BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780953|ref|YP_003065366.1| OmpA/MotB [Candidatus
Liberibacter asiaticus str. psy62]
         (190 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780953|ref|YP_003065366.1| OmpA/MotB [Candidatus Liberibacter asiaticus str. psy62]
 gi|254040630|gb|ACT57426.1| OmpA/MotB [Candidatus Liberibacter asiaticus str. psy62]
          Length = 190

 Score =  389 bits (999), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 190/190 (100%), Positives = 190/190 (100%)

Query: 1   MIKELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQD 60
           MIKELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQD
Sbjct: 1   MIKELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQD 60

Query: 61  TGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSI 120
           TGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSI
Sbjct: 61  TGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSI 120

Query: 121 GTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEI 180
           GTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEI
Sbjct: 121 GTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEI 180

Query: 181 QIFPRGNIKK 190
           QIFPRGNIKK
Sbjct: 181 QIFPRGNIKK 190


>gi|315122505|ref|YP_004062994.1| OmpA/MotB [Candidatus Liberibacter solanacearum CLso-ZC1]
 gi|313495907|gb|ADR52506.1| OmpA/MotB [Candidatus Liberibacter solanacearum CLso-ZC1]
          Length = 190

 Score =  208 bits (530), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 104/187 (55%), Positives = 133/187 (71%), Gaps = 5/187 (2%)

Query: 1   MIKELGLSMFIMTTISGCGLASREKKKVF---LHKSNDTDIVNKRFGSSLDKAEDEFQMQ 57
           MIK  G  M +MT +SGC  +++   K+F   L+  N+  ++   FGS LDKAEDE +MQ
Sbjct: 1   MIKRTGALMVVMTALSGC--SNKGNHKLFSKKLNNENNIILIKPNFGSHLDKAEDELRMQ 58

Query: 58  LQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHT 117
           LQD  + + R  D ITC+IPVH++F S   L K  +P+L  IAT LNKFPST IAI  HT
Sbjct: 59  LQDVDVSIIRKYDQITCHIPVHIAFSSGSILHKDIVPVLNSIATTLNKFPSTKIAITGHT 118

Query: 118 DSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQR 177
           DSIGTL+ NLLISQ+R+ +I  YLI++GVS +RF   +GFAYK PIDTNDT+ GR+NNQR
Sbjct: 119 DSIGTLEYNLLISQQRSQIITDYLIEKGVSPDRFAPPQGFAYKRPIDTNDTQEGRKNNQR 178

Query: 178 IEIQIFP 184
           +EI IFP
Sbjct: 179 VEINIFP 185


>gi|85711329|ref|ZP_01042388.1| Outer membrane protein and related
           peptidoglycan-associated(lipo)proteins [Idiomarina
           baltica OS145]
 gi|85694830|gb|EAQ32769.1| Outer membrane protein and related
           peptidoglycan-associated(lipo)proteins [Idiomarina
           baltica OS145]
          Length = 188

 Score =  116 bits (290), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 56/142 (39%), Positives = 90/142 (63%), Gaps = 2/142 (1%)

Query: 44  GSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSE-VFLEKKFLPMLQLIATI 102
           G+ +DK E+ F+ +L  +G+ V R GD I   +P +++F SE   + + F P+L+ +A +
Sbjct: 45  GNYMDKQEEAFRDELSGSGVQVIRDGDNIRLQLPGNITFASESANISQNFYPVLEDVAAV 104

Query: 103 LNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYP 162
           LNK+  T + I+ HTDS G+   N  +S  RA+ +++YL+  GV S R ++ +GF    P
Sbjct: 105 LNKYNKTTMMIEGHTDSTGSADYNQQLSLNRANAVRNYLVGYGVDSRR-VTTQGFGESQP 163

Query: 163 IDTNDTKVGRQNNQRIEIQIFP 184
           I TNDT  GRQ N+R+E++I P
Sbjct: 164 IATNDTAQGRQQNRRVELRIIP 185


>gi|109900555|ref|YP_663810.1| OmpA/MotB [Pseudoalteromonas atlantica T6c]
 gi|109702836|gb|ABG42756.1| OmpA/MotB [Pseudoalteromonas atlantica T6c]
          Length = 215

 Score =  115 bits (289), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 58/175 (33%), Positives = 101/175 (57%), Gaps = 3/175 (1%)

Query: 11  IMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGD 70
           I+  + G G    +K + ++  +    +     G+ +DK E+EF+ +L D+G+ V R GD
Sbjct: 39  IVGALIGKGTGDNDKSR-YVWGAAVGALAGSAIGNYMDKQEEEFREELADSGVEVYREGD 97

Query: 71  MITCYIPVHVSFVS-EVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLI 129
            +  Y+P  ++F S    ++  F P+L+ +A ++NK+  T + ++ HTD+ G    N  +
Sbjct: 98  TLRLYMPGSITFSSGNASVDSSFYPVLKDVALVINKYEKTTLMVEGHTDNTGADDMNQRL 157

Query: 130 SQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           S+ RA+ +K+YL+Q GV  NR +S  G     PI  N T+ GRQ N+R+E++I P
Sbjct: 158 SEARANSVKNYLVQNGV-DNRRVSTLGMGEYTPIADNATQAGRQKNRRVELKIIP 211


>gi|332308557|ref|YP_004436408.1| OmpA/MotB domain protein [Glaciecola agarilytica 4H-3-7+YE-5]
 gi|332175886|gb|AEE25140.1| OmpA/MotB domain protein [Glaciecola agarilytica 4H-3-7+YE-5]
          Length = 215

 Score =  115 bits (288), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 57/175 (32%), Positives = 102/175 (58%), Gaps = 3/175 (1%)

Query: 11  IMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGD 70
           I+  + G G    +K + ++  +    +     G+ +D+ E+EF+ +L D+G+ V R GD
Sbjct: 39  IVGALIGKGTGDNDKSR-YVWGAAVGALAGSAIGNYMDRQEEEFREELADSGVEVYREGD 97

Query: 71  MITCYIPVHVSFVS-EVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLI 129
           ++  Y+P  ++F S    ++  F P+L+ +A ++NK+  T + ++ HTD+ G    N  +
Sbjct: 98  VLRLYMPGSITFSSGNASVDSSFFPVLKDVALVINKYEKTTLMVEGHTDNTGADDMNQRL 157

Query: 130 SQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           S+ RA+ +K+YL+Q GV  NR +S  G     PI  N T+ GRQ N+R+E++I P
Sbjct: 158 SEARANSVKNYLVQNGV-DNRRVSTLGMGEYTPIADNTTQAGRQKNRRVELKIIP 211


>gi|317060136|ref|ZP_07924621.1| outer membrane protein [Fusobacterium sp. D12]
 gi|313685812|gb|EFS22647.1| outer membrane protein [Fusobacterium sp. D12]
          Length = 193

 Score =  112 bits (280), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 57/146 (39%), Positives = 89/146 (60%), Gaps = 2/146 (1%)

Query: 43  FGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSE-VFLEKKFLPMLQLIAT 101
           +G+  D+ E   +  L++T + V R G+ I+ Y+P  V+F S+   +   F   L  IA 
Sbjct: 49  WGAYRDQQEAALRASLKNTAVQVQRDGENISLYLPGGVTFASDSAQISGNFYSALNSIAQ 108

Query: 102 ILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKY 161
           +L ++P T I +Q HTDS G+ ++N+ +S  RA+ +K YLI +GV+SNR  S +GF    
Sbjct: 109 VLVQYPETQILVQGHTDSTGSFQHNMDLSNRRANSVKQYLIGQGVASNRLTS-QGFGPNN 167

Query: 162 PIDTNDTKVGRQNNQRIEIQIFPRGN 187
           P+  N T  GRQ N+R+EI+I P+ N
Sbjct: 168 PVADNSTPEGRQMNRRVEIKIAPKYN 193


>gi|317059511|ref|ZP_07923996.1| outer membrane protein [Fusobacterium sp. 3_1_5R]
 gi|313685187|gb|EFS22022.1| outer membrane protein [Fusobacterium sp. 3_1_5R]
          Length = 204

 Score =  112 bits (280), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 57/146 (39%), Positives = 90/146 (61%), Gaps = 2/146 (1%)

Query: 43  FGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSE-VFLEKKFLPMLQLIAT 101
           +G+  D+ E   +  L++T + V R G+ I+ Y+P  V+F S+   +   F   L  IA 
Sbjct: 60  WGAYRDQQEAALRASLKNTAVQVQRDGENISLYLPGGVTFASDSAQISGNFYSALNSIAQ 119

Query: 102 ILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKY 161
           +L ++P T I +Q HTDS G+ ++N+ +S  RA+ +K YLI +GV+SNR +S +GF    
Sbjct: 120 VLVQYPETQILVQGHTDSTGSFQHNMDLSNRRANSVKHYLIGQGVASNRLMS-QGFGPNN 178

Query: 162 PIDTNDTKVGRQNNQRIEIQIFPRGN 187
           P+  N T  GRQ N+R+EI+I P+ N
Sbjct: 179 PVADNSTPDGRQMNRRVEIKIAPKYN 204


>gi|257462480|ref|ZP_05626892.1| Outer membrane protein [Fusobacterium sp. D12]
          Length = 217

 Score =  112 bits (280), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 57/146 (39%), Positives = 89/146 (60%), Gaps = 2/146 (1%)

Query: 43  FGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSE-VFLEKKFLPMLQLIAT 101
           +G+  D+ E   +  L++T + V R G+ I+ Y+P  V+F S+   +   F   L  IA 
Sbjct: 73  WGAYRDQQEAALRASLKNTAVQVQRDGENISLYLPGGVTFASDSAQISGNFYSALNSIAQ 132

Query: 102 ILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKY 161
           +L ++P T I +Q HTDS G+ ++N+ +S  RA+ +K YLI +GV+SNR  S +GF    
Sbjct: 133 VLVQYPETQILVQGHTDSTGSFQHNMDLSNRRANSVKQYLIGQGVASNRLTS-QGFGPNN 191

Query: 162 PIDTNDTKVGRQNNQRIEIQIFPRGN 187
           P+  N T  GRQ N+R+EI+I P+ N
Sbjct: 192 PVADNSTPEGRQMNRRVEIKIAPKYN 217


>gi|257452971|ref|ZP_05618270.1| Outer membrane protein [Fusobacterium sp. 3_1_5R]
          Length = 217

 Score =  112 bits (280), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 57/146 (39%), Positives = 90/146 (61%), Gaps = 2/146 (1%)

Query: 43  FGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSE-VFLEKKFLPMLQLIAT 101
           +G+  D+ E   +  L++T + V R G+ I+ Y+P  V+F S+   +   F   L  IA 
Sbjct: 73  WGAYRDQQEAALRASLKNTAVQVQRDGENISLYLPGGVTFASDSAQISGNFYSALNSIAQ 132

Query: 102 ILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKY 161
           +L ++P T I +Q HTDS G+ ++N+ +S  RA+ +K YLI +GV+SNR +S +GF    
Sbjct: 133 VLVQYPETQILVQGHTDSTGSFQHNMDLSNRRANSVKHYLIGQGVASNRLMS-QGFGPNN 191

Query: 162 PIDTNDTKVGRQNNQRIEIQIFPRGN 187
           P+  N T  GRQ N+R+EI+I P+ N
Sbjct: 192 PVADNSTPDGRQMNRRVEIKIAPKYN 217


>gi|153009315|ref|YP_001370530.1| OmpA/MotB domain-containing protein [Ochrobactrum anthropi ATCC
           49188]
 gi|151561203|gb|ABS14701.1| OmpA/MotB domain protein [Ochrobactrum anthropi ATCC 49188]
          Length = 221

 Score =  111 bits (278), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 66/217 (30%), Positives = 110/217 (50%), Gaps = 34/217 (15%)

Query: 1   MIKELGLSMFIMTTISGC--------------------------------GLASREKKKV 28
           M+K++G+++F  T ++GC                                G +SR ++  
Sbjct: 1   MLKKIGIALFAATFLAGCTTDPYTGEQKMSNTAGGAAIGAAVGALGGLMVGGSSRAQRNA 60

Query: 29  FLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVF 87
            L  +    +     G+ +D+ E+E + QLQ TG+ V+R GD I   +P  ++F   +  
Sbjct: 61  VLIGAGIGALGGGAIGNYMDRQENELRAQLQGTGVSVTRNGDQIILNMPSSITFDTDQDQ 120

Query: 88  LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVS 147
           ++ +F P L  +A +L KF  T++ +  HTDS G++ +N  +SQ RA  + SYL  +G+ 
Sbjct: 121 VKSQFYPTLNSVAIVLRKFNQTLVDVYGHTDSTGSVSHNQALSQRRAASVASYLGSQGID 180

Query: 148 SNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
             RF +V G+    P+ TN T  GR  N+R+EIQI P
Sbjct: 181 PRRF-AVIGYGASQPVATNATPEGRAQNRRVEIQISP 216


>gi|56476024|ref|YP_157613.1| outer membrane lipoprotein [Aromatoleum aromaticum EbN1]
 gi|56312067|emb|CAI06712.1| outer membrane lipoprotein containing OmpA/MotB domain [Aromatoleum
           aromaticum EbN1]
          Length = 232

 Score =  111 bits (278), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 59/171 (34%), Positives = 95/171 (55%), Gaps = 6/171 (3%)

Query: 13  TTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMI 72
           + +SG G    ++ K  L  +     V    G  +DK E E + Q+  TG+ V R GD I
Sbjct: 46  SVVSGSG----DRTKGGLIGAAVGATVGGLIGRQMDKQEAELREQMAGTGVEVQRQGDTI 101

Query: 73  TCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQ 131
               P +++F  +   ++ +F P+L  +A  + ++P TVI ++ HTDS+G+   N  +S+
Sbjct: 102 RLQAPENITFDTNRADIKPQFQPVLGQLAQSIQQYPDTVIQVEGHTDSVGSASYNQTLSE 161

Query: 132 ERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
            RA  ++SYLIQRGV +NR  +V G+    P+  N T  GR  N+R+E+ I
Sbjct: 162 NRAGAVRSYLIQRGVDANRLAAV-GYGLTRPVADNSTAAGRAQNRRVEMLI 211


>gi|90022262|ref|YP_528089.1| OmpA family protein [Saccharophagus degradans 2-40]
 gi|89951862|gb|ABD81877.1| OmpA/MotB [Saccharophagus degradans 2-40]
          Length = 225

 Score =  111 bits (277), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 50/139 (35%), Positives = 90/139 (64%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +DK E E + QLQ TG+ V R G+ +   +P +++F  ++  +  +F  +L  +A +L K
Sbjct: 86  MDKQEAELRHQLQGTGVQVRREGNNLFLVMPGNITFDTAQYSIRSQFYEVLDSVAVVLKK 145

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +  T I +  HTD+ G+   N  +S++RA  +K+YL+Q+GV++ R  SV G+ Y+YP+ +
Sbjct: 146 YDKTAILVSGHTDNRGSSDYNQTLSEQRAGSVKAYLMQKGVAAGRVNSV-GYGYRYPVAS 204

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           ND+  GR+ N+R+E+++ P
Sbjct: 205 NDSAAGREQNRRVELKLEP 223


>gi|315917803|ref|ZP_07914043.1| outer membrane protein [Fusobacterium gonidiaformans ATCC 25563]
 gi|313691678|gb|EFS28513.1| outer membrane protein [Fusobacterium gonidiaformans ATCC 25563]
          Length = 204

 Score =  111 bits (277), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 56/146 (38%), Positives = 90/146 (61%), Gaps = 2/146 (1%)

Query: 43  FGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSE-VFLEKKFLPMLQLIAT 101
           +G+  D+ E   +  L++T + V R G+ I+ Y+P  V+F S+   +   F   L  IA 
Sbjct: 60  WGAYRDQQEAALRASLKNTAVQVQRDGENISLYLPGGVTFASDSAQISGNFYSALNSIAQ 119

Query: 102 ILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKY 161
           +L ++P T I +Q HTD+ G+ ++N+ +S  RA+ +K YLI +GV+SNR +S +GF    
Sbjct: 120 VLVQYPETQILVQGHTDNTGSFQHNMDLSNRRANSVKQYLIGQGVASNRLMS-QGFGPNN 178

Query: 162 PIDTNDTKVGRQNNQRIEIQIFPRGN 187
           P+  N T  GRQ N+R+EI+I P+ N
Sbjct: 179 PVADNSTPDGRQMNRRVEIKIAPKYN 204


>gi|257466649|ref|ZP_05630960.1| Outer membrane protein [Fusobacterium gonidiaformans ATCC 25563]
          Length = 217

 Score =  110 bits (276), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 56/146 (38%), Positives = 90/146 (61%), Gaps = 2/146 (1%)

Query: 43  FGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSE-VFLEKKFLPMLQLIAT 101
           +G+  D+ E   +  L++T + V R G+ I+ Y+P  V+F S+   +   F   L  IA 
Sbjct: 73  WGAYRDQQEAALRASLKNTAVQVQRDGENISLYLPGGVTFASDSAQISGNFYSALNSIAQ 132

Query: 102 ILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKY 161
           +L ++P T I +Q HTD+ G+ ++N+ +S  RA+ +K YLI +GV+SNR +S +GF    
Sbjct: 133 VLVQYPETQILVQGHTDNTGSFQHNMDLSNRRANSVKQYLIGQGVASNRLMS-QGFGPNN 191

Query: 162 PIDTNDTKVGRQNNQRIEIQIFPRGN 187
           P+  N T  GRQ N+R+EI+I P+ N
Sbjct: 192 PVADNSTPDGRQMNRRVEIKIAPKYN 217


>gi|239832093|ref|ZP_04680422.1| OmpA family protein [Ochrobactrum intermedium LMG 3301]
 gi|239824360|gb|EEQ95928.1| OmpA family protein [Ochrobactrum intermedium LMG 3301]
          Length = 260

 Score =  110 bits (274), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 66/217 (30%), Positives = 109/217 (50%), Gaps = 34/217 (15%)

Query: 1   MIKELGLSMFIMTTISGC--------------------------------GLASREKKKV 28
           M+K+ G+++F  T ++GC                                G +SR ++  
Sbjct: 40  MLKKTGIALFAATFLAGCTTDPYTGEQKMSNTAGGAAIGAAVGALGGLMVGGSSRAQRNA 99

Query: 29  FLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVF 87
            L  +    +     G+ +D+ E+E + QLQ TG+ V+R GD I   +P  ++F   +  
Sbjct: 100 VLIGAGIGALGGGAIGNYMDRQENELRAQLQGTGVSVTRNGDQIILNMPSSITFDTDQDQ 159

Query: 88  LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVS 147
           ++ +F P L  +A +L KF  T++ +  HTDS G++ +N  +SQ RA  + SYL  +G+ 
Sbjct: 160 VKSQFYPTLNSVAIVLRKFNQTLVDVYGHTDSTGSVSHNQALSQRRAASVASYLGSQGID 219

Query: 148 SNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
             RF +V G+    P+ TN T  GR  N+R+EIQI P
Sbjct: 220 PRRF-AVIGYGASQPVATNATPEGRAQNRRVEIQISP 255


>gi|319787272|ref|YP_004146747.1| OmpA/MotB domain protein [Pseudoxanthomonas suwonensis 11-1]
 gi|317465784|gb|ADV27516.1| OmpA/MotB domain protein [Pseudoxanthomonas suwonensis 11-1]
          Length = 226

 Score =  109 bits (273), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 51/142 (35%), Positives = 91/142 (64%), Gaps = 2/142 (1%)

Query: 44  GSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATI 102
           G+  D+ ++  + +LQ TG+ V+R GD IT  +P +V+F  +   L+ +F P+L  +A +
Sbjct: 83  GAYQDRQQNALRAKLQGTGVSVTRNGDNITLNMPGNVTFGFNSANLDPQFYPVLSSVAEV 142

Query: 103 LNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYP 162
           L ++  TV+ +  HTDS+G  + N  +S++RA+ +  +L+ + ++  RFI+V G   +YP
Sbjct: 143 LREYDKTVVEVAGHTDSVGGDEVNQRLSEQRANAVTQFLVSQNINPQRFITV-GAGKRYP 201

Query: 163 IDTNDTKVGRQNNQRIEIQIFP 184
           I +NDT+ GR  N+R+EI + P
Sbjct: 202 IASNDTEAGRAANRRVEITLVP 223


>gi|163759606|ref|ZP_02166691.1| OmpA/MotB [Hoeflea phototrophica DFL-43]
 gi|162283203|gb|EDQ33489.1| OmpA/MotB [Hoeflea phototrophica DFL-43]
          Length = 215

 Score =  106 bits (265), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 54/139 (38%), Positives = 85/139 (61%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVS-EVFLEKKFLPMLQLIATILNK 105
           +D+ E + + QLQ TG+ V+R+GD I   +P +++F S +  ++ +F   L  +A +L K
Sbjct: 76  MDQQEAQLRAQLQGTGVSVTRVGDKIILNMPSNITFDSDQSAVKPQFYETLNSVALVLQK 135

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           F  +++ +  HTDS G+   NL +SQ+RA  + SYLI +G  + RF + +GF    PI  
Sbjct: 136 FNRSLVDVAGHTDSTGSDSYNLTLSQQRAQSVSSYLISQGNDARRFYT-QGFGESRPIAD 194

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T  GR  N+R+EIQI P
Sbjct: 195 NGTDAGRAANRRVEIQISP 213


>gi|114707989|ref|ZP_01440881.1| OmpA family protein [Fulvimarina pelagi HTCC2506]
 gi|114536618|gb|EAU39750.1| OmpA family protein [Fulvimarina pelagi HTCC2506]
          Length = 221

 Score =  106 bits (265), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 54/139 (38%), Positives = 83/139 (59%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVF-LEKKFLPMLQLIATILNK 105
           +D  E + + QLQ TG+ V+R+GD I   +P +V+F S+   +   F P L  +A +L K
Sbjct: 80  MDNQEAQLRQQLQGTGVSVTRVGDRIILNMPSNVTFPSDQSQILPGFYPTLDSVAIVLQK 139

