BLAST/PSIBLAST alignment of GI: 254780953 and GI: 257462480 at iteration 1
>gi|257462480|ref|ZP_05626892.1| Outer membrane protein [Fusobacterium sp. D12] Length = 217
 Score =  112 bits (280), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 57/146 (39%), Positives = 89/146 (60%), Gaps = 2/146 (1%)

Query: 43  FGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSE-VFLEKKFLPMLQLIAT 101
           +G+  D+ E   +  L++T + V R G+ I+ Y+P  V+F S+   +   F   L  IA 
Sbjct: 73  WGAYRDQQEAALRASLKNTAVQVQRDGENISLYLPGGVTFASDSAQISGNFYSALNSIAQ 132

Query: 102 ILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKY 161
           +L ++P T I +Q HTDS G+ ++N+ +S  RA+ +K YLI +GV+SNR  S +GF    
Sbjct: 133 VLVQYPETQILVQGHTDSTGSFQHNMDLSNRRANSVKQYLIGQGVASNRLTS-QGFGPNN 191

Query: 162 PIDTNDTKVGRQNNQRIEIQIFPRGN 187
           P+  N T  GRQ N+R+EI+I P+ N
Sbjct: 192 PVADNSTPEGRQMNRRVEIKIAPKYN 217