~~~~~~L~~ia~~l~~~~~-~~i~I~GHTD~~g----~~~~N~~LS~~RA~~V~~~L~~~g~~~~r~  151 (190)
                      .+.| .+++ .|+++++..|++|+.+|+.+|+ ..|.|+||||+.|    .+.|||.||++||.+|+.||+..|+++.| 
T Consensus         4 ~~~F~~~~s~~l~~~~~~~L~~ia~~l~~~p~~~~I~I~GhTD~~~~~~~~~~~N~~LS~~RA~~V~~~L~~~Gi~~~r-   82 (138)
T 3cyp_B            4 PFTFENATSDAINQDMMLYIERIAKIIQKLPKRVHINVRGFTDDTPLVKTRFKSHYELAANRAYRVMKVLIQYGVNPNQ-   82 (138)
T ss_dssp             CEECSSTTCCCCCHHHHHHHHHHHHHHTTSCTTCEEEEEEECCCCCC----CCSHHHHHHHHHHHHHHHHHHTTCCGGG-
T ss_pred             CEECCCCCHHHCCHHHHHHHHHHHHHHHHCCCCEEEEEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCE-
T ss_conf             7661899734419989999999999999689970799988528988777761779999999999999999985999643-


Q ss_pred             EEEEEECCCCCCCCCCCHHHHHCCCCEEEEEECCHH
Q ss_conf             999970345888997697798529916999930101
Q gi|254780953|r  152 ISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGN  187 (190)
Q Consensus       152 i~v~g~G~~~p~~~n~~~~~ra~NRRVei~i~~~~~  187 (190)
                      |.+.|||+++|+++|+++++|++||||||+|.+...
T Consensus        83 i~~~g~G~~~P~~~n~~~~~~a~NRRVEI~i~~~~~  118 (138)
T 3cyp_B           83 LSFSSYGSTNPIAPNDSLENRMKNNRVEIFFSTDAN  118 (138)
T ss_dssp             EEEEECTTCSCSSCTTSHHHHHHHSEEEEEEEEEHH
T ss_pred             EEEEEEECCCCCCCCCCHHHHHHCCCEEEEEECCHH
T ss_conf             688210013757999397899873988999976867


No 12 
>2zf8_A MOTY, component of sodium-driven polar flagellar motor; beta barrel, 2-layer sandwich, flagellum, structural protein; 2.85A {Vibrio alginolyticus}
Probab=99.96  E-value=7.5e-30  Score=185.21  Aligned_cols=108  Identities=23%  Similarity=0.406  Sum_probs=98.9

Q ss_pred             CEECC-CHHHCCHHHHHHHHHHHHHHHHCCCC-EEEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEE
Q ss_conf             11128-81310999999999999999858994-89999803778720011122589999999988852387451699997
Q gi|254780953|r   79 HVSFV-SEVFLEKKFLPMLQLIATILNKFPST-VIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRG  156 (190)
Q Consensus        79 ~~~f~-~~a~l~~~~~~~L~~ia~~l~~~~~~-~i~I~GHTD~~g~~~~N~~LS~~RA~~V~~~L~~~g~~~~r~i~v~g  156 (190)
                      .++|+ +++.|++.++..|++|+.+|+.+|+. .|.|+||||+.|+..||+.||.+||++|++||+..|+++.| |.+.|
T Consensus       163 ~v~F~~gs~~L~~~~~~~L~~ia~~Lk~~p~~~~I~I~GhTD~~G~~~~N~~LS~~RA~~V~~~L~~~GI~~~r-I~v~g  241 (278)
T 2zf8_A          163 ILHYERQGDQLTKASKKRLSQIADYIRHNQDIDLVLVATYTDSTDGKSASQSLSERRAESLRDYFQSLGLPEDR-IQVQG  241 (278)
T ss_dssp             ECBSSSSSSSBCHHHHHHHHHHHHHHTTCCSCCEEEEEEC-------CCCHHHHHHHHHHHHHHHHHHSCCTTS-EECCE
T ss_pred             EEEECCCCCCCCHHHHHHHHHHHHHHHHCCCCCEEEEEEEECCCCCHHHHHHHHHHHHHHHHHHHHHCCCCHHH-EEEEE
T ss_conf             79848997327999999999999999868996579999882899976888999999999999999985999799-99999


Q ss_pred             ECCCCCCCCCCCHHHHHCCCCEEEEEECCHHH
Q ss_conf             03458889976977985299169999301011