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           F  T++ +  HTDS G    NL +SQ+RA  +  +L  RGV+ NR ++ +G+    PI  
Sbjct: 140 FDETIVNVYGHTDSQGGDGYNLSLSQQRASSVSQFLASRGVNPNR-LNTQGYGESQPIAD 198

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T+ GR  N+R+E+QI P
Sbjct: 199 NSTEAGRARNRRVEVQISP 217


>gi|119472020|ref|ZP_01614278.1| putative lipoprotein [Alteromonadales bacterium TW-7]
 gi|119445155|gb|EAW26447.1| putative lipoprotein [Alteromonadales bacterium TW-7]
          Length = 210

 Score =  105 bits (262), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 53/139 (38%), Positives = 84/139 (60%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSE-VFLEKKFLPMLQLIATILNK 105
           +DK E+ F+ +L  +G+ V R GD +   IP +++F ++  ++   F   L  IA ++NK
Sbjct: 69  MDKQEEAFRDELAGSGVEVVREGDNLRLVIPSNITFATDQSYISTGFNDTLNAIAKVMNK 128

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +  T ++++ HTDS G    N+ +S+ERA  +K+YL  + + + R IS  GF    PI T
Sbjct: 129 YEKTYLSVEGHTDSTGQDSYNMNLSRERAQSVKAYLANQDIMAAR-ISTSGFGETRPIAT 187

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           NDT  GR  N+R+EIQI P
Sbjct: 188 NDTANGRAQNRRVEIQIVP 206


>gi|254785154|ref|YP_003072582.1| OmpA family protein [Teredinibacter turnerae T7901]
 gi|237683675|gb|ACR10939.1| OmpA family protein [Teredinibacter turnerae T7901]
          Length = 216

 Score =  105 bits (261), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 50/139 (35%), Positives = 88/139 (63%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVF-LEKKFLPMLQLIATILNK 105
           +D+ E + + QLQ +G+ V R G+ I   +P +++F ++ F ++ +F  +L  +A +L +
Sbjct: 77  MDRQESKLRQQLQGSGVQVQRDGNTINLIMPGNITFATDSFDIKPEFHSVLDSVAQVLKE 136

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           F  TVI +  HTDS G+   N  +S+ RA+ ++SYL+ R V+S R  +V G+  + PI +
Sbjct: 137 FKKTVIVVSGHTDSTGSATYNQQLSENRANSVRSYLLNRSVASGRVQAV-GYGPRMPIAS 195

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T  GRQ N+R+E+++ P
Sbjct: 196 NKTAQGRQQNRRVELKLEP 214


>gi|13470497|ref|NP_102066.1| hypothetical protein mlr0220 [Mesorhizobium loti MAFF303099]
 gi|14021239|dbj|BAB47852.1| mlr0220 [Mesorhizobium loti MAFF303099]
          Length = 216

 Score =  104 bits (260), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 54/140 (38%), Positives = 84/140 (60%), Gaps = 2/140 (1%)

Query: 46  SLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILN 104
           ++D+ E E + QL+ TG+ V+R GD I   +P  ++F V +  ++  F P+L  +A +L 
Sbjct: 76  TMDQNEAELRRQLEGTGVSVTRSGDQIILNMPSDITFNVDQDAVKPGFYPVLNSVALVLK 135

Query: 105 KFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPID 164
           KF  T + +  HTDS G  ++N  +SQ RA  + +YL  +GV   RF +V GF    PI 
Sbjct: 136 KFKQTTVDVFGHTDSTGGDQHNFDLSQRRALAVANYLSGQGVDQRRF-AVTGFGKTRPIA 194

Query: 165 TNDTKVGRQNNQRIEIQIFP 184
           +N T  GR+ N+R+EIQ+ P
Sbjct: 195 SNATAAGREQNRRVEIQLSP 214


>gi|56460671|ref|YP_155952.1| Outer membrane protein and related peptidoglycan-associated
           (lipo)proteins [Idiomarina loihiensis L2TR]
 gi|56179681|gb|AAV82403.1| Outer membrane protein and related peptidoglycan-associated
           (lipo)proteins [Idiomarina loihiensis L2TR]
          Length = 208

 Score =  104 bits (260), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 50/141 (35%), Positives = 87/141 (61%), Gaps = 2/141 (1%)

Query: 45  SSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVS-EVFLEKKFLPMLQLIATIL 103
           S +DK E+EF+ +L D+G+ V R GD +   +P +++F +    + + F P+L  +A +L
Sbjct: 66  SYMDKQEEEFREELADSGVKVIRDGDNLRLQLPSNITFATGSANISQSFNPVLDDVARVL 125

Query: 104 NKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPI 163
            K+  T + I+ HTDS G+ + N  +S  RA+ +++ L+  GV S R ++  G+    P+
Sbjct: 126 KKYEKTTMLIEGHTDSTGSAEYNQQLSLNRANAVRNNLVGNGVDSRR-VTTEGYGESMPV 184

Query: 164 DTNDTKVGRQNNQRIEIQIFP 184
             NDT+ GRQ N+R+E++I P
Sbjct: 185 ADNDTESGRQLNRRVELRIVP 205


>gi|218660571|ref|ZP_03516501.1| outer membrane lipoprotein [Rhizobium etli IE4771]
          Length = 196

 Score =  104 bits (260), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 54/139 (38%), Positives = 84/139 (60%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D+ E E + QL+ TGI V+R GD I   +P +++F V +  ++  F P L  +A +L K
Sbjct: 55  MDQQEAELRAQLEGTGISVTRNGDNIILNMPSNITFDVDQDAVKPGFYPTLNSVAIVLRK 114

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           F  T+I +  HTDS G+L++N  +SQ RA  +  YL  +G+   R +S  GF    P+ +
Sbjct: 115 FNRTLIDVNGHTDSTGSLQHNQDLSQRRALSVADYLGGQGIDQRR-VSAVGFGPSQPVAS 173

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N ++ GR  N+R+EIQI P
Sbjct: 174 NASEAGRAQNRRVEIQIAP 192


>gi|209550136|ref|YP_002282053.1| OmpA/MotB domain protein [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|209535892|gb|ACI55827.1| OmpA/MotB domain protein [Rhizobium leguminosarum bv. trifolii
           WSM2304]
          Length = 221

 Score =  104 bits (259), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 54/139 (38%), Positives = 84/139 (60%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D+ E E + QL+ TGI V+R GD I   +P +++F V +  ++  F P L  +A +L K
Sbjct: 80  MDQQESELRAQLEGTGISVTRNGDNIILNMPSNITFDVDQDAVKPGFYPTLNSVAIVLRK 139

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           F  T+I +  HTDS G+L++N  +SQ RA  +  YL  +G+   R +S  GF    P+ +
Sbjct: 140 FNRTLIDVNGHTDSTGSLQHNQDLSQRRALSVADYLGGQGIDQRR-VSAVGFGPSQPVAS 198

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N ++ GR  N+R+EIQI P
Sbjct: 199 NASEAGRAQNRRVEIQIAP 217


>gi|241205517|ref|YP_002976613.1| OmpA/MotB domain protein [Rhizobium leguminosarum bv. trifolii
           WSM1325]
 gi|240859407|gb|ACS57074.1| OmpA/MotB domain protein [Rhizobium leguminosarum bv. trifolii
           WSM1325]
          Length = 221

 Score =  104 bits (259), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 54/139 (38%), Positives = 84/139 (60%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D+ E E + QL+ TGI V+R GD I   +P +++F V +  ++  F P L  +A +L K
Sbjct: 80  MDQQESELRAQLEGTGISVTRNGDNIILNMPSNITFDVDQDAVKPGFYPTLNSVAIVLRK 139

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           F  T+I +  HTDS G+L++N  +SQ RA  +  YL  +G+   R +S  GF    P+ +
Sbjct: 140 FNRTLIDVNGHTDSTGSLQHNQDLSQRRALSVADYLGGQGIDQRR-VSAVGFGPSQPVAS 198

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N ++ GR  N+R+EIQI P
Sbjct: 199 NASEAGRAQNRRVEIQIAP 217


>gi|116253010|ref|YP_768848.1| OmpA family outer membrane protein [Rhizobium leguminosarum bv.
           viciae 3841]
 gi|115257658|emb|CAK08755.1| putative OmpA family outer membrane protein [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 221

 Score =  104 bits (259), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 54/139 (38%), Positives = 84/139 (60%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D+ E E + QL+ TGI V+R GD I   +P +++F V +  ++  F P L  +A +L K
Sbjct: 80  MDQQESELRAQLEGTGISVTRNGDNIILNMPSNITFDVDQDAVKPGFYPTLNSVAIVLRK 139

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           F  T+I +  HTDS G+L++N  +SQ RA  +  YL  +G+   R +S  GF    P+ +
Sbjct: 140 FNRTLIDVNGHTDSTGSLQHNQDLSQRRALSVADYLGGQGIDQRR-VSAVGFGPSQPVAS 198

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N ++ GR  N+R+EIQI P
Sbjct: 199 NASEAGRAQNRRVEIQIAP 217


>gi|218673547|ref|ZP_03523216.1| outer membrane lipoprotein [Rhizobium etli GR56]
          Length = 180

 Score =  103 bits (258), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 54/139 (38%), Positives = 84/139 (60%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D+ E E + QL+ TGI V+R GD I   +P +++F V +  ++  F P L  +A +L K
Sbjct: 39  MDQQEAELRAQLEGTGISVTRNGDNIILNMPSNITFDVDQDAVKPGFYPTLNSVAIVLRK 98

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           F  T+I +  HTDS G+L++N  +SQ RA  +  YL  +G+   R +S  GF    P+ +
Sbjct: 99  FNRTLIDVNGHTDSTGSLQHNQDLSQRRALSVADYLGGQGIDQRR-VSAVGFGPSQPVAS 157

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N ++ GR  N+R+EIQI P
Sbjct: 158 NASEAGRAQNRRVEIQIAP 176


>gi|86358413|ref|YP_470305.1| outer membrane lipoprotein [Rhizobium etli CFN 42]
 gi|86282515|gb|ABC91578.1| outer membrane lipoprotein [Rhizobium etli CFN 42]
          Length = 221

 Score =  103 bits (258), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 54/139 (38%), Positives = 84/139 (60%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D+ E E + QL+ TGI V+R GD I   +P +++F V +  ++  F P L  +A +L K
Sbjct: 80  MDQQEAELRAQLEGTGISVTRNGDNIILNMPSNITFDVDQDAVKPGFYPTLNSVAIVLRK 139

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           F  T+I +  HTDS G+L++N  +SQ RA  +  YL  +G+   R +S  GF    P+ +
Sbjct: 140 FNRTLIDVNGHTDSTGSLQHNQDLSQRRALSVADYLGGQGIDQRR-VSAVGFGPSQPVAS 198

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N ++ GR  N+R+EIQI P
Sbjct: 199 NASEAGRAQNRRVEIQIAP 217


>gi|315127968|ref|YP_004069971.1| lipoprotein [Pseudoalteromonas sp. SM9913]
 gi|315016482|gb|ADT69820.1| lipoprotein [Pseudoalteromonas sp. SM9913]
          Length = 210

 Score =  103 bits (258), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 49/139 (35%), Positives = 85/139 (61%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVS-EVFLEKKFLPMLQLIATILNK 105
           +DK E  F+ +L  +G+ V R GD +   +P +++F + + ++   F   L  IA+++NK
Sbjct: 69  MDKQEAAFRDELAGSGVEVVREGDNLRLVMPSNITFATDQSYISSGFHDTLNAIASVMNK 128

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +  T ++++ HTDS G    N+ +S++RA  +K+YL+ + + + R +S  G+    PI T
Sbjct: 129 YEKTYLSVEGHTDSTGKDSYNMTLSEQRAQSVKNYLVNQQIMAAR-VSTSGYGESRPIAT 187

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           NDT  GR  N+R+EIQI P
Sbjct: 188 NDTANGRAQNRRVEIQIVP 206


>gi|190892542|ref|YP_001979084.1| outer membrane peptidoglycan-associated lipoprotein [Rhizobium etli
           CIAT 652]
 gi|190697821|gb|ACE91906.1| outer membrane peptidoglycan-associated lipoprotein [Rhizobium etli
           CIAT 652]
 gi|327192440|gb|EGE59397.1| outer membrane peptidoglycan-associated lipoprotein [Rhizobium etli
           CNPAF512]
          Length = 221

 Score =  103 bits (258), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 54/139 (38%), Positives = 84/139 (60%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D+ E E + QL+ TGI V+R GD I   +P +++F V +  ++  F P L  +A +L K
Sbjct: 80  MDQQEAELRAQLEGTGISVTRNGDNIILNMPSNITFDVDQDAVKPGFYPTLNSVAIVLRK 139

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           F  T+I +  HTDS G+L++N  +SQ RA  +  YL  +G+   R +S  GF    P+ +
Sbjct: 140 FNRTLIDVNGHTDSTGSLQHNQDLSQRRALSVADYLGGQGIDQRR-VSAVGFGPSQPVAS 198

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N ++ GR  N+R+EIQI P
Sbjct: 199 NASEAGRAQNRRVEIQIAP 217


>gi|126666899|ref|ZP_01737875.1| Outer membrane protein and related peptidoglycan-associated
           (lipo)protein [Marinobacter sp. ELB17]
 gi|126628615|gb|EAZ99236.1| Outer membrane protein and related peptidoglycan-associated
           (lipo)protein [Marinobacter sp. ELB17]
          Length = 232

 Score =  103 bits (258), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 48/139 (34%), Positives = 88/139 (63%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D+ E + + QL+ TG+ V R GD I+  +P +++F +++  +  +F   L+ +A +L +
Sbjct: 93  MDRQEVQLRQQLEGTGVRVVRNGDEISLVMPGNITFDLNQTSIRSQFAGTLESVALVLKE 152

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           F  T+I I+ HTDS G    N L+S+ RA  ++ +L+ +G+ S R  +V G+  +YP+ +
Sbjct: 153 FDQTIIQIEGHTDSQGGDSYNQLLSERRASSVRDFLLNQGIESRRTRAV-GYGERYPVAS 211

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           NDT  GR+ N+R+E+ + P
Sbjct: 212 NDTSGGREQNRRVELTLVP 230


>gi|222086409|ref|YP_002544943.1| outer membrane lipoprotein [Agrobacterium radiobacter K84]
 gi|221723857|gb|ACM27013.1| outer membrane lipoprotein [Agrobacterium radiobacter K84]
          Length = 222

 Score =  103 bits (257), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 52/139 (37%), Positives = 83/139 (59%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D+ E E + QLQ TG+ V+R+GD I   +P  ++F +    ++ +F   L  +A +L K
Sbjct: 80  MDQQESELRAQLQGTGVSVTRVGDRIILNMPSAITFDIDRDEIKPEFFATLNSVAIVLRK 139

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           F  T+I +  HTDS G+L++N  +S+ RA  + SYL  +G+   R +S  GF    P+ +
Sbjct: 140 FNRTLIDVNGHTDSTGSLQHNQDLSERRAGSVASYLGSQGIDQRR-VSAVGFGPTQPVAS 198

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N  + GR  N+R+EIQI P
Sbjct: 199 NANESGRAQNRRVEIQIAP 217


>gi|218514237|ref|ZP_03511077.1| outer membrane lipoprotein [Rhizobium etli 8C-3]
          Length = 141

 Score =  103 bits (256), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 54/138 (39%), Positives = 83/138 (60%), Gaps = 2/138 (1%)

Query: 48  DKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKF 106
           D+ E E + QL+ TGI V+R GD I   +P +++F V +  ++  F P L  +A +L KF
Sbjct: 1   DQQEAELRAQLEGTGISVTRNGDNIILNMPSNITFDVDQDAVKPGFYPTLNSVAIVLRKF 60

Query: 107 PSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTN 166
             T+I +  HTDS G+L++N  +SQ RA  +  YL  +G+   R +S  GF    P+ +N
Sbjct: 61  NRTLIDVNGHTDSTGSLQHNQDLSQRRALSVADYLGGQGIDQRR-VSAVGFGPSQPVASN 119

Query: 167 DTKVGRQNNQRIEIQIFP 184
            ++ GR  N+R+EIQI P
Sbjct: 120 ASEAGRAQNRRVEIQIAP 137


>gi|311695446|gb|ADP98319.1| OmpA/MotB domain protein [marine bacterium HP15]
          Length = 218

 Score =  102 bits (255), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 48/139 (34%), Positives = 87/139 (62%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +DK E E + +L+ TG+ V R GD I   +P +++F ++E  ++  F   L+ +A +L +
Sbjct: 79  MDKQEAELRRKLEGTGVRVVRNGDEIELVMPGNITFDLNESSIKPSFSGTLESVALVLKE 138

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +  T+I I+ HTDS G+   N L+S+ RA  ++ +L+ +G+   R  +V G+  +YP+ +
Sbjct: 139 YDKTIIQIEGHTDSSGSDSYNQLLSERRASSVRDFLLNQGIEPKRTRAV-GYGERYPVAS 197

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           NDT  GR+ N+R+E+ + P
Sbjct: 198 NDTAAGREQNRRVELTLVP 216


>gi|332533226|ref|ZP_08409093.1| putative lipoprotein [Pseudoalteromonas haloplanktis ANT/505]
 gi|332037305|gb|EGI73760.1| putative lipoprotein [Pseudoalteromonas haloplanktis ANT/505]
          Length = 210

 Score =  102 bits (255), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 50/139 (35%), Positives = 85/139 (61%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSE-VFLEKKFLPMLQLIATILNK 105
           +DK E+ F+ +L  +G+ V R GD +   +P +++F ++  ++   F   L  IA ++NK
Sbjct: 69  MDKQEEAFRDELAGSGVEVVREGDNLRLVMPSNITFATDQSYISSGFNDTLDAIAKVMNK 128

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +  T ++I+ HTDS G    N+ +S+ERA  +K+YL+ + + + R +S  G+    PI T
Sbjct: 129 YEKTYLSIEGHTDSTGKDSYNMNLSRERAQSVKNYLVNQQIMAER-VSTMGYGETRPIAT 187

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           ND+  GR  N+R+EIQI P
Sbjct: 188 NDSANGRAQNRRVEIQIVP 206


>gi|332704885|ref|ZP_08424973.1| OmpA/MotB domain protein [Desulfovibrio africanus str. Walvis Bay]
 gi|332555034|gb|EGJ52078.1| OmpA/MotB domain protein [Desulfovibrio africanus str. Walvis Bay]
          Length = 222

 Score =  102 bits (255), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 51/139 (36%), Positives = 82/139 (58%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D  E + + +LQ TG+ V+R GDMI   +P +V+F      ++ +F  +L  +A +L +
Sbjct: 81  MDYQESKLRQRLQGTGVSVTRQGDMIILNMPGNVTFDTGSAGIKPQFFEVLNSVAIVLKE 140

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +  T + +  HTDS G++  N+ +SQ+RA  +  YLI +GV   RF+ VRG     PI  
Sbjct: 141 YEKTYVDVLGHTDSTGSMNLNMRLSQDRAQSVAQYLISQGVQQERFL-VRGMGPNQPIAD 199

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T  GR  N+R+EI++ P
Sbjct: 200 NSTAAGRSQNRRVEIKLTP 218


>gi|114319490|ref|YP_741173.1| OmpA/MotB domain-containing protein [Alkalilimnicola ehrlichii
           MLHE-1]
 gi|114225884|gb|ABI55683.1| OmpA/MotB domain protein [Alkalilimnicola ehrlichii MLHE-1]
          Length = 224

 Score =  102 bits (254), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 51/142 (35%), Positives = 81/142 (57%), Gaps = 2/142 (1%)

Query: 44  GSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV-SEVFLEKKFLPMLQLIATI 102
           G  +D+  +E + +L+ TG+ V+R G+ +   +P HV+F      L   F  +L  +A +
Sbjct: 81  GGYMDRQAEELRQRLRGTGVSVTRDGENVILNMPGHVTFAFDSADLRSDFFEVLDSVAIV 140

Query: 103 LNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYP 162
            N+F  T+I +  HTDS G  + N  +S+ RA  +  YL+ R V+  R I+V GF  + P
Sbjct: 141 ANEFDQTMIEVAGHTDSTGPAEYNQRLSERRAQTVARYLVGRDVAEMRMIAV-GFGEERP 199

Query: 163 IDTNDTKVGRQNNQRIEIQIFP 184
           I +N T+ GRQ N+R+EI   P
Sbjct: 200 IASNQTEEGRQQNRRVEITFLP 221


>gi|15964027|ref|NP_384380.1| hypothetical protein SMc00354 [Sinorhizobium meliloti 1021]
 gi|15073203|emb|CAC41711.1| Probable porin [Sinorhizobium meliloti 1021]
          Length = 221

 Score =  102 bits (254), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 53/139 (38%), Positives = 81/139 (58%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEV-FLEKKFLPMLQLIATILNK 105
           +D+ E E + QLQ TG+ V+R GD I   +P +++F ++   +   F   L  +A +L K
Sbjct: 80  MDQQESELRAQLQGTGVSVTRAGDRIILNMPSNITFATDRDQVIPAFYSTLDSVAIVLRK 139

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           F  T+I +  HTDS G+   N  +S+ RA  + +YL  RGV   R  +V G+  + PI +
Sbjct: 140 FNKTLIDVDGHTDSTGSASYNQGLSERRAASVANYLASRGVDQRRMSAV-GYGLERPIAS 198

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T+VGR  N+R+EI I P
Sbjct: 199 NATEVGRAQNRRVEISIAP 217


>gi|262274025|ref|ZP_06051837.1| Flagellar motor rotation protein MotB [Grimontia hollisae CIP
           101886]
 gi|262221835|gb|EEY73148.1| Flagellar motor rotation protein MotB [Grimontia hollisae CIP
           101886]
          Length = 208

 Score =  102 bits (254), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 50/139 (35%), Positives = 84/139 (60%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D+ E  F+ +L  +GI V R GD I   +P +++F  ++  +   F   L  +A ++N+
Sbjct: 68  MDRQEAAFREELAGSGIEVVREGDNIRLVMPSNITFGTNQSGISPGFYQSLDAVARVMNE 127

