BLAST/PSIBLAST alignment of GI: 254780953 and GI: 317059511 at iteration 1
>gi|317059511|ref|ZP_07923996.1| outer membrane protein [Fusobacterium sp. 3_1_5R] Length = 204
>gi|313685187|gb|EFS22022.1| outer membrane protein [Fusobacterium sp. 3_1_5R] Length = 204
 Score =  112 bits (280), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 57/146 (39%), Positives = 90/146 (61%), Gaps = 2/146 (1%)

Query: 43  FGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSE-VFLEKKFLPMLQLIAT 101
           +G+  D+ E   +  L++T + V R G+ I+ Y+P  V+F S+   +   F   L  IA 
Sbjct: 60  WGAYRDQQEAALRASLKNTAVQVQRDGENISLYLPGGVTFASDSAQISGNFYSALNSIAQ 119

Query: 102 ILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKY 161
           +L ++P T I +Q HTDS G+ ++N+ +S  RA+ +K YLI +GV+SNR +S +GF    
Sbjct: 120 VLVQYPETQILVQGHTDSTGSFQHNMDLSNRRANSVKHYLIGQGVASNRLMS-QGFGPNN 178

Query: 162 PIDTNDTKVGRQNNQRIEIQIFPRGN 187
           P+  N T  GRQ N+R+EI+I P+ N
Sbjct: 179 PVADNSTPDGRQMNRRVEIKIAPKYN 204