Q gi|254780953|r  157 FAYKYPIDTNDTKVGRQNNQRIEIQIFPRGNI  188 (190)
Q Consensus       157 ~G~~~p~~~n~~~~~ra~NRRVei~i~~~~~~  188 (190)
                      ||+.+|+++|+++++|++||||||.| .|.+|
T Consensus       242 ~Ge~~Pi~~n~t~~~r~~NRRVeI~l-~r~ev  272 (278)
T 2zf8_A          242 YGKRRPIADNGSPIGKDKNRRVVISL-GRTQV  272 (278)
T ss_dssp             EC------------------CEEEEC-CCCC-
T ss_pred             ECCCCCCCCCCCHHHHHHCCCEEEEE-EEEEE
T ss_conf             75657779994978997349799999-73697


No 13 
>1rbl_M Ribulose 1,5 bisphosphate carboxylase/oxygenase (small chain); lyase(carbon-carbon); HET: CAP; 2.20A {Synechococcus elongatus pcc 6301} SCOP: d.73.1.1 PDB: 1rsc_M*
Probab=49.20  E-value=12  Score=16.38  Aligned_cols=29  Identities=7%  Similarity=0.098  Sum_probs=19.7

Q ss_pred             HHHHHHHHHHHHHHHCCCCEEEEEEECCC
Q ss_conf             99999999999998589948999980377
Q gi|254780953|r   91 KFLPMLQLIATILNKFPSTVIAIQSHTDS  119 (190)
Q Consensus        91 ~~~~~L~~ia~~l~~~~~~~i~I~GHTD~  119 (190)
                      +...+|.+|...++.+|+..|+|.|+-..
T Consensus        66 d~~~Vl~ele~C~~~~p~~YVRLiG~D~~   94 (109)
T 1rbl_M           66 APQQVLDEVRECRSEYGDCYIRVAGFDNI   94 (109)
T ss_dssp             CHHHHHHHHHHHHHHCTTSEEEEEEEETT
T ss_pred             CHHHHHHHHHHHHHHCCCCEEEEEEEECC
T ss_conf             67899999999999799766989999688


No 14 
>1svd_M Ribulose bisphosphate carboxylase small chain; beta-alpha-barrel, lyase; 1.80A {Halothiobacillus neapolitanus} SCOP: d.73.1.1
Probab=44.35  E-value=15  Score=15.94  Aligned_cols=25  Identities=12%  Similarity=0.200  Sum_probs=13.0

Q ss_pred             HHHHHHHHHHHHHHCCCCEEEEEEE
Q ss_conf             9999999999998589948999980
Q gi|254780953|r   92 FLPMLQLIATILNKFPSTVIAIQSH  116 (190)
Q Consensus        92 ~~~~L~~ia~~l~~~~~~~i~I~GH  116 (190)
                      ...+|.+|...++.+|+..|++.|+
T Consensus        69 ~~~Vl~ele~c~~~~p~~YVRlig~   93 (110)
T 1svd_M           69 VDNVLAEIEACRSAYPTHQVKLVAY   93 (110)
T ss_dssp             HHHHHHHHHHHHHHSTTSEEEEEEE
T ss_pred             HHHHHHHHHHHHHHCCCCEEEEEEE
T ss_conf             9999999999999899877999998


No 15 
>1wdd_S Ribulose bisphosphate carboxylase small chain C; rubisco, photosynthesis, alpha/beta barrel, N- methylmethionine, post-translational modification; HET: KCX CAP; 1.35A {Oryza sativa} SCOP: d.73.1.1 PDB: 8ruc_I* 1aus_S 1rbo_S* 1rco_S* 1rcx_S* 1rxo_S* 1upm_C* 1upp_I* 1aa1_S* 3rub_S 1rlc_S* 1rld_S 1ej7_S 1ir1_S* 4rub_S*
Probab=35.88  E-value=20  Score=15.17  Aligned_cols=30  Identities=10%  Similarity=0.211  Sum_probs=20.7

Q ss_pred             HHHHHHHHHHHHHHHCCCCEEEEEEECCCC
Q ss_conf             999999999999985899489999803778
Q gi|254780953|r   91 KFLPMLQLIATILNKFPSTVIAIQSHTDSI  120 (190)
Q Consensus        91 ~~~~~L~~ia~~l~~~~~~~i~I~GHTD~~  120 (190)
                      +..++|.+|...++.+|+..|+|.|+-...