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +  T ++I+ HTDS G    N+ +S++RA+ +KSYL++  V++ R   V G+    PI +
Sbjct: 128 YDKTFLSIEGHTDSTGDAAYNMTLSEKRAESVKSYLLRSAVNAKRLY-VTGYGETQPIAS 186

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           NDT  GR  N+R+EIQI P
Sbjct: 187 NDTSTGRAQNRRVEIQIVP 205


>gi|307301173|ref|ZP_07580935.1| OmpA/MotB domain protein [Sinorhizobium meliloti BL225C]
 gi|307321074|ref|ZP_07600479.1| OmpA/MotB domain protein [Sinorhizobium meliloti AK83]
 gi|306893246|gb|EFN24027.1| OmpA/MotB domain protein [Sinorhizobium meliloti AK83]
 gi|306903629|gb|EFN34216.1| OmpA/MotB domain protein [Sinorhizobium meliloti BL225C]
          Length = 227

 Score =  102 bits (254), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 53/139 (38%), Positives = 81/139 (58%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEV-FLEKKFLPMLQLIATILNK 105
           +D+ E E + QLQ TG+ V+R GD I   +P +++F ++   +   F   L  +A +L K
Sbjct: 86  MDQQESELRAQLQGTGVSVTRAGDRIILNMPSNITFATDRDQVIPAFYSTLDSVAIVLRK 145

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           F  T+I +  HTDS G+   N  +S+ RA  + +YL  RGV   R  +V G+  + PI +
Sbjct: 146 FNKTLIDVDGHTDSTGSASYNQGLSERRAASVANYLASRGVDQRRMSAV-GYGLERPIAS 204

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T+VGR  N+R+EI I P
Sbjct: 205 NATEVGRAQNRRVEISIAP 223


>gi|254693909|ref|ZP_05155737.1| Bacterial outer membrane protein [Brucella abortus bv. 3 str.
           Tulya]
 gi|261214200|ref|ZP_05928481.1| OmpA/MotB domain-containing protein [Brucella abortus bv. 3 str.
           Tulya]
 gi|260915807|gb|EEX82668.1| OmpA/MotB domain-containing protein [Brucella abortus bv. 3 str.
           Tulya]
          Length = 216

 Score =  102 bits (254), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 65/213 (30%), Positives = 105/213 (49%), Gaps = 30/213 (14%)

Query: 1   MIKELGLSMFIMTTISGC----------------------------GLASREKKKVFLHK 32
           M+K+ G+++   T ++GC                            G +SR ++   L  
Sbjct: 1   MLKKTGIALICATFLAGCTTDPYTGQQKVSNTTGGAAVGALGGLMVGGSSRAQRNAVLIG 60

Query: 33  SNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKK 91
           +    +     G+ +D+ E E + QLQ TG+ V+R GD I   +P +++F   +  ++ +
Sbjct: 61  AGIGALGGGLIGNYMDRQEAELRAQLQGTGVSVTRNGDRIILNMPSNITFDTDQDQVKSQ 120

Query: 92  FLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRF 151
           F P L  +A +L KF  T++ +   TDS G+   N  +SQ RA  + SYL  +G+   RF
Sbjct: 121 FYPTLNSVAIVLRKFDKTLVDVYGFTDSTGSASYNQALSQRRAASVASYLDSQGIDPRRF 180

Query: 152 ISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
            SV G+    PI +N T  GR  N+R+EIQI P
Sbjct: 181 -SVIGYGASQPIVSNATPEGRAQNRRVEIQISP 212


>gi|237736307|ref|ZP_04566788.1| outer membrane protein [Fusobacterium mortiferum ATCC 9817]
 gi|229421655|gb|EEO36702.1| outer membrane protein [Fusobacterium mortiferum ATCC 9817]
          Length = 203

 Score =  102 bits (253), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 54/143 (37%), Positives = 80/143 (55%), Gaps = 2/143 (1%)

Query: 43  FGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSE-VFLEKKFLPMLQLIAT 101
           +G+  D  E E + +L++T + VSR GD +  Y+P  V+F +    +   F   L  IA+
Sbjct: 60  WGAYRDNQEKELRERLKNTEVEVSREGDNLNLYLPGGVTFATNSANIASNFYGPLNSIAS 119

Query: 102 ILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKY 161
           +L ++P T I +  +TD+ G    NL +SQ RA+ ++ Y I +GV S R  SV G     
Sbjct: 120 VLVQYPETRIVVNGYTDNTGAASYNLDLSQRRANSVRDYFISQGVESYRVTSV-GHGINN 178

Query: 162 PIDTNDTKVGRQNNQRIEIQIFP 184
           P  TN T  GR  N+R+EIQI P
Sbjct: 179 PRATNSTAAGRAENRRVEIQILP 201


>gi|77361745|ref|YP_341320.1| lipoprotein [Pseudoalteromonas haloplanktis TAC125]
 gi|76876656|emb|CAI87878.1| putative lipoprotein [Pseudoalteromonas haloplanktis TAC125]
          Length = 209

 Score =  102 bits (253), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 49/139 (35%), Positives = 84/139 (60%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVS-EVFLEKKFLPMLQLIATILNK 105
           +DK E  F+ +L  +G+ V R GD +   +P +++F + + ++   F   L  IA ++NK
Sbjct: 69  MDKQETAFRDELAGSGVEVVREGDNLRLVMPSNITFATDQSYISSGFHNTLSAIAKVMNK 128

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +  T ++++ HTDS G    N+ +SQ+RA  +K+YL+ + + + R IS  G+    PI +
Sbjct: 129 YEKTYLSVEGHTDSTGKDSYNMSLSQQRAQSVKNYLVNQQIMAER-ISTTGYGETRPISS 187

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           ND+  GR  N+R+EIQI P
Sbjct: 188 NDSANGRAQNRRVEIQIVP 206


>gi|222150201|ref|YP_002551158.1| porin [Agrobacterium vitis S4]
 gi|221737183|gb|ACM38146.1| porin [Agrobacterium vitis S4]
          Length = 221

 Score =  101 bits (252), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 55/141 (39%), Positives = 82/141 (58%), Gaps = 2/141 (1%)

Query: 45  SSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEV-FLEKKFLPMLQLIATIL 103
           S +D  E E + QLQ TG+ V+R GD I   +P +++F ++   +   F P L  +A +L
Sbjct: 78  SYMDNQEAELRAQLQGTGVSVTRQGDRIILNMPSNITFPTDQDQVLPPFYPTLNSVAIVL 137

Query: 104 NKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPI 163
            KF  T++ +  HTDS G L++N  +SQ RA+ + +YL  +GV   R +S  GF    PI
Sbjct: 138 KKFNRTLVDVNGHTDSTGGLQHNQDLSQRRAESVLNYLGSQGVDPRR-MSAMGFGPSQPI 196

Query: 164 DTNDTKVGRQNNQRIEIQIFP 184
            TN T  GR  N+R+E+ I P
Sbjct: 197 ATNATPQGRAQNRRVEVAISP 217


>gi|15889974|ref|NP_355655.1| porin [Agrobacterium tumefaciens str. C58]
 gi|15157937|gb|AAK88440.1| porin [Agrobacterium tumefaciens str. C58]
          Length = 220

 Score =  101 bits (252), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 56/142 (39%), Positives = 83/142 (58%), Gaps = 8/142 (5%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLP----MLQLIATI 102
           +D  E E + QLQ TG+ V+R GD I   +P +++F ++   + + +P     L  +A +
Sbjct: 80  MDGQEAELRAQLQGTGVSVTRRGDSIVLNMPSNITFATD---QDQVIPPFYQTLDSVAIV 136

Query: 103 LNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYP 162
           LNKF  T+I I  HTDS G+L++N  +S+ RA  + +YL  RGV   R IS  GF    P
Sbjct: 137 LNKFNRTLIDINGHTDSTGSLQHNQALSERRAASVANYLGARGVDQRR-ISTLGFGPSQP 195

Query: 163 IDTNDTKVGRQNNQRIEIQIFP 184
           I +N T  GR  N+R+E+ I P
Sbjct: 196 IASNATSDGRAQNRRVEVLISP 217


>gi|227824113|ref|YP_002828086.1| putative outer membrane protein, OmpA/MotB domain protein
           [Sinorhizobium fredii NGR234]
 gi|227343115|gb|ACP27333.1| putative outer membrane protein, OmpA/MotB domain protein
           [Sinorhizobium fredii NGR234]
          Length = 221

 Score =  101 bits (252), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 51/139 (36%), Positives = 82/139 (58%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEV-FLEKKFLPMLQLIATILNK 105
           +D+ E E + QLQ TGI V+R GD I   +P +++F ++   +   F P L  +A +L K
Sbjct: 80  MDQQESELRAQLQGTGISVTRQGDRIILNMPSNITFATDRDQVIPPFYPTLDSVAIVLRK 139

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +  T+I +  HTDS G+  +N  +S+ RA  + +YL  RG+   R IS  G+  + P+ +
Sbjct: 140 YNKTLIDVDGHTDSTGSAAHNQDLSERRAASVANYLGSRGIDQRR-ISTMGYGMERPVAS 198

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N ++ GR  N+R+EI I P
Sbjct: 199 NSSEAGRAQNRRVEISIAP 217


>gi|254473994|ref|ZP_05087387.1| OmpA family protein [Pseudovibrio sp. JE062]
 gi|211956883|gb|EEA92090.1| OmpA family protein [Pseudovibrio sp. JE062]
          Length = 220

 Score =  101 bits (251), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 50/139 (35%), Positives = 83/139 (59%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D+ E + + QLQ +G+ V+R G+ I   +P  V+F V +  L  + + +L  +A +  +
Sbjct: 81  MDRQEAQLRQQLQSSGVSVTRNGNQIVLNMPNDVTFAVGQATLSSRAMQVLNSVALVAKE 140

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           FP T + +  HTD+ G+ + NL +SQ RAD + +YL  +GV+  R IS  G+    PI +
Sbjct: 141 FPQTRLNVYGHTDNTGSAQFNLQLSQRRADSVSNYLFNQGVNGAR-ISAAGYGLTSPIAS 199

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T+ GR  N+R+EI + P
Sbjct: 200 NATEAGRAQNRRVEIILSP 218


>gi|83644388|ref|YP_432823.1| outer membrane protein and related peptidoglycan-associated
           (lipo)protein [Hahella chejuensis KCTC 2396]
 gi|83632431|gb|ABC28398.1| Outer membrane protein and related peptidoglycan-associated
           (lipo)protein [Hahella chejuensis KCTC 2396]
          Length = 219

 Score =  101 bits (251), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 50/139 (35%), Positives = 83/139 (59%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +DK E E + +L+ TG+ V R GD IT  +P +++F      ++  F   L  +  +L +
Sbjct: 79  MDKQESELRHRLEGTGVRVVRNGDEITLVMPGNITFDTGRAEVKANFYDTLDSVGLVLKE 138

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           F  T+I +  HTDS G+L  N  +S++RA  +  YLI +GV S+R  ++ G+  +YP+ T
Sbjct: 139 FDKTIIQVSGHTDSTGSLDLNQRLSEQRAGSVGRYLISQGVLSSRVQTI-GYGPRYPVAT 197

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T  GR  N+R+E+++ P
Sbjct: 198 NSTTEGRAANRRVELKLVP 216


>gi|154250728|ref|YP_001411552.1| OmpA/MotB domain-containing protein [Parvibaculum lavamentivorans
           DS-1]
 gi|154154678|gb|ABS61895.1| OmpA/MotB domain protein [Parvibaculum lavamentivorans DS-1]
          Length = 224

 Score =  101 bits (251), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 54/139 (38%), Positives = 85/139 (61%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVF-LEKKFLPMLQLIATILNK 105
           +DK E E   +L+ +G+ V+R+G+ I   +P +V+F +    +  KF  +L  +A +L +
Sbjct: 83  MDKQEAELTQRLRASGVSVTRVGNDIILNMPGNVTFATNSSDINAKFYDVLNSVAIVLKE 142

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +  T+I +  HTDS G+ + NL +SQ+RA  + SYLI + V S RF  V G     PI T
Sbjct: 143 YDKTLIDVTGHTDSTGSDQYNLELSQKRAQSVASYLIGQSVDSRRFYIV-GAGESQPIAT 201

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           NDT  GR+ N+R+EI++ P
Sbjct: 202 NDTPQGREQNRRVEIRLSP 220


>gi|62290115|ref|YP_221908.1| OmpA family protein [Brucella abortus bv. 1 str. 9-941]
 gi|82700038|ref|YP_414612.1| outer membrane protein MotY [Brucella melitensis biovar Abortus
           2308]
 gi|189024353|ref|YP_001935121.1| outer membrane protein [Brucella abortus S19]
 gi|254689424|ref|ZP_05152678.1| Bacterial outer membrane protein [Brucella abortus bv. 6 str. 870]
 gi|254697559|ref|ZP_05159387.1| Bacterial outer membrane protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254730453|ref|ZP_05189031.1| Bacterial outer membrane protein [Brucella abortus bv. 4 str. 292]
 gi|256257670|ref|ZP_05463206.1| Bacterial outer membrane protein [Brucella abortus bv. 9 str. C68]
 gi|260546663|ref|ZP_05822402.1| bacterial outer membrane protein [Brucella abortus NCTC 8038]
 gi|260754947|ref|ZP_05867295.1| OmpA/MotB domain-containing protein [Brucella abortus bv. 6 str.
           870]
 gi|260758163|ref|ZP_05870511.1| OmpA/MotB domain-containing protein [Brucella abortus bv. 4 str.
           292]
 gi|260761989|ref|ZP_05874332.1| OmpA/MotB domain-containing protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|62196247|gb|AAX74547.1| OmpA family protein [Brucella abortus bv. 1 str. 9-941]
 gi|82616139|emb|CAJ11182.1| MotY protein:Bacterial outer membrane protein:OmpA/MotB domain
           [Brucella melitensis biovar Abortus 2308]
 gi|189019925|gb|ACD72647.1| Bacterial outer membrane protein [Brucella abortus S19]
 gi|260095713|gb|EEW79590.1| bacterial outer membrane protein [Brucella abortus NCTC 8038]
 gi|260668481|gb|EEX55421.1| OmpA/MotB domain-containing protein [Brucella abortus bv. 4 str.
           292]
 gi|260672421|gb|EEX59242.1| OmpA/MotB domain-containing protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260675055|gb|EEX61876.1| OmpA/MotB domain-containing protein [Brucella abortus bv. 6 str.
           870]
          Length = 220

 Score =  101 bits (251), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 54/139 (38%), Positives = 81/139 (58%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D+ E E + QLQ TG+ V+R GD I   +P +++F   +  ++ +F P L  +A +L K
Sbjct: 79  MDRQEAELRAQLQGTGVSVTRNGDRIILNMPSNITFDTDQDQVKSQFYPTLNSVAIVLRK 138

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           F  T++ +   TDS G+   N  +SQ RA  + SYL  +G+   RF SV G+    PI +
Sbjct: 139 FDKTLVDVYGFTDSTGSASYNQALSQRRAASVASYLDSQGIDPRRF-SVIGYGASQPIVS 197

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T  GR  N+R+EIQI P
Sbjct: 198 NATPEGRAQNRRVEIQISP 216


>gi|23502081|ref|NP_698208.1| OmpA family protein [Brucella suis 1330]
 gi|161619159|ref|YP_001593046.1| OmpA/MotB domain-containing protein [Brucella canis ATCC 23365]
 gi|163843469|ref|YP_001627873.1| OmpA/MotB domain-containing protein [Brucella suis ATCC 23445]
 gi|225852700|ref|YP_002732933.1| OmpA/MotB domain-containing protein [Brucella melitensis ATCC
           23457]
 gi|254701944|ref|ZP_05163772.1| OmpA family protein [Brucella suis bv. 5 str. 513]
 gi|254704489|ref|ZP_05166317.1| OmpA family protein [Brucella suis bv. 3 str. 686]
 gi|254706615|ref|ZP_05168443.1| OmpA family protein [Brucella pinnipedialis M163/99/10]
 gi|254710275|ref|ZP_05172086.1| OmpA family protein [Brucella pinnipedialis B2/94]
 gi|254714272|ref|ZP_05176083.1| OmpA family protein [Brucella ceti M644/93/1]
 gi|254717709|ref|ZP_05179520.1| OmpA family protein [Brucella ceti M13/05/1]
 gi|256031769|ref|ZP_05445383.1| OmpA family protein [Brucella pinnipedialis M292/94/1]
 gi|256044854|ref|ZP_05447758.1| OmpA family protein [Brucella melitensis bv. 1 str. Rev.1]
 gi|256061284|ref|ZP_05451434.1| OmpA family protein [Brucella neotomae 5K33]
 gi|256113758|ref|ZP_05454562.1| OmpA family protein [Brucella melitensis bv. 3 str. Ether]
 gi|256159939|ref|ZP_05457657.1| OmpA family protein [Brucella ceti M490/95/1]
 gi|256255170|ref|ZP_05460706.1| OmpA family protein [Brucella ceti B1/94]
 gi|256369628|ref|YP_003107138.1| OmpA family protein [Brucella microti CCM 4915]
 gi|260168903|ref|ZP_05755714.1| OmpA family protein [Brucella sp. F5/99]
 gi|260565544|ref|ZP_05836028.1| bacterial outer membrane protein [Brucella melitensis bv. 1 str.
           16M]
 gi|260566267|ref|ZP_05836737.1| bacterial outer membrane protein [Brucella suis bv. 4 str. 40]
 gi|261219551|ref|ZP_05933832.1| OmpA/MotB domain-containing protein [Brucella ceti M13/05/1]
 gi|261314075|ref|ZP_05953272.1| OmpA/MotB domain-containing protein [Brucella pinnipedialis
           M163/99/10]
 gi|261317837|ref|ZP_05957034.1| OmpA/MotB domain-containing protein [Brucella pinnipedialis B2/94]
 gi|261322046|ref|ZP_05961243.1| OmpA/MotB domain-containing protein [Brucella ceti M644/93/1]
 gi|261752512|ref|ZP_05996221.1| OmpA/MotB domain-containing protein [Brucella suis bv. 5 str. 513]
 gi|261755171|ref|ZP_05998880.1| OmpA/MotB domain-containing protein [Brucella suis bv. 3 str. 686]
 gi|261758395|ref|ZP_06002104.1| bacterial outer membrane protein [Brucella sp. F5/99]
 gi|306840330|ref|ZP_07473102.1| OmpA family protein [Brucella sp. BO2]
 gi|306844105|ref|ZP_07476699.1| OmpA family protein [Brucella sp. BO1]
 gi|23348039|gb|AAN30123.1| OmpA family protein [Brucella suis 1330]
 gi|161335970|gb|ABX62275.1| OmpA/MotB domain protein [Brucella canis ATCC 23365]
 gi|163674192|gb|ABY38303.1| OmpA/MotB domain protein [Brucella suis ATCC 23445]
 gi|225641065|gb|ACO00979.1| OmpA/MotB domain protein [Brucella melitensis ATCC 23457]
 gi|255999790|gb|ACU48189.1| OmpA family protein [Brucella microti CCM 4915]
 gi|260151612|gb|EEW86706.1| bacterial outer membrane protein [Brucella melitensis bv. 1 str.
           16M]
 gi|260155785|gb|EEW90865.1| bacterial outer membrane protein [Brucella suis bv. 4 str. 40]
 gi|260924640|gb|EEX91208.1| OmpA/MotB domain-containing protein [Brucella ceti M13/05/1]
 gi|261294736|gb|EEX98232.1| OmpA/MotB domain-containing protein [Brucella ceti M644/93/1]
 gi|261297060|gb|EEY00557.1| OmpA/MotB domain-containing protein [Brucella pinnipedialis B2/94]
 gi|261303101|gb|EEY06598.1| OmpA/MotB domain-containing protein [Brucella pinnipedialis
           M163/99/10]
 gi|261738379|gb|EEY26375.1| bacterial outer membrane protein [Brucella sp. F5/99]
 gi|261742265|gb|EEY30191.1| OmpA/MotB domain-containing protein [Brucella suis bv. 5 str. 513]
 gi|261744924|gb|EEY32850.1| OmpA/MotB domain-containing protein [Brucella suis bv. 3 str. 686]
 gi|306275548|gb|EFM57280.1| OmpA family protein [Brucella sp. BO1]
 gi|306289729|gb|EFM60918.1| OmpA family protein [Brucella sp. BO2]
          Length = 220

 Score =  100 bits (250), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 53/139 (38%), Positives = 81/139 (58%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D+ E E + QLQ TG+ V+R GD I   +P +++F   +  ++ +F P L  +A +L K
Sbjct: 79  MDRQEAELRAQLQGTGVSVTRNGDRIILNMPSNITFDTDQDQVKSQFYPTLNSVAIVLRK 138

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           F  T++ +   TDS G+   N  +SQ RA  + SYL  +G+   RF +V G+    PI +
Sbjct: 139 FDKTLVDVYGFTDSTGSASYNQALSQRRAASVASYLDSQGIDPRRF-AVIGYGASQPIAS 197

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T  GR  N+R+EIQI P
Sbjct: 198 NATPEGRAQNRRVEIQISP 216


>gi|17987069|ref|NP_539703.1| outer membrane protein [Brucella melitensis bv. 1 str. 16M]
 gi|261222366|ref|ZP_05936647.1| OmpA/MotB domain-containing protein [Brucella ceti B1/94]
 gi|261325291|ref|ZP_05964488.1| OmpA/MotB domain-containing protein [Brucella neotomae 5K33]
 gi|265988867|ref|ZP_06101424.1| OmpA/MotB domain-containing protein [Brucella pinnipedialis
           M292/94/1]
 gi|265991281|ref|ZP_06103838.1| OmpA/MotB domain-containing protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|265995118|ref|ZP_06107675.1| OmpA/MotB domain-containing protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|265998331|ref|ZP_06110888.1| OmpA/MotB domain-containing protein [Brucella ceti M490/95/1]
 gi|265999432|ref|ZP_05466341.2| bacterial outer membrane protein [Brucella melitensis bv. 2 str.
           63/9]
 gi|17982726|gb|AAL51967.1| outer membrane protein [Brucella melitensis bv. 1 str. 16M]
 gi|260920950|gb|EEX87603.1| OmpA/MotB domain-containing protein [Brucella ceti B1/94]
 gi|261301271|gb|EEY04768.1| OmpA/MotB domain-containing protein [Brucella neotomae 5K33]
 gi|262552799|gb|EEZ08789.1| OmpA/MotB domain-containing protein [Brucella ceti M490/95/1]
 gi|262766231|gb|EEZ12020.1| OmpA/MotB domain-containing protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|263002065|gb|EEZ14640.1| OmpA/MotB domain-containing protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|263093937|gb|EEZ17871.1| bacterial outer membrane protein [Brucella melitensis bv. 2 str.
           63/9]
 gi|264661064|gb|EEZ31325.1| OmpA/MotB domain-containing protein [Brucella pinnipedialis
           M292/94/1]
 gi|326409224|gb|ADZ66289.1| OmpA/MotB domain-containing protein [Brucella melitensis M28]
 gi|326538933|gb|ADZ87148.1| OmpA/MotB domain protein [Brucella melitensis M5-90]
          Length = 232

 Score =  100 bits (250), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 53/139 (38%), Positives = 81/139 (58%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D+ E E + QLQ TG+ V+R GD I   +P +++F   +  ++ +F P L  +A +L K
Sbjct: 91  MDRQEAELRAQLQGTGVSVTRNGDRIILNMPSNITFDTDQDQVKSQFYPTLNSVAIVLRK 150

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           F  T++ +   TDS G+   N  +SQ RA  + SYL  +G+   RF +V G+    PI +
Sbjct: 151 FDKTLVDVYGFTDSTGSASYNQALSQRRAASVASYLDSQGIDPRRF-AVIGYGASQPIAS 209

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T  GR  N+R+EIQI P
Sbjct: 210 NATPEGRAQNRRVEIQISP 228


>gi|294852539|ref|ZP_06793212.1| outer membrane protein [Brucella sp. NVSL 07-0026]
 gi|294821128|gb|EFG38127.1| outer membrane protein [Brucella sp. NVSL 07-0026]
          Length = 258

 Score =  100 bits (250), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 53/139 (38%), Positives = 81/139 (58%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D+ E E + QLQ TG+ V+R GD I   +P +++F   +  ++ +F P L  +A +L K
Sbjct: 91  MDRQEAELRAQLQGTGVSVTRNGDRIILNMPSNITFDTDQDQVKSQFYPTLNSVAIVLRK 150

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           F  T++ +   TDS G+   N  +SQ RA  + SYL  +G+   RF +V G+    PI +
Sbjct: 151 FDKTLVDVYGFTDSTGSASYNQALSQRRAASVASYLDSQGIDPRRF-AVIGYGASQPIAS 209

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T  GR  N+R+EIQI P
Sbjct: 210 NATPEGRAQNRRVEIQISP 228


>gi|260883956|ref|ZP_05895570.1| OmpA/MotB domain-containing protein [Brucella abortus bv. 9 str.
           C68]
 gi|297248510|ref|ZP_06932228.1| outer membrane protein [Brucella abortus bv. 5 str. B3196]
 gi|260873484|gb|EEX80553.1| OmpA/MotB domain-containing protein [Brucella abortus bv. 9 str.
           C68]
 gi|297175679|gb|EFH35026.1| outer membrane protein [Brucella abortus bv. 5 str. B3196]
          Length = 232

 Score =  100 bits (250), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 54/139 (38%), Positives = 81/139 (58%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D+ E E + QLQ TG+ V+R GD I   +P +++F   +  ++ +F P L  +A +L K
Sbjct: 91  MDRQEAELRAQLQGTGVSVTRNGDRIILNMPSNITFDTDQDQVKSQFYPTLNSVAIVLRK 150

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           F  T++ +   TDS G+   N  +SQ RA  + SYL  +G+   RF SV G+    PI +
Sbjct: 151 FDKTLVDVYGFTDSTGSASYNQALSQRRAASVASYLDSQGIDPRRF-SVIGYGASQPIVS 209

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T  GR  N+R+EIQI P
Sbjct: 210 NATPEGRAQNRRVEIQISP 228


>gi|225627675|ref|ZP_03785712.1| OmpA family protein [Brucella ceti str. Cudo]
 gi|225617680|gb|EEH14725.1| OmpA family protein [Brucella ceti str. Cudo]
          Length = 243

 Score =  100 bits (250), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 55/142 (38%), Positives = 83/142 (58%), Gaps = 3/142 (2%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D+ E E + QLQ TG+ V+R GD I   +P +++F   +  ++ +F P L  +A +L K
Sbjct: 102 MDRQEAELRAQLQGTGVSVTRNGDRIILNMPSNITFDTDQDQVKSQFYPTLNSVAIVLRK 161

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           F  T++ +   TDS G+   N  +SQ RA  + SYL  +G+   RF +V G+    PI +
Sbjct: 162 FDKTLVDVYGFTDSTGSASYNQALSQRRAASVASYLDSQGIDPRRF-AVIGYGASQPIAS 220

Query: 166 NDTKVGRQNNQRIEIQIFP-RG 186
           N T  GR  N+R+EIQI P RG
Sbjct: 221 NATPEGRAQNRRVEIQISPLRG 242


>gi|315497454|ref|YP_004086258.1| ompa/motb domain protein [Asticcacaulis excentricus CB 48]
 gi|315415466|gb|ADU12107.1| OmpA/MotB domain protein [Asticcacaulis excentricus CB 48]
          Length = 222

 Score =  100 bits (250), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 53/139 (38%), Positives = 80/139 (57%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVS-EVFLEKKFLPMLQLIATILNK 105
           +DK + E + +L  T + V+R GD I   +P  V+F S    ++  F P+L  +A+ILNK
Sbjct: 82  MDKQQAELRRELAGTNVTVTRNGDNIILNMPSDVTFGSGSASIDASFYPVLNDVASILNK 141

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +PST + I  H DS G+   N  +S++RA+   +YL  RGV + R   V G   + PI +
Sbjct: 142 YPSTYVDIVGHADSTGSDAINEPLSEDRANSTAAYLTSRGVVNQRLF-VAGMGSRQPIAS 200

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T  GR  N+R+EI + P
Sbjct: 201 NATPEGRAKNRRVEITLRP 219


>gi|148559799|ref|YP_001259124.1| OmpA family protein [Brucella ovis ATCC 25840]
 gi|148371056|gb|ABQ61035.1| OmpA family protein [Brucella ovis ATCC 25840]
          Length = 243

 Score =  100 bits (250), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 53/139 (38%), Positives = 81/139 (58%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D+ E E + QLQ TG+ V+R GD I   +P +++F   +  ++ +F P L  +A +L K
Sbjct: 102 MDRQEAELRAQLQGTGVSVTRNGDRIILNMPSNITFDTDQDQVKSQFYPTLNSVAIVLRK 161

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           F  T++ +   TDS G+   N  +SQ RA  + SYL  +G+   RF +V G+    PI +
Sbjct: 162 FDKTLVDVYGFTDSTGSASYNQALSQRRAASVASYLDSQGIDPRRF-AVIGYGASQPIAS 220

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T  GR  N+R+EIQI P
Sbjct: 221 NATPEGRAQNRRVEIQISP 239


>gi|237815623|ref|ZP_04594620.1| OmpA family protein [Brucella abortus str. 2308 A]
 gi|237788921|gb|EEP63132.1| OmpA family protein [Brucella abortus str. 2308 A]
          Length = 243

 Score =  100 bits (249), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 56/142 (39%), Positives = 83/142 (58%), Gaps = 3/142 (2%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D+ E E + QLQ TG+ V+R GD I   +P +++F   +  ++ +F P L  +A +L K
Sbjct: 102 MDRQEAELRAQLQGTGVSVTRNGDRIILNMPSNITFDTDQDQVKSQFYPTLNSVAIVLRK 161

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           F  T++ +   TDS G+   N  +SQ RA  + SYL  +G+   RF SV G+    PI +
Sbjct: 162 FDKTLVDVYGFTDSTGSASYNQALSQRRAASVASYLDSQGIDPRRF-SVIGYGASQPIVS 220

Query: 166 NDTKVGRQNNQRIEIQIFP-RG 186
           N T  GR  N+R+EIQI P RG
Sbjct: 221 NATPEGRAQNRRVEIQISPLRG 242


>gi|110633615|ref|YP_673823.1| OmpA/MotB [Mesorhizobium sp. BNC1]
 gi|110284599|gb|ABG62658.1| OmpA/MotB [Chelativorans sp. BNC1]
          Length = 217

 Score =  100 bits (249), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 50/139 (35%), Positives = 84/139 (60%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSE-VFLEKKFLPMLQLIATILNK 105
           +D+ E + + QLQ TG+ V+R GD I   +P +++F ++   ++  F   L  +A +L +
Sbjct: 76  MDQQEAQLRAQLQGTGVSVTRQGDYIILNMPSNITFATDSADIQPAFYQTLNSVALVLKR 135

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +  T++ +  HTDS G+L++N+ +SQ RA  +  YLI +G  S RF +V G     PI +
Sbjct: 136 YNQTLVDVYGHTDSTGSLQHNMQLSQRRAASVADYLIAQGTDSRRF-AVIGQGPSQPIAS 194

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T  GR  N+R+EI++ P
Sbjct: 195 NATPEGRAQNRRVEIRLAP 213


>gi|220933311|ref|YP_002512210.1| OmpA/MotB domain protein [Thioalkalivibrio sp. HL-EbGR7]
 gi|219994621|gb|ACL71223.1| OmpA/MotB domain protein [Thioalkalivibrio sp. HL-EbGR7]
          Length = 218

 Score =  100 bits (249), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 48/139 (34%), Positives = 86/139 (61%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D+ E E + +L+ TG+ V+R GD +   +P +++F V+   ++ +F P+L  +A +L K
Sbjct: 79  MDQQEAELRRELEGTGVSVTRDGDNLILNMPGNITFDVNRDEVKSEFYPVLNSVAKVLKK 138

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +  T I +  HTDS GT+++N+ +S  RAD +  YL+ +G+ + R  ++ GF    PI  
Sbjct: 139 YDKTAIEVAGHTDSTGTVEHNMALSLRRADSVAGYLLGQGIQNVRIATI-GFGPHRPIAD 197

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N+T  GR  N+R+E+ + P
Sbjct: 198 NNTAQGRSLNRRVELTLIP 216


>gi|253582681|ref|ZP_04859902.1| outer membrane protein [Fusobacterium varium ATCC 27725]
 gi|251835551|gb|EES64091.1| outer membrane protein [Fusobacterium varium ATCC 27725]
          Length = 216

 Score =  100 bits (249), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 51/143 (35%), Positives = 89/143 (62%), Gaps = 2/143 (1%)

Query: 43  FGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVF-LEKKFLPMLQLIAT 101
           +G+  D+ E E + +L++T + VS+ GD +   +P  V+F ++   +   F   L  IAT
Sbjct: 73  WGAYRDRQEQELRERLKNTEVQVSQKGDNLNLNLPGGVTFATDSSNIVPSFYGPLNSIAT 132

Query: 102 ILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKY 161
           +L ++P T I +  +TD++G+   N+ +S++RA  +++YLIQ+GVS+ R IS  G+  + 
Sbjct: 133 VLVQYPETRIIVNGYTDNVGSASYNITLSEKRAASVRNYLIQQGVSARR-ISYVGYGMEN 191

Query: 162 PIDTNDTKVGRQNNQRIEIQIFP 184
           P  TN T  GR  N+R+E++I P
Sbjct: 192 PRATNSTAAGRAENRRVELEILP 214


>gi|257470656|ref|ZP_05634746.1| Outer membrane protein [Fusobacterium ulcerans ATCC 49185]
          Length = 217

 Score =  100 bits (248), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 52/146 (35%), Positives = 89/146 (60%), Gaps = 2/146 (1%)

Query: 43  FGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVF-LEKKFLPMLQLIAT 101
           +G+  D+ E E + +L++T + VS+ GD +   +P  V+F ++   +   F   L  IAT
Sbjct: 73  WGAYRDRQEQELRERLKNTEVQVSQNGDNLNLNLPGGVTFATDSSNIVSSFYGPLNSIAT 132

Query: 102 ILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKY 161
           +L ++P T I +  +TD++G+   N+ +S+ RA  +++YLIQ+GVS+ R IS  G+  + 
Sbjct: 133 VLVQYPETRIIVNGYTDNVGSASYNVSLSERRAASVRNYLIQQGVSARR-ISYVGYGMEN 191

Query: 162 PIDTNDTKVGRQNNQRIEIQIFPRGN 187
           P  TN T  GR  N+R+E++I P  N
Sbjct: 192 PRATNSTAAGRAENRRVELEILPMSN 217


>gi|149377133|ref|ZP_01894882.1| Outer membrane protein and related peptidoglycan-associated
           (lipo)protein [Marinobacter algicola DG893]
 gi|149358551|gb|EDM47024.1| Outer membrane protein and related peptidoglycan-associated
           (lipo)protein [Marinobacter algicola DG893]
          Length = 222

 Score =  100 bits (248), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 47/139 (33%), Positives = 87/139 (62%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +DK E + + +L+ +G+ V R GD I   +P +++F V++  ++  F   L+ +A +L +
Sbjct: 83  MDKQEAQLRRKLEGSGVRVVRNGDEIELVMPGNITFDVNQSSIKPSFSNTLESVALVLKE 142

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           F  T+I I+ HTDS G+   N L+S+ RA  ++ +L+ +G+   R  +  G+  +YPI +
Sbjct: 143 FDKTIIQIEGHTDSTGSRDYNQLLSERRAGSVRDFLLNQGIEPKRTRAT-GYGPRYPIAS 201

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           NDT+ GR+ N+R+E+ + P
Sbjct: 202 NDTESGREQNRRVELTLVP 220


>gi|317064862|ref|ZP_07929347.1| outer membrane protein [Fusobacterium ulcerans ATCC 49185]
 gi|313690538|gb|EFS27373.1| outer membrane protein [Fusobacterium ulcerans ATCC 49185]
          Length = 211

 Score =  100 bits (248), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 52/146 (35%), Positives = 89/146 (60%), Gaps = 2/146 (1%)

Query: 43  FGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVF-LEKKFLPMLQLIAT 101
           +G+  D+ E E + +L++T + VS+ GD +   +P  V+F ++   +   F   L  IAT
Sbjct: 67  WGAYRDRQEQELRERLKNTEVQVSQNGDNLNLNLPGGVTFATDSSNIVSSFYGPLNSIAT 126

Query: 102 ILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKY 161
           +L ++P T I +  +TD++G+   N+ +S+ RA  +++YLIQ+GVS+ R IS  G+  + 
Sbjct: 127 VLVQYPETRIIVNGYTDNVGSASYNVSLSERRAASVRNYLIQQGVSARR-ISYVGYGMEN 185

Query: 162 PIDTNDTKVGRQNNQRIEIQIFPRGN 187
           P  TN T  GR  N+R+E++I P  N
Sbjct: 186 PRATNSTAAGRAENRRVELEILPMSN 211


>gi|261252822|ref|ZP_05945395.1| outer membrane protein [Vibrio orientalis CIP 102891]
 gi|260936213|gb|EEX92202.1| outer membrane protein [Vibrio orientalis CIP 102891]
          Length = 222

 Score =  100 bits (248), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 51/139 (36%), Positives = 84/139 (60%), Gaps = 3/139 (2%)

Query: 48  DKAEDEFQMQLQDTGIVVSRIGD-MITCYIPVHVSFVSEVF-LEKKFLPMLQLIATILNK 105
           D+ E   + +L D+G+ V R+G+  +   +   + F S  + L+      L+ +A IL +
Sbjct: 83  DQQEAALRKELLDSGVQVERVGENQLMLRLENGIGFQSSSYALDPSIHNTLRGVARILVE 142

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +P T + I  HTDS G+   N ++S+ RA+ ++SYL+ +GV++ R ++ RG   +YPI T
Sbjct: 143 YPDTSLVIDGHTDSTGSDTTNQVLSERRAESVRSYLVSQGVAAGRAVA-RGNGERYPICT 201

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           NDT  GR  N+R+EIQI P
Sbjct: 202 NDTTTGRACNRRVEIQILP 220


>gi|149909453|ref|ZP_01898108.1| outer membrane protein [Moritella sp. PE36]
 gi|149807563|gb|EDM67512.1| outer membrane protein [Moritella sp. PE36]
          Length = 214

 Score =  100 bits (248), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 49/137 (35%), Positives = 84/137 (61%), Gaps = 3/137 (2%)

Query: 48  DKAEDEFQMQLQDTGIVVSRIGD-MITCYIPVHVSFVSEVF-LEKKFLPMLQLIATILNK 105
           D+ E+E + +L  +G+ V R+G+  +   +   + F +  + L       L  +A ILN+
Sbjct: 76  DRQEEELRQELIGSGVQVKRVGENELQLIMAKGIGFQTAGYNLSGDIYSSLNSVAKILNE 135

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +P + + I  HTDS+G+ ++NL +S+ERA+ +  YL +RG+ S R +S RG+  + PI +
Sbjct: 136 YPKSSLRIVGHTDSVGSAQSNLTLSEERAESVSEYLNKRGIKSGR-LSTRGYGERRPIAS 194

Query: 166 NDTKVGRQNNQRIEIQI 182
           N+TK GR  N+R+EI I
Sbjct: 195 NETKSGRAANRRVEISI 211


>gi|120555732|ref|YP_960083.1| OmpA/MotB domain-containing protein [Marinobacter aquaeolei VT8]
 gi|120325581|gb|ABM19896.1| OmpA/MotB domain protein [Marinobacter aquaeolei VT8]
          Length = 236

 Score = 99.8 bits (247), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 46/139 (33%), Positives = 83/139 (59%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D+ E + + +L+ TG+ V R GD I   +P +++F   +  +   F   L+ +A +L +
Sbjct: 97  MDRQEAQLRQKLEGTGVRVVRNGDQIDLIMPGNITFDTDQSTIRSGFTGTLESVALVLKE 156

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           F  T+I I+ HTDS G+   N L+S+ RA  ++ +L+ +G+   R  +  G+  +YPI +
Sbjct: 157 FDKTIIQIEGHTDSTGSDSYNQLLSERRASSVRDFLLNQGIEPRRTRAT-GYGERYPIAS 215

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           NDT  GR+ N+R+E+ + P
Sbjct: 216 NDTAAGREQNRRVELTLVP 234


>gi|150398661|ref|YP_001329128.1| OmpA/MotB domain-containing protein [Sinorhizobium medicae WSM419]
 gi|150030176|gb|ABR62293.1| OmpA/MotB domain protein [Sinorhizobium medicae WSM419]
          Length = 221

 Score = 99.4 bits (246), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 50/139 (35%), Positives = 81/139 (58%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEV-FLEKKFLPMLQLIATILNK 105
           +D+ E E + QLQ TG+ V+R GD I   +P +++F ++   +   F   L  +A +L K
Sbjct: 80  MDQQESELRAQLQGTGVSVTRAGDRIILNMPSNITFATDRDQVIPAFYSTLDSVAIVLRK 139

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           F  T+I +  HTDS G+   N  +S+ RA  + +YL  RGV   R  +V G+  + P+ +
Sbjct: 140 FSKTLIDVDGHTDSTGSASYNQGLSERRAASVANYLASRGVDQRRMSAV-GYGMERPVAS 198

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N +++GR  N+R+EI I P
Sbjct: 199 NASEIGRVQNRRVEISIAP 217


>gi|325294095|ref|YP_004279959.1| porin [Agrobacterium sp. H13-3]
 gi|325061948|gb|ADY65639.1| porin [Agrobacterium sp. H13-3]
          Length = 220

 Score = 99.4 bits (246), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 55/142 (38%), Positives = 82/142 (57%), Gaps = 8/142 (5%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLP----MLQLIATI 102
           +D  E E + QLQ TG+ V+R GD I   +P +++F ++   + + +P     L  +A +
Sbjct: 80  MDGQESELRAQLQGTGVSVTRRGDSIVLNMPSNITFATD---QDQVIPPFYQTLDSVAIV 136

Query: 103 LNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYP 162
           LNKF  T+I I  HTDS G+ ++N  +S+ RA  + +YL  RGV   R IS  GF    P
Sbjct: 137 LNKFNRTLIDINGHTDSTGSQQHNQALSERRAASVANYLGARGVDQRR-ISTLGFGPSQP 195

Query: 163 IDTNDTKVGRQNNQRIEIQIFP 184
           I +N T  GR  N+R+E+ I P
Sbjct: 196 IASNATPDGRAQNRRVEVLISP 217


>gi|254302883|ref|ZP_04970241.1| possible outer membrane protein [Fusobacterium nucleatum subsp.
           polymorphum ATCC 10953]
 gi|148323075|gb|EDK88325.1| possible outer membrane protein [Fusobacterium nucleatum subsp.
           polymorphum ATCC 10953]
          Length = 212

 Score = 99.4 bits (246), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 52/143 (36%), Positives = 80/143 (55%), Gaps = 2/143 (1%)

Query: 43  FGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSE-VFLEKKFLPMLQLIAT 101
           +G+  D  E E + +LQ T   V + G+ +   +P  V+F S+   +   F   L  IA 
Sbjct: 69  WGAYRDNQEKELKAKLQGTQAEVKKDGNALVINLPGGVTFASDSANITSSFYSALNGIAQ 128

Query: 102 ILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKY 161
            LN +P T I +  +TDS G   +N  +SQ RA+ +  YL+ +GVSS+R ++  GF    
Sbjct: 129 SLNNYPETRIQVNGYTDSTGNDAHNQELSQRRANAVAQYLVAQGVSSSRIVA-NGFGSSN 187