T Consensus        78 d~~~Vl~Ele~C~k~~p~~YVRligfD~~~  107 (128)
T 1wdd_S           78 DATQVLKELEEAKKAYPDAFVRIIGFDNVR  107 (128)
T ss_dssp             CHHHHHHHHHHHHHHCTTSEEEEEEEETTT
T ss_pred             CHHHHHHHHHHHHHHCCCCEEEEEEEECCC
T ss_conf             999999999999997998769999997887


No 16 
>2o66_A PII protein; regulation of nitrogen and carbon metabolism, biosynthetic protein; HET: FLC; 1.90A {Arabidopsis thaliana} PDB: 2o67_A 2rd5_C*
Probab=34.40  E-value=21  Score=15.03  Aligned_cols=31  Identities=26%  Similarity=0.327  Sum_probs=14.7

Q ss_pred             HHHHHHHHHHHHHCCCCCCEEEEEEECCCCC
Q ss_conf             9999999988852387451699997034588
Q gi|254780953|r  132 ERADVIKSYLIQRGVSSNRFISVRGFAYKYP  162 (190)
Q Consensus       132 ~RA~~V~~~L~~~g~~~~r~i~v~g~G~~~p  162 (190)
                      .|...|++.|...|+..--...+.|+|..+.
T Consensus        23 ~kl~~V~~AL~~~Gv~g~Tv~~V~G~G~q~g   53 (135)
T 2o66_A           23 WRIQQVSSALLKIGIRGVTVSDVRGFGAQGG   53 (135)
T ss_dssp             GGHHHHHHHHHHTTCCCCEEEEEEECC----
T ss_pred             HHHHHHHHHHHHCCCCCEEEEEEEEECCCCC
T ss_conf             9999999999977998589974576525666


No 17 
>3g7n_A Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A {Penicillium expansum}
Probab=32.60  E-value=23  Score=14.86  Aligned_cols=61  Identities=10%  Similarity=0.141  Sum_probs=40.4

Q ss_pred             HHHHHHHHHHHHHHCCCCEEEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCCCC
Q ss_conf             9999999999998589948999980377872001112258999999998885238745169999703458889976
Q gi|254780953|r   92 FLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTND  167 (190)
Q Consensus        92 ~~~~L~~ia~~l~~~~~~~i~I~GHTD~~g~~~~N~~LS~~RA~~V~~~L~~~g~~~~r~i~v~g~G~~~p~~~n~  167 (190)
                      ....+..|-..++++|+.+|.|.||.           |.-.=|.-.+-+|...+... + +.+..||.-  ..-|.