Query: 162 PIDTNDTKVGRQNNQRIEIQIFP 184
           PI +N T+ GR  N+R+EI+I P
Sbjct: 188 PIASNSTQEGRLQNRRVEIKILP 210


>gi|254428835|ref|ZP_05042542.1| Rickettsia 17 kDa surface antigen family [Alcanivorax sp. DG881]
 gi|196195004|gb|EDX89963.1| Rickettsia 17 kDa surface antigen family [Alcanivorax sp. DG881]
          Length = 221

 Score = 99.4 bits (246), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 51/165 (30%), Positives = 95/165 (57%), Gaps = 2/165 (1%)

Query: 21  ASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHV 80
           +++E+K+  L  +    +     G  +D  E + + +L+  G+ V+R G+ I   +P ++
Sbjct: 55  SAKERKERALAGAGIGAVTGGGVGYYMDVQEAKLRQKLEGAGVSVTRDGENIILNMPGNL 114

Query: 81  SFVSE-VFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKS 139
           +F ++   ++  F P+L  ++ +LN++ ST+I +  HTDS G  + NLL+SQ+RA  + +
Sbjct: 115 TFATDSTNVKSSFDPVLDAVSEVLNEYKSTMIQVAGHTDSTGGDRYNLLLSQQRAQAVSN 174

Query: 140 YLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
            L   GV   R  +V GF    PI +N+T  GR+ N+R+E+ + P
Sbjct: 175 KLSGYGVEQVRLDTV-GFGETQPIASNNTASGREQNRRVELTLLP 218


>gi|197106951|ref|YP_002132328.1| OmpA family protein [Phenylobacterium zucineum HLK1]
 gi|196480371|gb|ACG79899.1| OmpA family protein [Phenylobacterium zucineum HLK1]
          Length = 221

 Score = 99.4 bits (246), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 49/139 (35%), Positives = 80/139 (57%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D+ + E + +L  +G+ V R GD I   +P  V+F V +  ++ +F P+L  IA  L++
Sbjct: 81  MDRQQAELRRELAGSGVEVERRGDDIVLNMPSDVTFGVDQSDVQSRFYPVLDDIAATLSR 140

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +P T+I +  H DS G    N  +S+ RA  + SYL+ RGV  +R   V G+    P+ +
Sbjct: 141 YPQTLIDVAGHADSTGADAYNQALSERRASSVASYLVSRGVLQDRLYVV-GYGESRPVAS 199

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T+ GR  N+R+EI + P
Sbjct: 200 NATEQGRAQNRRVEITVRP 218


>gi|114800290|ref|YP_762003.1| OmpA family protein [Hyphomonas neptunium ATCC 15444]
 gi|114740464|gb|ABI78589.1| OmpA family protein [Hyphomonas neptunium ATCC 15444]
          Length = 211

 Score = 99.0 bits (245), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 51/139 (36%), Positives = 76/139 (54%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV-SEVFLEKKFLPMLQLIATILNK 105
           +D+ E++ + Q   TGI V R GD I   +P  +SF      ++  F   L  +A  LN+
Sbjct: 71  MDRQEEKLRQQTAGTGIEVERQGDQIALTMPSGISFQQGSAQIQPAFYQTLNDVAATLNE 130

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +PST + I+ H  S G    N  +SQ+RAD ++SYL  +GV   R  +V G    YP+  
Sbjct: 131 YPSTAVDIRGHASSEGARDFNQRLSQQRADAVRSYLTNQGVQGVRMSAV-GMGIDYPVAD 189

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T+ GR  N+R+EI + P
Sbjct: 190 NSTEAGRSQNRRVEIILTP 208


>gi|329847657|ref|ZP_08262685.1| inner membrane lipoprotein yiaD [Asticcacaulis biprosthecum C19]
 gi|328842720|gb|EGF92289.1| inner membrane lipoprotein yiaD [Asticcacaulis biprosthecum C19]
          Length = 208

 Score = 99.0 bits (245), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 53/139 (38%), Positives = 80/139 (57%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVS-EVFLEKKFLPMLQLIATILNK 105
           +D+   + + +L+   + V+R GD I   +P  V+F S    L   F+P+L  +ATILN+
Sbjct: 68  MDRQNKDLRSELEGRNVYVTRSGDNIILSMPGDVTFSSGSADLNGGFMPVLNDVATILNQ 127

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +PST I +  H DS GT   N+ +S+ RA+ +  YL+ + V S R I V G     PI +
Sbjct: 128 YPSTYIDVVGHADSQGTDAFNMDLSERRANAVAGYLVGQKVKSER-IYVAGAGESSPIAS 186

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           NDT  GR  N+R+EI + P
Sbjct: 187 NDTADGRARNRRVEITLRP 205


>gi|254719262|ref|ZP_05181073.1| OmpA family protein [Brucella sp. 83/13]
 gi|265984261|ref|ZP_06096996.1| OmpA/MotB domain-containing protein [Brucella sp. 83/13]
 gi|306838013|ref|ZP_07470871.1| OmpA family protein [Brucella sp. NF 2653]
 gi|264662853|gb|EEZ33114.1| OmpA/MotB domain-containing protein [Brucella sp. 83/13]
 gi|306406937|gb|EFM63158.1| OmpA family protein [Brucella sp. NF 2653]
          Length = 220

 Score = 98.6 bits (244), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 52/139 (37%), Positives = 80/139 (57%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D+ E E + Q Q TG+ V+R GD I   +P +++F   +  ++ +F P L  +A +L K
Sbjct: 79  MDRQEAELRAQSQGTGVSVTRNGDRIILNMPSNITFDTDQDQVKSQFYPTLNSVAIVLRK 138

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           F  T++ +   TDS G+   N  +SQ RA  + SYL  +G+   RF +V G+    PI +
Sbjct: 139 FDKTLVDVYGFTDSTGSASYNQALSQRRAASVASYLDSQGIDPRRF-AVIGYGASQPIAS 197

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T  GR  N+R+EIQI P
Sbjct: 198 NATPEGRAQNRRVEIQISP 216


>gi|296329053|ref|ZP_06871559.1| proteobacterial sortase system OmpA family protein [Fusobacterium
           nucleatum subsp. nucleatum ATCC 23726]
 gi|296153857|gb|EFG94669.1| proteobacterial sortase system OmpA family protein [Fusobacterium
           nucleatum subsp. nucleatum ATCC 23726]
          Length = 208

 Score = 98.6 bits (244), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 53/143 (37%), Positives = 79/143 (55%), Gaps = 2/143 (1%)

Query: 43  FGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSE-VFLEKKFLPMLQLIAT 101
           +G+  D  E E + +LQ T   V + G+ +   +P  V+F S+   +   F   L  IA 
Sbjct: 65  WGAYRDNQERELKAKLQGTQAQVRKDGNALVINLPGGVTFASDSANITSGFYSALNGIAQ 124

Query: 102 ILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKY 161
            LN +P T I +  +TD+ G   +N  +SQ RA+ +  YLI +GVSSNR ++  GF    
Sbjct: 125 SLNNYPETRIQVNGYTDNTGKDAHNQELSQRRANAVAQYLIAQGVSSNRIVA-NGFGSSN 183

Query: 162 PIDTNDTKVGRQNNQRIEIQIFP 184
           PI +N T  GR  N+R+EI+I P
Sbjct: 184 PIASNSTPEGRLQNRRVEIKILP 206


>gi|19704600|ref|NP_604162.1| Outer membrane protein [Fusobacterium nucleatum subsp. nucleatum
           ATCC 25586]
 gi|19714896|gb|AAL95461.1| Outer membrane protein [Fusobacterium nucleatum subsp. nucleatum
           ATCC 25586]
          Length = 202

 Score = 98.6 bits (244), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 53/143 (37%), Positives = 79/143 (55%), Gaps = 2/143 (1%)

Query: 43  FGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSE-VFLEKKFLPMLQLIAT 101
           +G+  D  E E + +LQ T   V + G+ +   +P  V+F S+   +   F   L  IA 
Sbjct: 59  WGAYRDNQERELKAKLQGTQAQVRKDGNALVINLPGGVTFASDSANITSGFYSALNGIAQ 118

Query: 102 ILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKY 161
            LN +P T I +  +TD+ G   +N  +SQ RA+ +  YLI +GVSSNR ++  GF    
Sbjct: 119 SLNNYPETRIQVNGYTDNTGKDAHNQELSQRRANAVAQYLIAQGVSSNRIVA-NGFGSSN 177

Query: 162 PIDTNDTKVGRQNNQRIEIQIFP 184
           PI +N T  GR  N+R+EI+I P
Sbjct: 178 PIASNSTPEGRLQNRRVEIKILP 200


>gi|260460699|ref|ZP_05808949.1| OmpA/MotB domain protein [Mesorhizobium opportunistum WSM2075]
 gi|259033276|gb|EEW34537.1| OmpA/MotB domain protein [Mesorhizobium opportunistum WSM2075]
          Length = 216

 Score = 98.6 bits (244), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 52/140 (37%), Positives = 82/140 (58%), Gaps = 2/140 (1%)

Query: 46  SLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEV-FLEKKFLPMLQLIATILN 104
           ++D+ E E + QL+ TG+ V+R GD I   +P  ++F S+   ++  F  +L  +A +L 
Sbjct: 76  TMDQNEAELRRQLEGTGVSVTRSGDQIILNMPSDITFNSDQDAVKPGFYQVLNSVALVLK 135

Query: 105 KFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPID 164
           KF  T + +  HTDS G  ++N  +SQ RA  + +YL  +GV   RF +V GF    P+ 
Sbjct: 136 KFKQTTVDVFGHTDSTGGDQHNFDLSQRRALAVANYLAGQGVDQRRF-AVTGFGKTRPVA 194

Query: 165 TNDTKVGRQNNQRIEIQIFP 184
           +N T  GR  N+R+EIQ+ P
Sbjct: 195 SNATSEGRAQNRRVEIQLSP 214


>gi|237742260|ref|ZP_04572741.1| outer membrane protein [Fusobacterium sp. 4_1_13]
 gi|256845531|ref|ZP_05550989.1| type VI secretion system OmpA/MotB [Fusobacterium sp. 3_1_36A2]
 gi|294785172|ref|ZP_06750460.1| OmpA family protein [Fusobacterium sp. 3_1_27]
 gi|229429908|gb|EEO40120.1| outer membrane protein [Fusobacterium sp. 4_1_13]
 gi|256719090|gb|EEU32645.1| type VI secretion system OmpA/MotB [Fusobacterium sp. 3_1_36A2]
 gi|294486886|gb|EFG34248.1| OmpA family protein [Fusobacterium sp. 3_1_27]
          Length = 212

 Score = 98.2 bits (243), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 51/143 (35%), Positives = 80/143 (55%), Gaps = 2/143 (1%)

Query: 43  FGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSE-VFLEKKFLPMLQLIAT 101
           +G+  D  E E + +LQ T   V + G+ +   +P  V+F S+   +   F   L  IA 
Sbjct: 69  WGAYRDNQERELKAKLQGTQAQVRKDGNALVINLPGGVTFASDSANISSGFYSALNGIAQ 128

Query: 102 ILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKY 161
            LN +P T I +  +TD+ G   +N  +SQ RA+ +  YLI +GV+SNR ++  GF    
Sbjct: 129 SLNNYPETRIQVNGYTDNTGKDAHNQELSQRRANAVAQYLIAQGVASNRIVA-NGFGSSN 187

Query: 162 PIDTNDTKVGRQNNQRIEIQIFP 184
           P+ +N T+ GR  N+R+EI+I P
Sbjct: 188 PVASNSTQEGRLQNRRVEIKILP 210


>gi|88860858|ref|ZP_01135494.1| putative lipoprotein [Pseudoalteromonas tunicata D2]
 gi|88817071|gb|EAR26890.1| putative lipoprotein [Pseudoalteromonas tunicata D2]
          Length = 214

 Score = 98.2 bits (243), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 55/164 (33%), Positives = 93/164 (56%), Gaps = 2/164 (1%)

Query: 22  SREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVS 81
           S  K K  ++ +    I     GS +DK E  F+ +L  +G+ V R GD +   +P +++
Sbjct: 49  SNHKDKRLIYGAAIGAIAGAAVGSYMDKQEQAFRDELAGSGVEVVREGDNLRLVMPSNIT 108

Query: 82  FVS-EVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSY 140
           F + + ++   F   L  IA ++NK+  T ++I+ HTDS G  + N  +S++RA  +K+Y
Sbjct: 109 FATDQSYISTGFHDTLDAIAKVMNKYEKTFLSIEGHTDSTGKTEYNQNLSEQRALSVKNY 168

Query: 141 LIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           L+ + +   R IS +G+    PI +N+T  GR  N+R+EIQI P
Sbjct: 169 LLNKQILDVR-ISTQGWGESRPIASNETSSGRALNRRVEIQIVP 211


>gi|254447788|ref|ZP_05061253.1| OmpA family protein [gamma proteobacterium HTCC5015]
 gi|198262568|gb|EDY86848.1| OmpA family protein [gamma proteobacterium HTCC5015]
          Length = 225

 Score = 98.2 bits (243), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 49/139 (35%), Positives = 84/139 (60%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVF-LEKKFLPMLQLIATILNK 105
           +D+ E + + +L+D+G+ V R GD I   +P +++F ++   +   F  +L  +A +L +
Sbjct: 83  MDRQEAKLREKLRDSGVSVERDGDNINLIMPGNITFQTDSSDVSSSFYNVLDSVAIVLEE 142

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           F  T++A+  HTDS G+   N ++S++RA  + SYL  +GV + RF  V GF    PI  
Sbjct: 143 FDKTIVAVSGHTDSTGSDSYNQVLSEKRASSVASYLKSKGVLNERF-EVIGFGEARPIAD 201

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T+ GR+ N+R+EI + P
Sbjct: 202 NSTESGREQNRRVEITLLP 220


>gi|34763092|ref|ZP_00144063.1| Outer membrane protein [Fusobacterium nucleatum subsp. vincentii
           ATCC 49256]
 gi|27887226|gb|EAA24326.1| Outer membrane protein [Fusobacterium nucleatum subsp. vincentii
           ATCC 49256]
          Length = 202

 Score = 98.2 bits (243), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 51/143 (35%), Positives = 80/143 (55%), Gaps = 2/143 (1%)

Query: 43  FGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSE-VFLEKKFLPMLQLIAT 101
           +G+  D  E E + +LQ T   V + G+ +   +P  V+F S+   +   F   L  IA 
Sbjct: 59  WGAYRDNQERELKAKLQGTQAQVRKDGNALVINLPGGVTFASDSANISSGFYSALNGIAQ 118

Query: 102 ILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKY 161
            LN +P T I +  +TD+ G   +N  +SQ RA+ +  YLI +GV+SNR ++  GF    
Sbjct: 119 SLNNYPETRIQVNGYTDNTGKDAHNQELSQRRANAVAQYLIAQGVASNRIVA-NGFGSSN 177

Query: 162 PIDTNDTKVGRQNNQRIEIQIFP 184
           P+ +N T+ GR  N+R+EI+I P
Sbjct: 178 PVASNSTQEGRLQNRRVEIKILP 200


>gi|319783265|ref|YP_004142741.1| OmpA/MotB domain protein [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
 gi|317169153|gb|ADV12691.1| OmpA/MotB domain protein [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
          Length = 216

 Score = 98.2 bits (243), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 52/140 (37%), Positives = 82/140 (58%), Gaps = 2/140 (1%)

Query: 46  SLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEV-FLEKKFLPMLQLIATILN 104
           ++D+ E E + QL+ TG+ V+R GD I   +P  ++F S+   ++  F  +L  +A +L 
Sbjct: 76  TMDQNEAELRRQLEGTGVSVTRSGDQIILNMPSDITFNSDQDAVKPGFYQVLNSVALVLK 135

Query: 105 KFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPID 164
           KF  T + +  HTDS G  ++N  +SQ RA  + +YL  +GV   RF +V GF    P+ 
Sbjct: 136 KFKQTTVDVFGHTDSTGGDQHNFDLSQRRALAVANYLSGQGVDQRRF-AVTGFGKTRPVA 194

Query: 165 TNDTKVGRQNNQRIEIQIFP 184
           +N T  GR  N+R+EIQ+ P
Sbjct: 195 SNATAEGRAQNRRVEIQLSP 214


>gi|237744199|ref|ZP_04574680.1| outer membrane protein [Fusobacterium sp. 7_1]
 gi|256027684|ref|ZP_05441518.1| Outer membrane protein [Fusobacterium sp. D11]
 gi|260494220|ref|ZP_05814351.1| type VI secretion system OmpA/MotB [Fusobacterium sp. 3_1_33]
 gi|289765644|ref|ZP_06525022.1| outer membrane protein [Fusobacterium sp. D11]
 gi|229431428|gb|EEO41640.1| outer membrane protein [Fusobacterium sp. 7_1]
 gi|260198366|gb|EEW95882.1| type VI secretion system OmpA/MotB [Fusobacterium sp. 3_1_33]
 gi|289717199|gb|EFD81211.1| outer membrane protein [Fusobacterium sp. D11]
          Length = 212

 Score = 97.8 bits (242), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 54/148 (36%), Positives = 81/148 (54%), Gaps = 2/148 (1%)

Query: 38  IVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSE-VFLEKKFLPML 96
           +V   +G+  D  E E + +LQ T   V + G+ +   +P  V+F S+   +   F   L
Sbjct: 64  LVGMGWGAYRDNQERELKAKLQGTQAQVKKEGNALVINLPGGVTFASDSANISSGFYSAL 123

Query: 97  QLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRG 156
             IA  LN +P T I +  +TD+ G   +N  +SQ RA+ +  YLI +GVSS+R I+  G
Sbjct: 124 NGIAQSLNNYPETRIQVNGYTDNTGKDAHNQELSQRRANAVAQYLIAQGVSSSRIIA-NG 182

Query: 157 FAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           F    PI +N T  GR  N+R+EI+I P
Sbjct: 183 FGSSNPIASNSTPDGRLQNRRVEIKILP 210


>gi|192360671|ref|YP_001983282.1| OmpA family protein [Cellvibrio japonicus Ueda107]
 gi|190686836|gb|ACE84514.1| OmpA family protein [Cellvibrio japonicus Ueda107]
          Length = 217

 Score = 97.4 bits (241), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 47/139 (33%), Positives = 82/139 (58%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV-SEVFLEKKFLPMLQLIATILNK 105
           +D+ E + + +LQ TG+ V R G+ +   +P +++F  S   +   F P+L  +A ++ +
Sbjct: 78  MDRQEAKLRAELQGTGVQVRREGNNLYLIMPGNITFATSSADIRSDFFPVLNSVAKVVAE 137

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           F  T I +  HTDS G+   N  +S+ RAD +  YL  + V+S R I   G+  +YP+ +
Sbjct: 138 FNQTSIRVTGHTDSTGSDSINQPLSERRADSVAMYLRSQKVASAR-IQAYGYGSRYPVAS 196

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           NDT  GR+ N+R+E+++ P
Sbjct: 197 NDTPTGREQNRRVELELIP 215


>gi|304321111|ref|YP_003854754.1| hypothetical protein PB2503_07784 [Parvularcula bermudensis
           HTCC2503]
 gi|303300013|gb|ADM09612.1| hypothetical protein PB2503_07784 [Parvularcula bermudensis
           HTCC2503]
          Length = 231

 Score = 97.1 bits (240), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 44/139 (31%), Positives = 84/139 (60%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVS-EVFLEKKFLPMLQLIATILNK 105
           +D+ E E + +L  TG+ V R+G+ I   +P +++F + +  +  +F   L  +A ++ +
Sbjct: 91  MDRQEQELRRELASTGVRVQRVGNDIRLIMPGNITFATGQASVRPEFYATLNSVAKVIER 150

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +  T + ++ HTDS+GT  +N+ +S  RA+ + +YL  +GV+  R  ++ G+    P+ +
Sbjct: 151 YQQTAVLVEGHTDSVGTEDSNVQLSIARAESVGNYLAAQGVAVPRIRAI-GYGESQPVAS 209

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T  GRQ N+R+EIQ+ P
Sbjct: 210 NGTDSGRQQNRRVEIQLSP 228


>gi|83945760|ref|ZP_00958104.1| OmpA family protein [Oceanicaulis alexandrii HTCC2633]
 gi|83850850|gb|EAP88711.1| OmpA family protein [Oceanicaulis alexandrii HTCC2633]
          Length = 217

 Score = 96.7 bits (239), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 47/139 (33%), Positives = 82/139 (58%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVS-EVFLEKKFLPMLQLIATILNK 105
           +D+ E+ F+ +L+ +G+ V R+G+ +   +P  V+F +    ++++F P+L  +A +L  
Sbjct: 77  MDRQENAFRERLRGSGVTVRRVGNDLYLVMPGDVTFATNSAQIDQRFGPVLNDVADVLMT 136

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +P+T + +  H DS+G    N  +S+ RA  + + LI RGV  +R   V G     PI +
Sbjct: 137 YPATYVDVIGHADSVGDASYNQTLSERRASSVAAELIARGVMRDRLY-VAGMGESQPIAS 195

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           NDT  GR  N+R+EI+I P
Sbjct: 196 NDTDSGRAANRRVEIKIAP 214


>gi|114569157|ref|YP_755837.1| OmpA/MotB domain-containing protein [Maricaulis maris MCS10]
 gi|114339619|gb|ABI64899.1| OmpA/MotB domain protein [Maricaulis maris MCS10]
          Length = 227

 Score = 96.3 bits (238), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 48/139 (34%), Positives = 82/139 (58%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVS-EVFLEKKFLPMLQLIATILNK 105
           +D+ E   +  L DTG+ V R G+ +   +P  V+F +    ++ +F  +L  ++T+LN+
Sbjct: 86  MDRQETAMREALSDTGVGVRREGNDLRLIMPGDVTFATNSADIQGQFYGILSDVSTVLNR 145

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +P+T + +  H DS+G    N  +S+ RA  + +YLI +GV  +RF  + G   + PI +
Sbjct: 146 YPATYVDVVGHADSVGAADYNQQLSERRALSVGNYLIAQGVLRDRFY-IAGMGERSPIAS 204

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N+T  GRQ N+R+EI I P
Sbjct: 205 NETAAGRQQNRRVEILIRP 223


>gi|256822902|ref|YP_003146865.1| OmpA/MotB domain-containing protein [Kangiella koreensis DSM 16069]
 gi|256796441|gb|ACV27097.1| OmpA/MotB domain protein [Kangiella koreensis DSM 16069]
          Length = 221

 Score = 96.3 bits (238), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 47/139 (33%), Positives = 84/139 (60%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVF-LEKKFLPMLQLIATILNK 105
           +D  E E + +L  TG+ V R G+ I   +P  ++F ++ + ++  F P+L  ++ +L K
Sbjct: 80  MDSQEKELREELAGTGVGVQRDGEQIHLIMPGDITFQTDRYAIDSGFYPVLDSVSKVLYK 139

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           F  T + +   TDS+G+   N  +S++RA+ + SYL QR + +NR + V G+  +YP+  
Sbjct: 140 FKDTNLEVAGFTDSVGSDSYNQELSEKRANSVASYLRQREIPNNR-LRVVGYGERYPVAP 198

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N+T+ GR  N+R+E+ I P
Sbjct: 199 NETEAGRSKNRRVELTITP 217


>gi|289209442|ref|YP_003461508.1| OmpA/MotB domain protein [Thioalkalivibrio sp. K90mix]
 gi|288945073|gb|ADC72772.1| OmpA/MotB domain protein [Thioalkalivibrio sp. K90mix]
          Length = 221

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 51/139 (36%), Positives = 83/139 (59%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D+ E E + QL+ TG+ V+R GD I   +P H++F +    ++ +F  +L  +A +L +
Sbjct: 80  MDRQEAELREQLRGTGVSVTRDGDNIILNMPGHITFDIDRTDIKPEFEEVLNSVALVLAE 139

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +  T I +  HTD  G ++ N+ +S+ RA  +   LI+RGV S R  +V GF    PI T
Sbjct: 140 YDQTGIEVAGHTDITGRVEYNMDLSERRAQSVGRALIRRGVQSVRVDTV-GFGPHQPIAT 198

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N+T  GR  N+R+E+ +FP
Sbjct: 199 NETAEGRALNRRVELTLFP 217


>gi|310780073|ref|YP_003968405.1| OmpA/MotB domain protein [Ilyobacter polytropus DSM 2926]
 gi|309749396|gb|ADO84057.1| OmpA/MotB domain protein [Ilyobacter polytropus DSM 2926]
          Length = 216

 Score = 95.5 bits (236), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 51/138 (36%), Positives = 82/138 (59%), Gaps = 3/138 (2%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGD-MITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILN 104
            D+ E   + +L+ TG+ + R  D  +   +P +++F      +   F  +L  +ATIL 
Sbjct: 76  FDRQEAALRQELERTGVSLRRTADNTLELVMPGNLTFRTGSSDINSGFYDVLDSVATILV 135

Query: 105 KFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPID 164
           ++  T I +  HTD+ G+L  N  +SQERA+ +  YL  RGV S+R IS +GF Y++PI 
Sbjct: 136 EYKDTTIFVSGHTDNTGSLATNQRLSQERANSVGRYLSSRGVLSSR-ISSQGFDYQFPIA 194

Query: 165 TNDTKVGRQNNQRIEIQI 182
           +N T  GR+ N+R+EI+I
Sbjct: 195 SNSTASGREQNRRVEIEI 212


>gi|323491313|ref|ZP_08096498.1| putative outer membrane protein [Vibrio brasiliensis LMG 20546]
 gi|323314439|gb|EGA67518.1| putative outer membrane protein [Vibrio brasiliensis LMG 20546]
          Length = 222

 Score = 95.5 bits (236), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 50/139 (35%), Positives = 83/139 (59%), Gaps = 3/139 (2%)

Query: 48  DKAEDEFQMQLQDTGIVVSRIGD-MITCYIPVHVSFVSEVF-LEKKFLPMLQLIATILNK 105
           D+ E   + QL ++G+ V R+G+  +   +   + F S  + L+      L+ +A IL +
Sbjct: 83  DQQEAALRKQLLNSGVQVERVGENQLLLRLENGIGFQSSSYQLDSSIHNTLRGVAQILVE 142

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +P T + I  HTDS G+   N ++S+ RA+ ++SYL+ +GV++ R I+ RG   +YP+ T
Sbjct: 143 YPDTSLVIDGHTDSTGSDTTNQVLSERRAESVRSYLVSQGVAAGRAIA-RGNGERYPLCT 201

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T  GR  N+R+EIQI P
Sbjct: 202 NSTTEGRACNRRVEIQILP 220


>gi|262068012|ref|ZP_06027624.1| OmpA family protein [Fusobacterium periodonticum ATCC 33693]
 gi|291378280|gb|EFE85798.1| OmpA family protein [Fusobacterium periodonticum ATCC 33693]
          Length = 212

 Score = 95.5 bits (236), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 51/143 (35%), Positives = 77/143 (53%), Gaps = 2/143 (1%)

Query: 43  FGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSE-VFLEKKFLPMLQLIAT 101
           +G+  D    E +  L+ T   V   G+ +   +P  V+F S+   +   F   L  +A 
Sbjct: 69  WGAYKDNQARELKAALKGTQAEVRNDGNALVVNLPGGVTFASDSANISSGFYSALNGVAQ 128

Query: 102 ILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKY 161
            L K+P T I +  +TDS G   +NL +SQ RA+ +  Y I +GVSSNR ++  GF    
Sbjct: 129 TLVKYPETRIQVNGYTDSTGGDAHNLDLSQRRANAVAQYFIAQGVSSNRIVA-NGFGSSN 187

Query: 162 PIDTNDTKVGRQNNQRIEIQIFP 184
           PI +N T  GRQ N+R+E++I P
Sbjct: 188 PIASNATPEGRQANRRVEVRILP 210


>gi|90420689|ref|ZP_01228595.1| outer membrane protein [Aurantimonas manganoxydans SI85-9A1]
 gi|90334980|gb|EAS48741.1| outer membrane protein [Aurantimonas manganoxydans SI85-9A1]
          Length = 220

 Score = 95.5 bits (236), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 47/142 (33%), Positives = 82/142 (57%), Gaps = 2/142 (1%)

Query: 44  GSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATI 102
           G+ +D  E + + QL+ TG+ V+R+GD I   +P +++F   +  +   F P L  +A +
Sbjct: 76  GAYMDNQEAKLRDQLRGTGVSVTRVGDRIILNMPSNITFPTDQSSILPAFYPTLNSVALV 135

Query: 103 LNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYP 162
           L ++  +++ +  HTDS G+   N  +SQ+RA  +   L  +GV   R ++ +GF    P
Sbjct: 136 LKEYDKSIVNVYGHTDSQGSDGYNFTLSQQRASSVSQLLASQGVDPRR-LNTQGFGESQP 194

Query: 163 IDTNDTKVGRQNNQRIEIQIFP 184
           + +NDT+ GR  N+R+EI I P
Sbjct: 195 VASNDTESGRAQNRRVEIAISP 216


>gi|110834272|ref|YP_693131.1| OmpA family protein [Alcanivorax borkumensis SK2]
 gi|110647383|emb|CAL16859.1| OmpA family protein [Alcanivorax borkumensis SK2]
          Length = 221

 Score = 95.1 bits (235), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 50/165 (30%), Positives = 93/165 (56%), Gaps = 2/165 (1%)

Query: 21  ASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHV 80
           +++E+K+  L  +    +     G  +D  E + + +L+  G+ V+R G+ I   +P ++
Sbjct: 55  SAKERKERALAGAGIGAVTGGGVGYYMDVQEAKLRQKLEGAGVSVTRDGENIILNMPGNL 114

Query: 81  SFVSE-VFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKS 139
           +F ++   ++  F P+L+ +A +L ++ ST+I +  HTDS G  + NLL+SQ+RA  + +
Sbjct: 115 TFATDSTDVKPSFDPVLEAVAEVLKEYKSTMIQVAGHTDSTGGDRYNLLLSQQRAQAVSN 174

Query: 140 YLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
            L   GV   R   V GF    PI +N +  GR+ N+R+E+ + P
Sbjct: 175 KLSAFGVEQVRLDPV-GFGETQPIASNSSASGREQNRRVELTLLP 218


>gi|94496613|ref|ZP_01303189.1| OmpA/MotB [Sphingomonas sp. SKA58]
 gi|94423973|gb|EAT08998.1| OmpA/MotB [Sphingomonas sp. SKA58]
          Length = 226

 Score = 94.4 bits (233), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 49/139 (35%), Positives = 79/139 (56%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D  E + + +   TG+ V R GD +   +P  ++F      ++ +F P L  +A++L +
Sbjct: 81  MDAQERKLREETAGTGVDVIRDGDNLLLRMPSGITFGYDRADVQPQFQPTLNDVASVLAQ 140

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +P T I +  HTDS G+   N  +S+ RA  + +YL+ RGV S R I  RGF    PI +
Sbjct: 141 YPKTYIDVYGHTDSDGSDAYNQTLSERRAQAVANYLVGRGVQSAR-IGTRGFGETQPIAS 199

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T+ G+  N+R+EI+I P
Sbjct: 200 NATEEGKAANRRVEIKIAP 218


>gi|15641208|ref|NP_230840.1| putative lipoprotein [Vibrio cholerae O1 biovar El Tor str. N16961]
 gi|121587785|ref|ZP_01677544.1| lipoprotein, putative [Vibrio cholerae 2740-80]
 gi|121728252|ref|ZP_01681285.1| lipoprotein, putative [Vibrio cholerae V52]
 gi|147673077|ref|YP_001216765.1| putative lipoprotein [Vibrio cholerae O395]
 gi|153819084|ref|ZP_01971751.1| lipoprotein, putative [Vibrio cholerae NCTC 8457]
 gi|153823238|ref|ZP_01975905.1| lipoprotein, putative [Vibrio cholerae B33]
 gi|227081367|ref|YP_002809918.1| putative lipoprotein [Vibrio cholerae M66-2]
 gi|229505212|ref|ZP_04394722.1| outer membrane protein [Vibrio cholerae BX 330286]
 gi|229511118|ref|ZP_04400597.1| outer membrane protein [Vibrio cholerae B33]
 gi|229518237|ref|ZP_04407681.1| outer membrane protein [Vibrio cholerae RC9]
 gi|229608231|ref|YP_002878879.1| outer membrane protein [Vibrio cholerae MJ-1236]
 gi|255745601|ref|ZP_05419549.1| outer membrane protein [Vibrio cholera CIRS 101]
 gi|262158324|ref|ZP_06029440.1| outer membrane protein [Vibrio cholerae INDRE 91/1]
 gi|262169483|ref|ZP_06037175.1| outer membrane protein [Vibrio cholerae RC27]
 gi|298498705|ref|ZP_07008512.1| conserved hypothetical protein [Vibrio cholerae MAK 757]
 gi|9655673|gb|AAF94354.1| lipoprotein, putative [Vibrio cholerae O1 biovar El Tor str.
           N16961]
 gi|121547949|gb|EAX58030.1| lipoprotein, putative [Vibrio cholerae 2740-80]
 gi|121629503|gb|EAX61929.1| lipoprotein, putative [Vibrio cholerae V52]
 gi|126510367|gb|EAZ72961.1| lipoprotein, putative [Vibrio cholerae NCTC 8457]
 gi|126519252|gb|EAZ76475.1| lipoprotein, putative [Vibrio cholerae B33]
 gi|146314960|gb|ABQ19499.1| putative lipoprotein [Vibrio cholerae O395]
 gi|227009255|gb|ACP05467.1| putative lipoprotein [Vibrio cholerae M66-2]
 gi|227013112|gb|ACP09322.1| putative lipoprotein [Vibrio cholerae O395]
 gi|229344952|gb|EEO09926.1| outer membrane protein [Vibrio cholerae RC9]
 gi|229351083|gb|EEO16024.1| outer membrane protein [Vibrio cholerae B33]
 gi|229357435|gb|EEO22352.1| outer membrane protein [Vibrio cholerae BX 330286]
 gi|229370886|gb|ACQ61309.1| outer membrane protein [Vibrio cholerae MJ-1236]
 gi|255736676|gb|EET92073.1| outer membrane protein [Vibrio cholera CIRS 101]
 gi|262022296|gb|EEY41005.1| outer membrane protein [Vibrio cholerae RC27]
 gi|262029765|gb|EEY48413.1| outer membrane protein [Vibrio cholerae INDRE 91/1]
 gi|297543038|gb|EFH79088.1| conserved hypothetical protein [Vibrio cholerae MAK 757]
          Length = 223

 Score = 94.0 bits (232), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 48/139 (34%), Positives = 86/139 (61%), Gaps = 3/139 (2%)

Query: 48  DKAEDEFQMQLQDTGIVVSRIGD-MITCYIPVHVSFVSEVF-LEKKFLPMLQLIATILNK 105
           D+ E E +  L D+G+ V R+G+  +   +   + F S  + L+      L+ +A IL +
Sbjct: 84  DQQEAELRKALLDSGVQVVRVGENQLMLRMENGIGFTSNSYQLDSYIHKTLRGVARILVE 143

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +P T + I+ HTDS G+   N ++S++RA+ ++S+L+ +GV++ R I+ RG   ++P+ +
Sbjct: 144 YPDTSLVIEGHTDSTGSDTTNQVLSEKRAESVRSFLLSQGVAAGRAIA-RGNGERFPLCS 202

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N+T  GR  N+R+EIQI P
Sbjct: 203 NNTAEGRACNRRVEIQILP 221


>gi|254848320|ref|ZP_05237670.1| lipoprotein [Vibrio cholerae MO10]
 gi|254844025|gb|EET22439.1| lipoprotein [Vibrio cholerae MO10]
          Length = 222

 Score = 94.0 bits (232), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 48/139 (34%), Positives = 86/139 (61%), Gaps = 3/139 (2%)

Query: 48  DKAEDEFQMQLQDTGIVVSRIGD-MITCYIPVHVSFVSEVF-LEKKFLPMLQLIATILNK 105
           D+ E E +  L D+G+ V R+G+  +   +   + F S  + L+      L+ +A IL +
Sbjct: 83  DQQEAELRKALLDSGVQVVRVGENQLMLRMENGIGFTSNSYQLDSYIHKTLRGVARILVE 142

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +P T + I+ HTDS G+   N ++S++RA+ ++S+L+ +GV++ R I+ RG   ++P+ +
Sbjct: 143 YPDTSLVIEGHTDSTGSDTTNQVLSEKRAESVRSFLLSQGVAAGRAIA-RGNGERFPLCS 201

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N+T  GR  N+R+EIQI P
Sbjct: 202 NNTAEGRACNRRVEIQILP 220


>gi|254292013|ref|ZP_04962792.1| lipoprotein, putative [Vibrio cholerae AM-19226]
 gi|150422090|gb|EDN14058.1| lipoprotein, putative [Vibrio cholerae AM-19226]
          Length = 223

 Score = 94.0 bits (232), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 48/139 (34%), Positives = 85/139 (61%), Gaps = 3/139 (2%)

Query: 48  DKAEDEFQMQLQDTGIVVSRIGD-MITCYIPVHVSFVSEVF-LEKKFLPMLQLIATILNK 105
           D+ E E +  L D+G+ V R+G+  +   +   + F S  + L+      L+ +A IL +
Sbjct: 84  DQQEAELRKALMDSGVQVVRVGENQLMLRMENGIGFTSNSYQLDSYIHKTLRGVARILVE 143

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +P T + I+ HTDS G+   N ++S++RA+ ++S+L+ +GV+  R I+ RG   ++P+ +
Sbjct: 144 YPDTSLVIEGHTDSTGSDSTNQVLSEKRAESVRSFLLSQGVAEGRAIA-RGNGERFPLCS 202

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N+T  GR  N+R+EIQI P
Sbjct: 203 NNTAEGRACNRRVEIQILP 221


>gi|260778449|ref|ZP_05887341.1| outer membrane protein [Vibrio coralliilyticus ATCC BAA-450]
 gi|260604613|gb|EEX30908.1| outer membrane protein [Vibrio coralliilyticus ATCC BAA-450]
          Length = 222

 Score = 93.6 bits (231), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 49/139 (35%), Positives = 85/139 (61%), Gaps = 3/139 (2%)

Query: 48  DKAEDEFQMQLQDTGIVVSRIGD-MITCYIPVHVSFVSEVF-LEKKFLPMLQLIATILNK 105
           D+ E   + +L D+G+ V R+G+  +   +   + F +  + L+      L+ +A IL +
Sbjct: 83  DQQEAALRKELLDSGVQVERVGENQLMLRMENGIGFQTGSYNLDPSIHNTLRGVAKILVE 142

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +P T + I+ HTDS G+   N ++S+ RA+ ++SYLI +GV+S R I+ RG   ++P+ T
Sbjct: 143 YPDTSLVIEGHTDSTGSDTTNQVLSERRAESVRSYLISQGVASGRAIA-RGNGERFPLCT 201

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N+T  GR  N+R+EI+I P
Sbjct: 202 NNTSEGRACNRRVEIKILP 220


>gi|294787848|ref|ZP_06753092.1| OmpA family protein [Simonsiella muelleri ATCC 29453]
 gi|294484141|gb|EFG31824.1| OmpA family protein [Simonsiella muelleri ATCC 29453]
          Length = 217

 Score = 93.6 bits (231), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 55/144 (38%), Positives = 77/144 (53%), Gaps = 2/144 (1%)

Query: 43  FGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVF-LEKKFLPMLQLIAT 101
            G  +D  E + + QL DTG+ V R G+ I   +P +V+F +  + L       L   A 
Sbjct: 73  VGGYMDYQEKKLREQLADTGVEVQREGNQIKLTMPENVTFATGRYDLSVNAQNSLNGAAQ 132

Query: 102 ILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKY 161
            L  +  T I+I  HTDS G    N+ +SQ RA+ +  YLI +GVSS+R IS  G     
Sbjct: 133 TLATYNETTISIIGHTDSTGNDSINIPLSQNRANAVAQYLISKGVSSSR-ISTAGHGASQ 191

Query: 162 PIDTNDTKVGRQNNQRIEIQIFPR 185
           PI +N T  GR  N+R+EI I P+
Sbjct: 192 PIASNSTAEGRAQNRRVEILINPQ 215


>gi|153215326|ref|ZP_01949939.1| lipoprotein, putative [Vibrio cholerae 1587]
 gi|153826671|ref|ZP_01979338.1| lipoprotein, putative [Vibrio cholerae MZO-2]
 gi|153829618|ref|ZP_01982285.1| putative lipoprotein [Vibrio cholerae 623-39]
 gi|183179599|ref|ZP_02957810.1| lipoprotein, putative [Vibrio cholerae MZO-3]
 gi|229515575|ref|ZP_04405034.1| outer membrane protein [Vibrio cholerae TMA 21]
 gi|229520377|ref|ZP_04409802.1| outer membrane protein [Vibrio cholerae TM 11079-80]
 gi|229525804|ref|ZP_04415209.1| outer membrane protein [Vibrio cholerae bv. albensis VL426]
 gi|229529718|ref|ZP_04419108.1| outer membrane protein [Vibrio cholerae 12129(1)]
 gi|254226715|ref|ZP_04920292.1| lipoprotein, putative [Vibrio cholerae V51]
 gi|262191649|ref|ZP_06049827.1| outer membrane protein [Vibrio cholerae CT 5369-93]
 gi|297578794|ref|ZP_06940722.1| conserved hypothetical protein [Vibrio cholerae RC385]
 gi|124114769|gb|EAY33589.1| lipoprotein, putative [Vibrio cholerae 1587]
 gi|125620776|gb|EAZ49133.1| lipoprotein, putative [Vibrio cholerae V51]
 gi|148874894|gb|EDL73029.1| putative lipoprotein [Vibrio cholerae 623-39]
 gi|149739533|gb|EDM53761.1| lipoprotein, putative [Vibrio cholerae MZO-2]
 gi|183013010|gb|EDT88310.1| lipoprotein, putative [Vibrio cholerae MZO-3]
 gi|229333492|gb|EEN98978.1| outer membrane protein [Vibrio cholerae 12129(1)]
 gi|229339385|gb|EEO04402.1| outer membrane protein [Vibrio cholerae bv. albensis VL426]
 gi|229342475|gb|EEO07468.1| outer membrane protein [Vibrio cholerae TM 11079-80]
 gi|229347344|gb|EEO12304.1| outer membrane protein [Vibrio cholerae TMA 21]
 gi|262032491|gb|EEY51051.1| outer membrane protein [Vibrio cholerae CT 5369-93]
 gi|297536388|gb|EFH75221.1| conserved hypothetical protein [Vibrio cholerae RC385]
 gi|327483893|gb|AEA78300.1| Outer membrane protein [Vibrio cholerae LMA3894-4]
          Length = 223

 Score = 93.6 bits (231), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 48/139 (34%), Positives = 86/139 (61%), Gaps = 3/139 (2%)

Query: 48  DKAEDEFQMQLQDTGIVVSRIGD-MITCYIPVHVSFVSEVF-LEKKFLPMLQLIATILNK 105
           D+ E E +  L D+G+ V R+G+  +   +   + F S  + L+      L+ +A IL +
Sbjct: 84  DQQEAELRKALLDSGVQVVRVGENQLMLRMENGIGFTSNSYQLDSYIHKTLRGVARILVE 143

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +P T + I+ HTDS G+   N ++S++RA+ ++S+L+ +GV++ R I+ RG   ++P+ +
Sbjct: 144 YPDTSLVIEGHTDSTGSDTTNQVLSEKRAESVRSFLLSQGVAAGRAIA-RGNGERFPLCS 202

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N+T  GR  N+R+EIQI P
Sbjct: 203 NNTAEGRACNRRVEIQILP 221


>gi|294012887|ref|YP_003546347.1| OmpA-family protein [Sphingobium japonicum UT26S]
 gi|292676217|dbj|BAI97735.1| OmpA-family protein [Sphingobium japonicum UT26S]
          Length = 226