T Consensus       107 ~~~i~~~v~~~~~~~p~~~i~vTGHS-----------LGGAlA~L~a~~l~~~~~~~-~-i~~~tFG~P--rvGn~  167 (258)
T 3g7n_A          107 HDTIITEVKALIAKYPDYTLEAVGHS-----------LGGALTSIAHVALAQNFPDK-S-LVSNALNAF--PIGNQ  167 (258)
T ss_dssp             HHHHHHHHHHHHHHSTTCEEEEEEET-----------HHHHHHHHHHHHHHHHCTTS-C-EEEEEESCC--CCBCH
T ss_pred             HHHHHHHHHHHHHHCCCCEEEEECCC-----------HHHHHHHHHHHHHHHHCCCC-C-EEEEEECCC--CCCCH
T ss_conf             99999999999987479659985465-----------08899999999999838998-6-699995899--86787


No 18 
>1tib_A Lipase; hydrolase(carboxylic esterase); 1.84A {Thermomyces lanuginosus} SCOP: c.69.1.17 PDB: 1dt3_A 1dt5_A 1du4_A 1ein_A* 1dte_A 1gt6_A*
Probab=32.52  E-value=23  Score=14.86  Aligned_cols=60  Identities=18%  Similarity=0.212  Sum_probs=39.1

Q ss_pred             HHHHHHHHHHHHHCCCCEEEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCCCCCH
Q ss_conf             99999999999858994899998037787200111225899999999888523874516999970345888997697
Q gi|254780953|r   93 LPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTK  169 (190)
Q Consensus        93 ~~~L~~ia~~l~~~~~~~i~I~GHTD~~g~~~~N~~LS~~RA~~V~~~L~~~g~~~~r~i~v~g~G~~~p~~~n~~~  169 (190)
                      ...+..|...+.++|+.+|.|.||.           |.-.=|.-.+-+|...+.   + +.+..||  .|..-|..-
T Consensus       122 ~~i~~~v~~~~~~~~~~~l~vtGHS-----------LGgalA~l~a~~l~~~~~---~-v~v~tFg--~PrvGn~~f  181 (269)
T 1tib_A          122 DTLRQKVEDAVREHPDYRVVFTGHS-----------LGGALATVAGADLRGNGY---D-IDVFSYG--APRVGNRAF  181 (269)
T ss_dssp             HHHHHHHHHHHHHCTTSEEEEEEET-----------HHHHHHHHHHHHHTTSSS---C-EEEEEES--CCCCBCHHH
T ss_pred             HHHHHHHHHHHHHCCCCEEEEECCC-----------HHHHHHHHHHHHHHHCCC---C-CEEEEEC--CCCCCCHHH
T ss_conf             9999999999987899658983167-----------789999999999873588---7-3089848--986579999


No 19 
>1w7f_A Beta-lactamase; hydrolase, isocitrate, bacillus licheniformis hydrolase; HET: ICT; 1.80A {Bacillus licheniformis}
Probab=29.59  E-value=23  Score=14.78  Aligned_cols=23  Identities=17%  Similarity=0.405  Sum_probs=13.2

Q ss_pred             HHHHHHHHHHHHHHHHCCCCCCC
Q ss_conf             47899999999999751478876
Q gi|254780953|r    2 IKELGLSMFIMTTISGCGLASRE   24 (190)
Q Consensus         2 ~k~l~l~~~~~~~l~g~~~~~~~   24 (190)
                      .|.+.+.++.+.++++|+....+
T Consensus        11 ~~~~~~~~~~~~~l~~~~~~~~~   33 (307)
T 1w7f_A           11 KKAAAVLLFSCVALAGCANNQTN   33 (307)
T ss_dssp             -----------------------
T ss_pred             HHHHHHHHHHHHHHHHHCCCCCC
T ss_conf             99999999999999972234444


No 20 
>2xbp_A Nitrogen regulatory protein P-II; nucleotide-binding, transcription regulation, transcription, phosphoprotein, gene regulation; HET: ATP; 1.20A {Synechococcus elongatus} PDB: 2v5h_G* 2jj4_D* 2xg8_A 1qy7_A 1ul3_A
Probab=28.88  E-value=26  Score=14.50  Aligned_cols=31  Identities=26%  Similarity=0.359  Sum_probs=17.7

Q ss_pred             HHHHHHHHHHHHHCCCCCCEEEEEEECCCCC
Q ss_conf             9999999988852387451699997034588
Q gi|254780953|r  132 ERADVIKSYLIQRGVSSNRFISVRGFAYKYP  162 (190)
Q Consensus       132 ~RA~~V~~~L~~~g~~~~r~i~v~g~G~~~p  162 (190)
                      .|...|.+.|...|+..--...+.|||....