 Score = 93.6 bits (231), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 48/139 (34%), Positives = 79/139 (56%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEV-FLEKKFLPMLQLIATILNK 105
           +D  E + + +   +G+ V R GD +   +P  ++F ++   ++ +F P L  +A++L +
Sbjct: 81  MDAQERKLREETAGSGVDVIRDGDNLVLRMPSGITFATDSSAVQPQFQPTLNDVASVLAQ 140

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +P T I +  HTDS GT   N  +S+ RA  +  YL   GV S R I+ RGF    PI +
Sbjct: 141 YPKTYIDVYGHTDSDGTDTYNQALSERRAQAVGDYLTTHGVQSAR-IATRGFGETQPIAS 199

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T  G+ +N+R+EI+I P
Sbjct: 200 NATAEGKASNRRVEIKIAP 218


>gi|307293986|ref|ZP_07573830.1| OmpA/MotB domain protein [Sphingobium chlorophenolicum L-1]
 gi|306880137|gb|EFN11354.1| OmpA/MotB domain protein [Sphingobium chlorophenolicum L-1]
          Length = 226

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 49/139 (35%), Positives = 79/139 (56%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEV-FLEKKFLPMLQLIATILNK 105
           +D  E + + Q   +G+ V R GD +   +P  ++F ++   ++ +F P L  +A++L +
Sbjct: 81  MDAQEKKLREQTAGSGVDVIRDGDNLVLRMPSGITFATDSSAVQPQFQPTLNDVASVLAQ 140

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +P T I +  HTDS GT   N  +S+ RA  +  YL   GV S R I+ RGF    PI +
Sbjct: 141 YPKTYIDVYGHTDSDGTDVYNQGLSERRAQAVGDYLTSHGVQSAR-IATRGFGETQPIAS 199

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T  G+ +N+R+EI+I P
Sbjct: 200 NATAEGKASNRRVEIKIAP 218


>gi|59713511|ref|YP_206286.1| outer membrane lipoprotein [Vibrio fischeri ES114]
 gi|197337177|ref|YP_002157921.1| inner membrane lipoprotein YiaD [Vibrio fischeri MJ11]
 gi|59481759|gb|AAW87398.1| predicted outer membrane lipoprotein [Vibrio fischeri ES114]
 gi|197314429|gb|ACH63878.1| inner membrane lipoprotein YiaD [Vibrio fischeri MJ11]
          Length = 222

 Score = 93.2 bits (230), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 47/139 (33%), Positives = 81/139 (58%), Gaps = 3/139 (2%)

Query: 48  DKAEDEFQMQLQDTGIVVSRIG-DMITCYIPVHVSFVSEVF-LEKKFLPMLQLIATILNK 105
           D+ E   + +L+ +G+ V R+G + +   +   + F S  + L+      L  +A IL +
Sbjct: 83  DQQEKALRNELKSSGVQVERVGKNELKLVMDNGIGFQSSSYQLDASIYNTLNGVARILVE 142

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +P T + I  HTDS G    N  +S++RAD +++YLI++ V++ R ++ RG+  +YP+  
Sbjct: 143 YPDTALQIDGHTDSSGNATKNQTLSEQRADSVRTYLIKQDVAAGR-VNARGYGARYPVCD 201

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N TK GR  N+R+EI I P
Sbjct: 202 NSTKQGRACNRRVEITILP 220


>gi|327395890|dbj|BAK13312.1| inner membrane lipoprotein YiaD precursor [Pantoea ananatis
           AJ13355]
          Length = 237

 Score = 92.8 bits (229), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 48/139 (34%), Positives = 82/139 (58%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D  E + + +++ TG+ V+R GD I   +P +V+F  S   L+      L  +A +L +
Sbjct: 98  MDVQEAKLRDKMKGTGVSVTRQGDNIVLNMPNNVTFDSSSSSLKPAGANTLTGVAMVLKE 157

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +P T + +  HTDS G+   N+ +SQ+RA+ + S LI +GV+S+R +  RG     P+ T
Sbjct: 158 YPKTAVNVVGHTDSTGSRALNMRLSQQRAESVASALIVQGVASDR-LHTRGAGPDSPVAT 216

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T+ G+  N+R+EI + P
Sbjct: 217 NSTEAGKAQNRRVEITLSP 235


>gi|224824498|ref|ZP_03697605.1| OmpA/MotB domain protein [Lutiella nitroferrum 2002]
 gi|224602991|gb|EEG09167.1| OmpA/MotB domain protein [Lutiella nitroferrum 2002]
          Length = 218

 Score = 92.8 bits (229), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 49/149 (32%), Positives = 81/149 (54%), Gaps = 2/149 (1%)

Query: 38  IVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPML 96
           IV    G+ +D  E + + +L +T + V R+GD I   +P +++F V+   L+      L
Sbjct: 69  IVGAGVGAYMDYQEKQLRDKLANTQVGVDRVGDQIKLTMPDNITFAVNSAELQPSVRTAL 128

Query: 97  QLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRG 156
             ++ +L ++P T I +  HTD+ G +  N  +SQ RA  +  +L  RGV+ +R   V G
Sbjct: 129 TDVSNVLTQYPDTTITVAGHTDNTGNVAYNQTLSQRRAQSVAGFLQSRGVAGSRINPV-G 187

Query: 157 FAYKYPIDTNDTKVGRQNNQRIEIQIFPR 185
           +    PI +N T  GR  N+R+EI I P+
Sbjct: 188 YGQNQPIASNTTAEGRAKNRRVEILINPK 216


>gi|325923199|ref|ZP_08184883.1| outer membrane protein/peptidoglycan-associated (lipo)protein
           [Xanthomonas gardneri ATCC 19865]
 gi|325546323|gb|EGD17493.1| outer membrane protein/peptidoglycan-associated (lipo)protein
           [Xanthomonas gardneri ATCC 19865]
          Length = 249

 Score = 92.8 bits (229), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 48/142 (33%), Positives = 79/142 (55%), Gaps = 2/142 (1%)

Query: 44  GSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATI 102
           G   D+ E   + +  +TGI V R GD IT  +P  ++F   +  L+ +F   L  +A+ 
Sbjct: 96  GQYQDRQERALRERTANTGIEVQRQGDNITLNLPDGITFDFGKSALKPQFYSALNGVAST 155

Query: 103 LNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYP 162
           L ++  T++ +  HTDS+G+   N  +S+ERA  +  YL  +GV   R  ++ G   +YP
Sbjct: 156 LREYNQTMVEVVGHTDSVGSDAVNQRLSEERAGAVAQYLTAQGVQRERMETM-GAGKRYP 214

Query: 163 IDTNDTKVGRQNNQRIEIQIFP 184
           I  N+T  GR  N+R+EI++ P
Sbjct: 215 IADNNTDAGRAQNRRVEIRLIP 236


>gi|218550833|ref|YP_002384624.1| outer membrane lipoprotein [Escherichia fergusonii ATCC 35469]
 gi|218358374|emb|CAQ91021.1| putative outer membrane lipoprotien [Escherichia fergusonii ATCC
           35469]
 gi|324111886|gb|EGC05866.1| OmpA family protein [Escherichia fergusonii B253]
 gi|325499107|gb|EGC96966.1| outer membrane lipoprotein [Escherichia fergusonii ECD227]
          Length = 219

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 49/139 (35%), Positives = 81/139 (58%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVS-EVFLEKKFLPMLQLIATILNK 105
           +D  E + + +++ TG+ V+R GD I   +P +V+F S    L+      L  +A +L +
Sbjct: 81  MDVQEAKLRDKMRGTGVSVTRSGDNIILNMPNNVTFDSNSATLKPAGANTLTGVAMVLKE 140

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +P T + +  +TDS G    N+ +SQ+RAD + S LI +GV++NR I+ RG     PI +
Sbjct: 141 YPKTAVNVLGYTDSTGGYDLNMRLSQQRADSVASALITQGVAANR-INTRGMGPANPIAS 199

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T  G+  N+R+EI + P
Sbjct: 200 NSTAEGKAQNRRVEITLSP 218


>gi|119476926|ref|ZP_01617207.1| ompA family protein [marine gamma proteobacterium HTCC2143]
 gi|119449733|gb|EAW30970.1| ompA family protein [marine gamma proteobacterium HTCC2143]
          Length = 213

 Score = 92.4 bits (228), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 53/169 (31%), Positives = 92/169 (54%), Gaps = 3/169 (1%)

Query: 18  CGL-ASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYI 76
           CG+  SRE  K   + +     +    G+ +D  E   + QLQ +G+ V R GD I   +
Sbjct: 44  CGIIGSRESSKHARNAAAGCGAIGAGIGAYMDVQESALREQLQGSGVRVVREGDNIRLIM 103

Query: 77  PVHVSFVSEVF-LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERAD 135
           P  ++F ++ + L + F P+L+ +  +L K+  T++ +  HTD+ G  + N  +S++RA 
Sbjct: 104 PGSITFETDSYVLRRSFSPVLESVGLVLAKYNETMMRVTGHTDNTGGEQYNQRLSEDRAQ 163

Query: 136 VIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
            + S L+ +GV  NR   ++G     PI  N+T  GR +N+R+E+ I P
Sbjct: 164 SVASNLMSQGVDGNRLY-IQGSGETMPIADNNTSSGRASNRRVELYILP 211


>gi|261856649|ref|YP_003263932.1| OmpA/MotB domain protein [Halothiobacillus neapolitanus c2]
 gi|261837118|gb|ACX96885.1| OmpA/MotB domain protein [Halothiobacillus neapolitanus c2]
          Length = 216

 Score = 92.4 bits (228), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 51/143 (35%), Positives = 82/143 (57%), Gaps = 2/143 (1%)

Query: 43  FGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIAT 101
            G+ +DK   + Q Q+ +TG+ V R GD I    P  ++F  +   L+ +F+P+LQ +A 
Sbjct: 73  IGNQMDKQAAQLQQQMANTGVEVQRQGDGIHLQAPEAITFNTNSATLKPQFMPVLQQLAQ 132

Query: 102 ILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKY 161
            +N++P T++ ++ +TDS G+   N  +S  RA  + S L Q GV  NR  +V G+    
Sbjct: 133 SVNQYPGTIVRVEGNTDSTGSASYNQQLSLNRAQSVASALSQYGVPYNRIQAV-GYGMTR 191

Query: 162 PIDTNDTKVGRQNNQRIEIQIFP 184
           PI +N T  GR  N+R++I I P
Sbjct: 192 PIASNATAAGRAQNRRVDILIVP 214


>gi|254483376|ref|ZP_05096606.1| OmpA family protein [marine gamma proteobacterium HTCC2148]
 gi|214036360|gb|EEB77037.1| OmpA family protein [marine gamma proteobacterium HTCC2148]
          Length = 214

 Score = 92.4 bits (228), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 51/169 (30%), Positives = 87/169 (51%), Gaps = 3/169 (1%)

Query: 18  CGLASR-EKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYI 76
           CGL    +  K   + +    IV    G+ +D  E + + +LQ TG+ V R GD I   +
Sbjct: 44  CGLVGAIDSGKHARNAALGCGIVGAGVGAYMDVQEAKLKEELQGTGVQVVREGDNIRLIM 103

Query: 77  PVHVSFVSEVF-LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERAD 135
           P +++F ++ + L   F  +L  +  +L+K+  T + +  HTD+ G+ + N  +S+ RA 
Sbjct: 104 PGNITFETDSYNLRSSFYSVLNSVGQVLSKYADTTLRVSGHTDNTGSRQYNQTLSERRAG 163

Query: 136 VIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
            +  YL  R V   R + V+G  +  PI  N +  GR  N+R+E+ I P
Sbjct: 164 SVADYLATREVDRARML-VQGMGFDQPIADNGSAAGRAQNRRVELYILP 211


>gi|166712665|ref|ZP_02243872.1| OmpA family protein [Xanthomonas oryzae pv. oryzicola BLS256]
          Length = 241

 Score = 92.4 bits (228), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 47/143 (32%), Positives = 79/143 (55%), Gaps = 2/143 (1%)

Query: 43  FGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIAT 101
            G   D+ E   + +  +TGI V R GD I+  +P  ++F   +  L+ +F   L  +A+
Sbjct: 87  IGQYQDRQERALRERTANTGIEVQRQGDNISLNLPDGITFDFGKSALKPEFYTALNGVAS 146

Query: 102 ILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKY 161
            L ++  T++ +  HTDS+G+   N  +S+ERA  +  YL  +GV   R  ++ G   +Y
Sbjct: 147 TLREYNQTMVEVVGHTDSVGSDAANQRLSEERAGAVAQYLTAQGVQRERMETM-GAGKRY 205

Query: 162 PIDTNDTKVGRQNNQRIEIQIFP 184
           PI  N+T  GR  N+R+EI++ P
Sbjct: 206 PIADNNTDAGRAKNRRVEIRLIP 228


>gi|188575664|ref|YP_001912593.1| OmpA family protein [Xanthomonas oryzae pv. oryzae PXO99A]
 gi|188520116|gb|ACD58061.1| OmpA family protein [Xanthomonas oryzae pv. oryzae PXO99A]
          Length = 241

 Score = 92.0 bits (227), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 47/143 (32%), Positives = 79/143 (55%), Gaps = 2/143 (1%)

Query: 43  FGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIAT 101
            G   D+ E   + +  +TGI V R GD I+  +P  ++F   +  L+ +F   L  +A+
Sbjct: 87  IGQYQDRQERALRERTANTGIEVQRQGDNISLNLPDGITFDFGKSALKPEFYTALNGVAS 146

Query: 102 ILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKY 161
            L ++  T++ +  HTDS+G+   N  +S+ERA  +  YL  +GV   R  ++ G   +Y
Sbjct: 147 TLREYNQTMVEVVGHTDSVGSDAANQRLSEERAGAVAQYLTAQGVQRERMETM-GAGKRY 205

Query: 162 PIDTNDTKVGRQNNQRIEIQIFP 184
           PI  N+T  GR  N+R+EI++ P
Sbjct: 206 PIADNNTDAGRAKNRRVEIRLIP 228


>gi|21230892|ref|NP_636809.1| outer membrane protein [Xanthomonas campestris pv. campestris str.
           ATCC 33913]
 gi|66769109|ref|YP_243871.1| outer membrane protein [Xanthomonas campestris pv. campestris str.
           8004]
 gi|188992257|ref|YP_001904267.1| OmpA family outer membrane lipoprotein [Xanthomonas campestris pv.
           campestris str. B100]
 gi|21112502|gb|AAM40733.1| outer membrane protein [Xanthomonas campestris pv. campestris str.
           ATCC 33913]
 gi|66574441|gb|AAY49851.1| outer membrane protein [Xanthomonas campestris pv. campestris str.
           8004]
 gi|167734017|emb|CAP52223.1| OmpA family outer membrane lipoprotein [Xanthomonas campestris pv.
           campestris]
          Length = 241

 Score = 92.0 bits (227), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 48/142 (33%), Positives = 79/142 (55%), Gaps = 2/142 (1%)

Query: 44  GSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATI 102
           G   D+ E   + +  +TGI V R GD IT  +P  ++F   +  L+ +F   L  +A+ 
Sbjct: 88  GQYQDRQERALRERTANTGIDVQRQGDNITLNLPDGITFDFGKSALKPQFYTALNGVAST 147

Query: 103 LNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYP 162
           L ++  T++ +  HTDS+G+   N  +S+ERA+ +  YL  +GV   R  ++ G   +YP
Sbjct: 148 LREYNQTMVEVVGHTDSVGSDAVNQRLSEERANAVAQYLTAQGVQRERMETM-GAGKRYP 206

Query: 163 IDTNDTKVGRQNNQRIEIQIFP 184
           I  N T  GR  N+R+EI++ P
Sbjct: 207 IADNSTDAGRAQNRRVEIRLIP 228


>gi|21242231|ref|NP_641813.1| OmpA family protein [Xanthomonas axonopodis pv. citri str. 306]
 gi|21107654|gb|AAM36349.1| OmpA family protein [Xanthomonas axonopodis pv. citri str. 306]
          Length = 241

 Score = 92.0 bits (227), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 52/181 (28%), Positives = 95/181 (52%), Gaps = 7/181 (3%)

Query: 5   LGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIV 64
           +G++  ++T     G ++ E+++  +  +    +     G   D+ E   + +  +TGI 
Sbjct: 54  IGVAAGLLT-----GDSATERRQHAMVGAGIGALSGAAIGQYQDRQERALRERTANTGIE 108

Query: 65  VSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTL 123
           V R GD IT  +P  ++F   +  L+ +F   L  +A+ L ++  T++ +  HTDS+G+ 
Sbjct: 109 VQRQGDNITLNLPDGITFDFGKSALKPQFYSALNGVASTLREYNQTMVEVVGHTDSVGSD 168

Query: 124 KNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
             N  +S+ERA  +  YL  +GV   R  ++ G   +YPI  N T  GR  N+R+EI++ 
Sbjct: 169 AVNQRLSEERAGAVAQYLTAQGVQRERMETM-GAGKRYPIADNSTDAGRAQNRRVEIRLI 227

Query: 184 P 184
           P
Sbjct: 228 P 228


>gi|262402450|ref|ZP_06079011.1| outer membrane protein [Vibrio sp. RC586]
 gi|262351232|gb|EEZ00365.1| outer membrane protein [Vibrio sp. RC586]
          Length = 223

 Score = 92.0 bits (227), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 47/139 (33%), Positives = 85/139 (61%), Gaps = 3/139 (2%)

Query: 48  DKAEDEFQMQLQDTGIVVSRIGD-MITCYIPVHVSFVSEVF-LEKKFLPMLQLIATILNK 105
           D+ E E +  L D+G+ V R+G+  +   +   + F S  + L+      L+ +A IL +
Sbjct: 84  DQQEAELRKALLDSGVQVVRVGENQLMLRMENGIGFTSSSYQLDSYIHKTLRGVARILVE 143

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +P T + I+ HTDS G+   N ++S++RA+ ++++L+ +GV++ R I+ RG   ++P+ +
Sbjct: 144 YPDTSLVIEGHTDSTGSDTTNQVLSEKRAESVRAFLLSQGVAAGRAIA-RGNGERFPLCS 202

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T  GR  N+R+EIQI P
Sbjct: 203 NSTAEGRACNRRVEIQILP 221


>gi|58581150|ref|YP_200166.1| OmpA family protein [Xanthomonas oryzae pv. oryzae KACC10331]
 gi|84623073|ref|YP_450445.1| OmpA family protein [Xanthomonas oryzae pv. oryzae MAFF 311018]
 gi|58425744|gb|AAW74781.1| OmpA family protein [Xanthomonas oryzae pv. oryzae KACC10331]
 gi|84367013|dbj|BAE68171.1| OmpA family protein [Xanthomonas oryzae pv. oryzae MAFF 311018]
          Length = 241

 Score = 92.0 bits (227), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 47/143 (32%), Positives = 79/143 (55%), Gaps = 2/143 (1%)

Query: 43  FGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIAT 101
            G   D+ E   + +  +TGI V R GD I+  +P  ++F   +  L+ +F   L  +A+
Sbjct: 87  IGQYQDRQERALRERTANTGIEVQRQGDNISLNLPDGITFDFGKSALKPEFYTALNGVAS 146

Query: 102 ILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKY 161
            L ++  T++ +  HTDS+G+   N  +S+ERA  +  YL  +GV   R  ++ G   +Y
Sbjct: 147 TLREYNQTMVEVVGHTDSVGSDAANQRLSEERAGAVAQYLTAQGVQRERMETM-GAGKRY 205

Query: 162 PIDTNDTKVGRQNNQRIEIQIFP 184
           PI  N+T  GR  N+R+EI++ P
Sbjct: 206 PIADNNTDAGRAKNRRVEIRLIP 228


>gi|146308665|ref|YP_001189130.1| OmpA/MotB domain-containing protein [Pseudomonas mendocina ymp]
 gi|145576866|gb|ABP86398.1| OmpA/MotB domain protein [Pseudomonas mendocina ymp]
          Length = 222

 Score = 92.0 bits (227), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 47/138 (34%), Positives = 76/138 (55%), Gaps = 2/138 (1%)

Query: 48  DKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSE-VFLEKKFLPMLQLIATILNKF 106
           D+ E E + Q+Q TG+ V R GD+I   +P +++F ++   +   F   L  +A    ++
Sbjct: 81  DRQEAELRRQMQGTGVEVQRQGDVIQLIMPGNITFATDSAEIASSFYAPLNNLANSFRQY 140

Query: 107 PSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTN 166
               I +  HTDS G+   N+ +SQ RA  + SYLI +GV  +R +S RG     P+ +N
Sbjct: 141 NQNSIEVVGHTDSTGSHSYNMSLSQRRAQSVASYLIAQGVDGSR-VSTRGMGPDQPVASN 199

Query: 167 DTKVGRQNNQRIEIQIFP 184
            T  GR  N+R+E+ + P
Sbjct: 200 ATAEGRAQNRRVEVTLRP 217


>gi|258626412|ref|ZP_05721259.1| putative lipoprotein [Vibrio mimicus VM603]
 gi|258581464|gb|EEW06366.1| putative lipoprotein [Vibrio mimicus VM603]
          Length = 223

 Score = 92.0 bits (227), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 47/139 (33%), Positives = 85/139 (61%), Gaps = 3/139 (2%)

Query: 48  DKAEDEFQMQLQDTGIVVSRIGD-MITCYIPVHVSFVSEVF-LEKKFLPMLQLIATILNK 105
           D+ E E +  L D+G+ V R+G+  +   +   + F S  + L+      L+ +A IL  
Sbjct: 84  DQQEAELRKALLDSGVQVVRVGENQLMLRMENGIGFTSSSYQLDSYIHKTLRGVARILVA 143

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +P T + I+ HTDS G+   N ++S++RA+ ++++L+ +GV++ R I+ RG   ++P+ +
Sbjct: 144 YPDTSLVIEGHTDSTGSDTTNQVLSEKRAESVRAFLLSQGVAAGRAIA-RGNGERFPLCS 202

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N+T  GR  N+R+EIQI P
Sbjct: 203 NNTAEGRACNRRVEIQILP 221