T Consensus        11 ~k~~~v~~AL~~~Gv~g~Tv~~V~G~G~~~g   41 (113)
T 2xbp_A           11 FKLDEVKIALVNAGIVGMTVSEVRGFGRQKG   41 (113)
T ss_dssp             GGHHHHHHHHHHTTCCCCEEEEEEECCCCTT
T ss_pred             HHHHHHHHHHHHCCCCCEEEEEEEEEECCCC
T ss_conf             8999999999977998499972356705678


No 21 
>1bxn_I Rubisco, protein (ribulose bisphosphate carboxylase small chain); lyase (carbon-carbon); 2.70A {Cupriavidus necator} SCOP: d.73.1.1
Probab=27.34  E-value=28  Score=14.34  Aligned_cols=32  Identities=19%  Similarity=0.246  Sum_probs=26.9

Q ss_pred             HHHHHHHHHHHHHHHCCCCEEEEEEECCCCCC
Q ss_conf             99999999999998589948999980377872
Q gi|254780953|r   91 KFLPMLQLIATILNKFPSTVIAIQSHTDSIGT  122 (190)
Q Consensus        91 ~~~~~L~~ia~~l~~~~~~~i~I~GHTD~~g~  122 (190)
                      +..++|.+|...++.+|+..|+|.|+-...+.
T Consensus        60 d~~~Vl~Ele~C~~~~p~~YVRliGfD~~rq~   91 (139)
T 1bxn_I           60 DAAGILMEINNARNTFPNHYIRVTAFDSTHTV   91 (139)
T ss_dssp             CHHHHHHHHHHHHHHCSSSEEEEEEECTTTCC
T ss_pred             CHHHHHHHHHHHHHHCCCCEEEEEEEECCCCE
T ss_conf             99999999999999899876999999688655


No 22 
>1gk8_I Ribulose bisphosphate carboxylase small chain 1; lyase, rubisco, photosynthesis; HET: KCX CAP; 1.4A {Chlamydomonas reinhardtii} SCOP: d.73.1.1 PDB: 2v63_I* 2v67_I* 2v68_I* 2v69_I* 2v6a_I* 2vdh_I* 2vdi_I* 1uw9_C* 1uwa_C* 1ir2_I* 1uzd_C* 1uzh_C*
Probab=26.61  E-value=29  Score=14.27  Aligned_cols=31  Identities=13%  Similarity=0.270  Sum_probs=25.7

Q ss_pred             HHHHHHHHHHHHHHHCCCCEEEEEEECCCCC
Q ss_conf             9999999999999858994899998037787
Q gi|254780953|r   91 KFLPMLQLIATILNKFPSTVIAIQSHTDSIG  121 (190)
Q Consensus        91 ~~~~~L~~ia~~l~~~~~~~i~I~GHTD~~g  121 (190)
                      +..++|.+|...-+.+|+..|+|.|+-...+
T Consensus        85 D~~~Vl~Ei~~Crka~P~~yIRvigFDn~rQ  115 (140)
T 1gk8_I           85 DPMQVLREIVACTKAFPDAYVRLVAFDNQKQ  115 (140)
T ss_dssp             CHHHHHHHHHHHHHHCTTSEEEEEEEETTTT
T ss_pred             CHHHHHHHHHHHHHHCCCCEEEEEEEECCCC
T ss_conf             9899999999999879844678878607644


No 23 
>2j9c_A GLNK1, hypothetical nitrogen regulatory PII-like protein MJ0059; EM single particle, nitrogen metabolism, signalling, transcription; HET: ATP; 1.30A {Methanococcus jannaschii} PDB: 2j9d_A* 2j9e_A* 2j9d_E*
Probab=26.53  E-value=29  Score=14.26  Aligned_cols=32  Identities=22%  Similarity=0.287  Sum_probs=19.7

Q ss_pred             HHHHHHHHHHHHHCCCCCCEEEEEEECCCCCC
Q ss_conf             99999999888523874516999970345888
Q gi|254780953|r  132 ERADVIKSYLIQRGVSSNRFISVRGFAYKYPI  163 (190)
Q Consensus       132 ~RA~~V~~~L~~~g~~~~r~i~v~g~G~~~p~  163 (190)
                      .|...|.+.|..-|+..--...+.|||..+..
T Consensus        13 ~kl~~v~~AL~~~Gv~g~Tv~~v~G~G~~~~~   44 (119)
T 2j9c_A           13 EKLEIVKKALSDAGYVGMTVSEVKGRGVQGGI   44 (119)
T ss_dssp             GGHHHHHHHHHHTTCCCEEEEEEEEECCSSSS
T ss_pred             HHHHHHHHHHHHCCCCEEEEEEEEECCCCCCC
T ss_conf             89999999999779970999965641788885


No 24 
>2f2f_C CDT C, cytolethal distending toxin C; actinobacillus actinomycetemcomitans, oligomerization, stability and toxic activity; 2.40A {Aggregatibacter actinomycetemcomitans} SCOP: b.42.2.1
Probab=26.01  E-value=12  Score=16.41  Aligned_cols=22  Identities=18%  Similarity=0.238  Sum_probs=13.5

Q ss_pred             HHHHHHHHHHHHHHHHCCCCCCC
Q ss_conf             47899999999999751478876
Q gi|254780953|r    2 IKELGLSMFIMTTISGCGLASRE   24 (190)
Q Consensus         2 ~k~l~l~~~~~~~l~g~~~~~~~   24 (190)
                      |||++| +|++.++++|++....
T Consensus         1 mkK~~i-~f~~~l~~~~~s~~~~   22 (186)
T 2f2f_C            1 MKKYLL-SFLLSMILTLTSHAES   22 (186)
T ss_dssp             -----------------------
T ss_pred             CCHHHH-HHHHHHHHHCCCCCCC
T ss_conf             932489-9999999751145546


No 25 
>1bwv_S Rubisco, protein (ribulose bisphosphate carboxylase); carbon dioxide fixation, complex (rubisco/reaction intermediate); HET: KCX CAP; 2.40A {Galdieria partita} SCOP: d.73.1.1 PDB: 1iwa_B
Probab=25.91  E-value=30  Score=14.19  Aligned_cols=31  Identities=13%  Similarity=0.034  Sum_probs=26.6

Q ss_pred             HHHHHHHHHHHHHHHCCCCEEEEEEECCCCC
Q ss_conf             9999999999999858994899998037787
Q gi|254780953|r   91 KFLPMLQLIATILNKFPSTVIAIQSHTDSIG  121 (190)
Q Consensus        91 ~~~~~L~~ia~~l~~~~~~~i~I~GHTD~~g  121 (190)
                      +...+|.+|...++.+|+..|+|.|+-...+
T Consensus        60 d~~~Vl~Ele~C~~~~p~~YVRligfD~~rq   90 (138)
T 1bwv_S           60 DPAAVLFEINACRKARSNFYIKVVGFSSVRG   90 (138)
T ss_dssp             CHHHHHHHHHHHHHHCTTSEEEEEEEECCTT
T ss_pred             CHHHHHHHHHHHHHHCCCCEEEEEEEECCCC
T ss_conf             9999999999999989977499999978744


No 26 
>3c9h_A ABC transporter, substrate binding protein; structural genomics, MCSG, PSI-2, protein structure initiative; HET: CIT; 1.90A {Agrobacterium tumefaciens str}
Probab=23.89  E-value=29  Score=14.24  Aligned_cols=16  Identities=19%  Similarity=0.048  Sum_probs=9.1

Q ss_pred             CHHHHHHHHHHHHHHH
Q ss_conf             9478999999999997
Q gi|254780953|r    1 MIKELGLSMFIMTTIS   16 (190)
Q Consensus         1 m~k~l~l~~~~~~~l~   16 (190)
                      |++.|+|++.++++..
T Consensus         1 ~~~~l~l~l~~~~a~~   16 (355)
T 3c9h_A            1 MRICLFLCLCLCMASP   16 (355)
T ss_dssp             ---------------C
T ss_pred             CCHHHHHHHHHHHHHH
T ss_conf             9079999999999999


No 27 
>3ce8_A Putative PII-like nitrogen regulatory protein; structural genomics, joint center for structural genomics, JCSG; HET: MSE; 2.40A {Shewanella baltica OS155}
Probab=23.64  E-value=33  Score=13.94  Aligned_cols=48  Identities=17%  Similarity=0.068  Sum_probs=20.6

Q ss_pred             HHHHHHHHHH-CCCCCCEEEEEEECCCCCCCCCCCHHHHHCCCCEEEEEE
Q ss_conf             9999988852-387451699997034588899769779852991699993
Q gi|254780953|r  135 DVIKSYLIQR-GVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIF  183 (190)
Q Consensus       135 ~~V~~~L~~~-g~~~~r~i~v~g~G~~~p~~~n~~~~~ra~NRRVei~i~  183 (190)
                      +.+.++|... |+..--...+.|||......+ ..+.-+-..+||.|.++
T Consensus        36 e~LVD~Lle~~gv~GFTi~~a~G~G~~~~~~S-~~EQV~G~~~~v~ievi   84 (120)
T 3ce8_A           36 DDIVDTLIELEFLSGFSLGNICGFSREHSHFN-IKEQVEGYREFCKFEIM   84 (120)
T ss_dssp             HHHHHHHTTCTTCCCCEEEEEEEEECC------------EEEEEEEEEEE
T ss_pred             HHHHHHHHHCCCCCCEEEEECCCCCCCCCCCC-HHHHHCCCCCEEEEEEE
T ss_conf             99999999668989879983332476665757-67651071224999999


No 28 
>2ogh_A Eukaryotic translation initiation factor EIF-1; alpha-beta protein; NMR {Saccharomyces cerevisiae}
Probab=22.70  E-value=35  Score=13.84  Aligned_cols=25  Identities=16%  Similarity=0.337  Sum_probs=19.9

Q ss_pred             HHHHHHHHHHHHCCCCCCEEEEEEE
Q ss_conf             9999999888523874516999970
Q gi|254780953|r  133 RADVIKSYLIQRGVSSNRFISVRGF  157 (190)
Q Consensus       133 RA~~V~~~L~~~g~~~~r~i~v~g~  157 (190)
                      -...|..+|...+..+...|.+.||
T Consensus        84 ~~~~v~~~L~~~~~v~k~~I~vhgf  108 (108)
T 2ogh_A           84 QRAKVCEFMISQLGLQKKNIKIHGF  108 (108)
T ss_dssp             CHHHHHHHHHHHHTSCCSCEEECCC
T ss_pred             HHHHHHHHHHHCCCCCHHHEEECCC
T ss_conf             8999999999837998556885389


No 29 
>1lgy_A Lipase, triacylglycerol lipase; hydrolase (carboxylic ester); 2.20A {Rhizopus niveus} SCOP: c.69.1.17 PDB: 1tic_A
Probab=21.24  E-value=37  Score=13.66  Aligned_cols=57  Identities=16%  Similarity=0.172  Sum_probs=31.1

Q ss_pred             HHHHHHHHHHHHCCCCEEEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHCC-CCCCEEEEEEECCCC
Q ss_conf             99999999998589948999980377872001112258999999998885238-745169999703458
Q gi|254780953|r   94 PMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGV-SSNRFISVRGFAYKY  161 (190)
Q Consensus        94 ~~L~~ia~~l~~~~~~~i~I~GHTD~~g~~~~N~~LS~~RA~~V~~~L~~~g~-~~~r~i~v~g~G~~~  161 (190)
                      ..+..+...+..+|+.+|.|.||.           |+-.=|.-.+-+|..... .....+.+..||.-+
T Consensus       122 ~i~~~v~~~~~~~~~~~i~vtGHS-----------LGGAlA~L~a~~l~~~~~~~~~~~i~v~tFG~Pr  179 (269)
T 1lgy_A          122 DYFPVVQEQLTAHPTYKVIVTGHS-----------LGGAQALLAGMDLYQREPRLSPKNLSIFTVGGPR  179 (269)
T ss_dssp             HHHHHHHHHHHHCTTCEEEEEEET-----------HHHHHHHHHHHHHHHHCTTCSTTTEEEEEESCCC
T ss_pred             HHHHHHHHHHHHCCCCEEEEECCC-----------CHHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCC
T ss_conf             999999999987899659995357-----------5088899999999972855578874399858997


No 30 
>2jep_A Xyloglucanase; family 5, plant cell WALL, hydrolase; 1.4A {Paenibacillus pabuli} PDB: 2jeq_A*
Probab=20.48  E-value=39  Score=13.57  Aligned_cols=75  Identities=11%  Similarity=0.096  Sum_probs=43.3

Q ss_pred             CHHHCCHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCH--------HHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEE
Q ss_conf             8131099999999999999985899489999803778720--------01112258999999998885238745169999
Q gi|254780953|r   84 SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTL--------KNNLLISQERADVIKSYLIQRGVSSNRFISVR  155 (190)
Q Consensus        84 ~~a~l~~~~~~~L~~ia~~l~~~~~~~i~I~GHTD~~g~~--------~~N~~LS~~RA~~V~~~L~~~g~~~~r~i~v~  155 (190)
                      +...+.+.....++++.+...++ +..|.|.=|.|.....        ..+..-...|...+...+.......+..+...
T Consensus       100 ~~~~~~~~~l~~~~~vv~~a~~~-Gl~vildlH~~~~~~~~~~~~~~~~~~~~~~~~~~~~~w~~ia~~~~~~~~~l~fe  178 (395)
T 2jep_A          100 PNYTINAAWLNRIQQVVDYAYNE-GLYVIINIHGDGYNSVQGGWLLVNGGNQTAIKEKYKKVWQQIATKFSNYNDRLIFE  178 (395)
T ss_dssp             TTCCBCHHHHHHHHHHHHHHHTT-TCEEEECCCGGGCTTSTTCCCCTTCSCHHHHHHHHHHHHHHHHHHTTTCCTTEEEE
T ss_pred             CCCCCCHHHHHHHHHHHHHHHHC-CCEEEEEECCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCEEEEEE
T ss_conf             88745989999999999999858-99799996345666666766777776627999999999999988742456089994


Q ss_pred             EECC
Q ss_conf             7034
Q gi|254780953|r  156 GFAY  159 (190)
Q Consensus       156 g~G~  159 (190)
                      .+-|
T Consensus       179 ~~NE  182 (395)
T 2jep_A          179 SMNE  182 (395)
T ss_dssp             CCSS
T ss_pred             CCCC
T ss_conf             2010


No 31 
>2if1_A EIF1, SUI1; translation initiation factor; NMR {Homo sapiens} SCOP: d.64.1.1
Probab=20.35  E-value=33  Score=13.96  Aligned_cols=26  Identities=23%  Similarity=0.567  Sum_probs=19.9

Q ss_pred             HHHHHHHHHHHHHCCCCCCEEEEEEE
Q ss_conf             99999999888523874516999970
Q gi|254780953|r  132 ERADVIKSYLIQRGVSSNRFISVRGF  157 (190)
Q Consensus       132 ~RA~~V~~~L~~~g~~~~r~i~v~g~  157 (190)
                      .-...|++||+..|+.+...|.+-||
T Consensus       101 D~r~~V~~~L~~~g~~~k~~I~vHgf  126 (126)
T 2if1_A          101 DQRKNICQFLVEIGLAKDDQLKVHGF  126 (126)
T ss_dssp             CCHHHHHHHHHHHTSSCTTTEECCCC
T ss_pred             HHHHHHHHHHHHCCCCCCCCEEECCC
T ss_conf             28999999999849997044885389


Done!