>gi|294782159|ref|ZP_06747485.1| OmpA family protein [Fusobacterium sp. 1_1_41FAA]
 gi|294480800|gb|EFG28575.1| OmpA family protein [Fusobacterium sp. 1_1_41FAA]
          Length = 212

 Score = 92.0 bits (227), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 50/143 (34%), Positives = 77/143 (53%), Gaps = 2/143 (1%)

Query: 43  FGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSE-VFLEKKFLPMLQLIAT 101
           +G+  D    E +  L+ T   V   G+ +   +P  V+F S+   +   F   L  +A 
Sbjct: 69  WGAYKDNQARELKAALKGTQAEVRNDGNALVVNLPGGVTFASDSANISSGFYSALNGVAQ 128

Query: 102 ILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKY 161
            L ++P T I +  +TDS G   +N  +SQ RA+ +  YLI +GVSSNR ++  GF    
Sbjct: 129 TLVRYPETRIQVNGYTDSTGGDAHNQELSQRRANSVAQYLISQGVSSNRIVA-NGFGSLN 187

Query: 162 PIDTNDTKVGRQNNQRIEIQIFP 184
           PI +N T  GRQ N+R+E++I P
Sbjct: 188 PIASNATPEGRQANRRVEVRILP 210


>gi|146281506|ref|YP_001171659.1| OmpA family protein [Pseudomonas stutzeri A1501]
 gi|145569711|gb|ABP78817.1| OmpA family protein [Pseudomonas stutzeri A1501]
 gi|327479683|gb|AEA82993.1| OmpA family protein [Pseudomonas stutzeri DSM 4166]
          Length = 217

 Score = 92.0 bits (227), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 51/138 (36%), Positives = 73/138 (52%), Gaps = 2/138 (1%)

Query: 48  DKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVS-EVFLEKKFLPMLQLIATILNKF 106
           D  E + +  LQ TG+ V R GD +T  +P +++F S    +   F P L  +  +  +F
Sbjct: 80  DTQEAKLRQTLQGTGVQVQRNGDNLTLIMPGNITFASNSADISSSFYPTLNSLVQVFKEF 139

Query: 107 PSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTN 166
               + I  HTDS G+L+ N  +S  RA  + SYLI  GV+  R IS  G     PI +N
Sbjct: 140 NKNGVDIVGHTDSTGSLQLNQDLSNRRAQSVASYLIANGVAPAR-ISSYGAGPSQPIASN 198

Query: 167 DTKVGRQNNQRIEIQIFP 184
           DT  GR  N+R+EI + P
Sbjct: 199 DTAAGRAQNRRVEINLRP 216


>gi|329888485|ref|ZP_08267083.1| inner membrane lipoprotein yiaD [Brevundimonas diminuta ATCC 11568]
 gi|328847041|gb|EGF96603.1| inner membrane lipoprotein yiaD [Brevundimonas diminuta ATCC 11568]
          Length = 224

 Score = 91.7 bits (226), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 49/142 (34%), Positives = 82/142 (57%), Gaps = 2/142 (1%)

Query: 44  GSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVS-EVFLEKKFLPMLQLIATI 102
           G  +D  +   + +L  TG+ V+R GD +   +P  V+F + +  L+ +FLP+L  +A +
Sbjct: 81  GQYMDGQQRALEAELSGTGVGVARQGDNLVLRMPSDVTFATNQSDLDPRFLPVLDDVARV 140

Query: 103 LNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYP 162
           LN++  +++ +  HTDS G    N  +S+ RA  + ++LI RGV   R I V G + + P
Sbjct: 141 LNQYDRSMVDVVGHTDSSGGDAINQPLSERRAASVAAHLINRGVMRER-IYVAGMSARAP 199

Query: 163 IDTNDTKVGRQNNQRIEIQIFP 184
           I +N T  G+  N+R+EI I P
Sbjct: 200 IGSNATPEGKAQNRRVEILIRP 221


>gi|260890151|ref|ZP_05901414.1| OmpA family protein [Leptotrichia hofstadii F0254]
 gi|260860174|gb|EEX74674.1| OmpA family protein [Leptotrichia hofstadii F0254]
          Length = 215

 Score = 91.7 bits (226), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 50/139 (35%), Positives = 80/139 (57%), Gaps = 3/139 (2%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGD-MITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILN 104
            D+ E E + +L+ TG+ V R G+  I    P +++F ++   ++ +F   L  +AT+L 
Sbjct: 74  FDRQEKELRNKLKGTGVDVKRTGEGEIKLTAPENITFDINSYVIKPQFRNTLDSVATVLK 133

Query: 105 KFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPID 164
            +P + I +  HTD+ G    N  +S  RA  ++SYL  +G+SS+R  S RGF  K PI 
Sbjct: 134 TYPDSTIVVSGHTDTTGNDAINNPLSINRASSVESYLESQGISSSRITS-RGFGSKQPIA 192

Query: 165 TNDTKVGRQNNQRIEIQIF 183
           +N T+ GR  N+R+EI I 
Sbjct: 193 SNSTEAGRAQNRRVEIAII 211


>gi|261210647|ref|ZP_05924939.1| outer membrane protein [Vibrio sp. RC341]
 gi|260840132|gb|EEX66712.1| outer membrane protein [Vibrio sp. RC341]
          Length = 223

 Score = 91.7 bits (226), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 47/139 (33%), Positives = 85/139 (61%), Gaps = 3/139 (2%)

Query: 48  DKAEDEFQMQLQDTGIVVSRIGD-MITCYIPVHVSFVSEVF-LEKKFLPMLQLIATILNK 105
           D+ E E +  L D+G+ V R+G+  +   +   + F S  + L+      L+ +A IL +
Sbjct: 84  DQQEAELRKALLDSGVQVVRVGENQLLLRMENGIGFTSSSYQLDSYIHKTLRGVARILVE 143

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +P T + I+ HTDS G+   N ++S++RA+ ++++L+ +GV++ R I+ RG   ++P+ +
Sbjct: 144 YPDTSLVIEGHTDSTGSDTTNQVLSEKRAESVRAFLLAQGVAAGRAIA-RGNGERFPLCS 202

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T  GR  N+R+EIQI P
Sbjct: 203 NSTAEGRACNRRVEIQILP 221


>gi|325914015|ref|ZP_08176371.1| outer membrane protein/peptidoglycan-associated (lipo)protein
           [Xanthomonas vesicatoria ATCC 35937]
 gi|325539784|gb|EGD11424.1| outer membrane protein/peptidoglycan-associated (lipo)protein
           [Xanthomonas vesicatoria ATCC 35937]
          Length = 241

 Score = 91.7 bits (226), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 48/142 (33%), Positives = 78/142 (54%), Gaps = 2/142 (1%)

Query: 44  GSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATI 102
           G   D+ E   + +  +TGI V R GD IT  +P  ++F   +  L+ +F   L  +A+ 
Sbjct: 88  GQYQDRQERALRERTANTGIDVQRQGDNITLNLPDGITFDFGKSALKPQFYSALNGVAST 147

Query: 103 LNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYP 162
           L ++  T++ +  HTDS+G+   N  +S+ERA  +  YL  +GV   R  ++ G   +YP
Sbjct: 148 LREYNQTMVEVVGHTDSVGSDAVNQRLSEERAGAVAQYLTAQGVQRERMETM-GAGKRYP 206

Query: 163 IDTNDTKVGRQNNQRIEIQIFP 184
           I  N T  GR  N+R+EI++ P
Sbjct: 207 IADNSTDAGRAQNRRVEIRLIP 228


>gi|92115424|ref|YP_575352.1| OmpA/MotB [Chromohalobacter salexigens DSM 3043]
 gi|91798514|gb|ABE60653.1| OmpA/MotB [Chromohalobacter salexigens DSM 3043]
          Length = 226

 Score = 91.7 bits (226), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 47/139 (33%), Positives = 76/139 (54%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D  E++ +  L  TGI V R GD I   +P  V+F V    L+      L     ++ +
Sbjct: 84  MDAQEEKLRRDLDGTGIGVDRQGDNIVLNMPSSVTFDVDSSALKTPARQALNDATAVMRE 143

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +P T I +  +TDS G+   N  +S+ RA  +  YL Q G+++NR  +V G+  + P+ +
Sbjct: 144 YPKTRINVAGYTDSTGSADYNQRLSERRAQAVADYLGQGGIAANRINTV-GYGERQPVAS 202

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           NDT+ GR  N+R+EI + P
Sbjct: 203 NDTESGRAQNRRVEITLTP 221


>gi|148555237|ref|YP_001262819.1| OmpA/MotB domain-containing protein [Sphingomonas wittichii RW1]
 gi|148500427|gb|ABQ68681.1| OmpA/MotB domain protein [Sphingomonas wittichii RW1]
          Length = 222

 Score = 91.7 bits (226), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 45/139 (32%), Positives = 81/139 (58%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVF-LEKKFLPMLQLIATILNK 105
           +D+ E + + Q   TG+ V R GD +   +P  ++F +  + ++ +F   L  +A+ L++
Sbjct: 79  MDRQEAKLREQTAGTGVEVERQGDELLLNMPAGITFATNSYEVQPQFRTTLDKVASTLSE 138

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +  T + +  HTDS G+   N  +S+ RA+ + +YL   GV++ R I  +GF  + P+ +
Sbjct: 139 YGKTYVDVYGHTDSTGSDAINEPLSRNRAEAVANYLSGHGVAAAR-IGTQGFGSRQPVAS 197

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T  GRQ N+R+EI+I P
Sbjct: 198 NATPDGRQANRRVEIKIVP 216


>gi|212633550|ref|YP_002310075.1| OmpA protein [Shewanella piezotolerans WP3]
 gi|212555034|gb|ACJ27488.1| OmpA [Shewanella piezotolerans WP3]
          Length = 222

 Score = 91.3 bits (225), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 50/139 (35%), Positives = 78/139 (56%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D  E E + QLQ +G+ V+R GD I   +P  V+F V +  L ++   +L  +A +  +
Sbjct: 83  MDVQEAELRKQLQSSGVSVTRSGDTIILNMPNDVTFGVDQTDLSQRAKQVLNSVALVALE 142

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +  T + +  HTDS G    N+ +SQ RA  + SYL+ R V S R +S  G     P+ +
Sbjct: 143 YDETKLNVMGHTDSSGAASYNMRLSQVRASEVASYLMSRKVPSARVVS-HGVGEDRPVAS 201

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N+TK GR  N+R+EI + P
Sbjct: 202 NETKAGRAENRRVEIILSP 220


>gi|258622653|ref|ZP_05717674.1| putative lipoprotein [Vibrio mimicus VM573]
 gi|262171774|ref|ZP_06039452.1| outer membrane protein [Vibrio mimicus MB-451]
 gi|258585109|gb|EEW09837.1| putative lipoprotein [Vibrio mimicus VM573]
 gi|261892850|gb|EEY38836.1| outer membrane protein [Vibrio mimicus MB-451]
          Length = 223

 Score = 91.3 bits (225), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 47/139 (33%), Positives = 84/139 (60%), Gaps = 3/139 (2%)

Query: 48  DKAEDEFQMQLQDTGIVVSRIGD-MITCYIPVHVSFVSEVF-LEKKFLPMLQLIATILNK 105
           D+ E E +  L D+G+ V R+G+  +   +   + F S  + L+      L+ +A IL  
Sbjct: 84  DQQEAELRKALLDSGVQVVRVGENQLMLRMENGIGFTSSSYQLDSYIHKTLRGVARILVA 143

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +P T + I+ HTDS G+   N ++S++RA+ ++++L+ +GV++ R I+ RG   ++P+ +
Sbjct: 144 YPDTSLVIEGHTDSTGSDTTNQVLSEKRAESVRAFLLSQGVAAGRAIA-RGNGERFPLCS 202

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T  GR  N+R+EIQI P
Sbjct: 203 NSTAEGRACNRRVEIQILP 221


>gi|254524462|ref|ZP_05136517.1| outer membrane protein [Stenotrophomonas sp. SKA14]
 gi|219722053|gb|EED40578.1| outer membrane protein [Stenotrophomonas sp. SKA14]
          Length = 231

 Score = 91.3 bits (225), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 58/181 (32%), Positives = 93/181 (51%), Gaps = 7/181 (3%)

Query: 5   LGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIV 64
           +G++  ++T     G ++ E+++  L  +    +     G   D+ E   + +  +TGI 
Sbjct: 54  IGVAAGLLT-----GDSATERRQHALIGAGIGALSGAAVGQYQDRQERALRERTANTGID 108

Query: 65  VSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTL 123
           V R GD I   +P  ++F   +  L+ +F   L  +A  L  +  T+I +  HTDSIG+ 
Sbjct: 109 VQRQGDNIMLNLPDGITFDFGKATLKPQFYGSLNGVAGTLRDYNQTMIEVVGHTDSIGSD 168

Query: 124 KNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
             N  +S+ERAD +  YLI +GV S R I   G    YPI  N T  GR  N+R+EI++ 
Sbjct: 169 AVNNRLSKERADSVAQYLIGQGVQSVR-IETLGAGKSYPIADNSTDAGRAKNRRVEIRVI 227

Query: 184 P 184
           P
Sbjct: 228 P 228


>gi|291615624|ref|YP_003518366.1| YiaD [Pantoea ananatis LMG 20103]
 gi|291150654|gb|ADD75238.1| YiaD [Pantoea ananatis LMG 20103]
          Length = 237

 Score = 91.3 bits (225), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 47/139 (33%), Positives = 81/139 (58%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D  E + + +++ TG+ V+R GD I   +P +V+F  S   L+      L  +A +L +
Sbjct: 98  MDVQEAKLRDKMKGTGVSVTRQGDNIVLNMPNNVTFDSSSSSLKPAGANTLTGVAMVLKE 157

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +P T + +  HTDS G+   N+ +SQ+RA+ + S LI +GV+ NR +  +G     P+ T
Sbjct: 158 YPKTAVNVVGHTDSTGSRALNMRLSQQRAESVASALIVQGVAGNR-LHTQGAGPDSPVAT 216

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T+ G+  N+R+EI + P
Sbjct: 217 NSTEAGKAQNRRVEITLSP 235


>gi|254283478|ref|ZP_04958446.1| OmpA family protein [gamma proteobacterium NOR51-B]
 gi|219679681|gb|EED36030.1| OmpA family protein [gamma proteobacterium NOR51-B]
          Length = 199

 Score = 91.3 bits (225), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 57/166 (34%), Positives = 88/166 (53%), Gaps = 7/166 (4%)

Query: 20  LASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVH 79
           L +  +K    H   DTD +    G  LD      Q  L   G+ V R  D +   +P  
Sbjct: 19  LTAVRRKTAAKHSPVDTDSI----GYYLDVQTARLQA-LAREGVSVERRDDHLLIVMPGT 73

Query: 80  VSFVSE-VFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIK 138
            SF S+   L+   L +L  ++T+L +F  ++I I  H+DS+G    NL +S++RA  + 
Sbjct: 74  ASFASDSALLKSNMLGLLDDLSTVLQEFNKSLIFIGGHSDSLGDSGYNLYLSRQRALAVG 133

Query: 139 SYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           ++L + G+ S R + VRGF    PI TNDT+ GR  N+RIE+ ++P
Sbjct: 134 THLSKVGIDSWRLV-VRGFGDAKPIATNDTESGRAGNRRIELTVWP 178


>gi|304391383|ref|ZP_07373325.1| inner membrane lipoprotein YiaD [Ahrensia sp. R2A130]
 gi|303295612|gb|EFL89970.1| inner membrane lipoprotein YiaD [Ahrensia sp. R2A130]
          Length = 219

 Score = 91.3 bits (225), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 45/138 (32%), Positives = 84/138 (60%), Gaps = 2/138 (1%)

Query: 48  DKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVS-EVFLEKKFLPMLQLIATILNKF 106
           D  E + + +LQ+TG+ VSR+G+ I   +P +++F S    L+ +F  +L  +A +L ++
Sbjct: 81  DNQEAKLRAELQNTGVSVSRVGNDIVLNMPSNITFNSGSADLKAQFFRVLNSVALVLKEY 140

Query: 107 PSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTN 166
             T++ +  HTDS G+ + N  +S+ R   +  YL+Q+G  S R+  V G+  + PI +N
Sbjct: 141 NKTLVNVSGHTDSDGSDQFNQQLSERRGVNVAQYLVQQGTDSRRYYVV-GYGEERPIASN 199

Query: 167 DTKVGRQNNQRIEIQIFP 184
            +  G++ N+R+EI++ P
Sbjct: 200 ASAAGKEQNRRVEIRLSP 217


>gi|49188511|ref|YP_025325.1| OmpA [Pseudomonas alcaligenes]
 gi|5123490|gb|AAD40344.1|U88088_22 OmpA [Pseudomonas alcaligenes]
          Length = 220

 Score = 91.3 bits (225), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 47/144 (32%), Positives = 79/144 (54%), Gaps = 2/144 (1%)

Query: 43  FGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVS-EVFLEKKFLPMLQLIAT 101
           +G   DK E E + Q++ +G+ V R GD I   +P  ++F + +  ++  F   L  +A 
Sbjct: 71  YGYYADKQEAELREQMKGSGVQVERQGDEIVIVMPGAITFATGKAEIQPNFANTLNQLAG 130

Query: 102 ILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKY 161
               +P + + +  HTDS+G+ + N L+SQ RA  +  +L   GV ++R I V G     
Sbjct: 131 SFRNYPDSRLIVTGHTDSVGSYEANELLSQRRAQSVAQFLRGNGVQTDR-IEVIGAGPNQ 189

Query: 162 PIDTNDTKVGRQNNQRIEIQIFPR 185
           P+ +N T  GR  N+R+EI++ PR
Sbjct: 190 PVASNATAEGRAQNRRVEIKLAPR 213


>gi|28199574|ref|NP_779888.1| OmpA family protein [Xylella fastidiosa Temecula1]
 gi|28057689|gb|AAO29537.1| OmpA family protein [Xylella fastidiosa Temecula1]
          Length = 242

 Score = 91.3 bits (225), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 48/138 (34%), Positives = 79/138 (57%), Gaps = 2/138 (1%)

Query: 48  DKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKF 106
           D+ E   + +  +TGI V R GD IT  +P  ++F   +  L+ +F   L+ +A+ L ++
Sbjct: 94  DRQERALRERTANTGIDVKRDGDNITLNLPDGITFDFGKSMLKPQFYGALKNVASTLREY 153

Query: 107 PSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTN 166
             T+I +  +TDSIG+   N  +S++RA  + SYL  +GV   R + + G   +YPI  N
Sbjct: 154 NQTMIEVVGYTDSIGSDVVNQRLSEDRAGAVASYLAAQGVQRER-MEISGMGKRYPIADN 212

Query: 167 DTKVGRQNNQRIEIQIFP 184
            T+ GR  N+R+EI + P
Sbjct: 213 STEAGRSKNRRVEIHLIP 230


>gi|285017932|ref|YP_003375643.1| hypothetical protein XALc_1141 [Xanthomonas albilineans GPE PC73]
 gi|283473150|emb|CBA15656.1| hypothetical protein XALc_1141 [Xanthomonas albilineans]
          Length = 231

 Score = 91.3 bits (225), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 52/168 (30%), Positives = 91/168 (54%), Gaps = 2/168 (1%)

Query: 18  CGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIP 77
            G ++ E+++  +  +    +     G+  D+ E   + +  +TGI V R GD IT  +P
Sbjct: 62  SGSSATERRQHAMIGAGIGALSGAAIGNYQDRQERALRERTANTGIDVRRDGDNITLNLP 121

Query: 78  VHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADV 136
             ++F  ++  L+ +F   L  +A  L+++  T+I +  HTD+IG+   N  +S++RA  
Sbjct: 122 DGITFDFNQSTLKPQFYSALNGVAKTLSEYNQTMIEVVGHTDNIGSDAVNQRLSEQRASS 181

Query: 137 IKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           + +YL  +GV   R I   G   KYPI  N T+ GR  N+R+EI++ P
Sbjct: 182 VAAYLTAQGVQPER-IQTLGAGKKYPIADNSTEAGRAQNRRVEIRVVP 228


>gi|289670151|ref|ZP_06491226.1| OmpA family outer membrane lipoprotein [Xanthomonas campestris pv.
           musacearum NCPPB4381]
          Length = 241

 Score = 91.3 bits (225), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 51/181 (28%), Positives = 96/181 (53%), Gaps = 7/181 (3%)

Query: 5   LGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIV 64
           +G++  ++T     G ++ E+++  +  +    +     G   D+ E   + +  +TGI 
Sbjct: 54  IGVAAGLLT-----GDSATERRQHAMVGAGIGALSGAAIGQYQDRQERALRERTANTGIE 108

Query: 65  VSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTL 123
           V R GD I+  +P  ++F   +  L+ +F   L  +A+ L ++  T++ +  HTDS+G+ 
Sbjct: 109 VQRQGDNISLNLPDGITFDFGKSALKPEFYTALNGVASTLREYNQTMVEVVGHTDSVGSD 168

Query: 124 KNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
             N  +S+ERA  +  YL  +GV   R  ++ G   +YPI  N+T  GR  N+R+EI++ 
Sbjct: 169 AVNQRLSEERAGAVAQYLTAQGVQRERMETM-GAGKRYPIADNNTDAGRAKNRRVEIRLI 227

Query: 184 P 184
           P
Sbjct: 228 P 228


>gi|71276562|ref|ZP_00652836.1| OmpA/MotB:Rickettsia 17 kDa surface antigen [Xylella fastidiosa
           Dixon]
 gi|71900206|ref|ZP_00682345.1| OmpA/MotB [Xylella fastidiosa Ann-1]
 gi|170730945|ref|YP_001776378.1| OmpA family protein [Xylella fastidiosa M12]
 gi|182682310|ref|YP_001830470.1| OmpA/MotB domain-containing protein [Xylella fastidiosa M23]
 gi|71162633|gb|EAO12361.1| OmpA/MotB:Rickettsia 17 kDa surface antigen [Xylella fastidiosa
           Dixon]
 gi|71730039|gb|EAO32131.1| OmpA/MotB [Xylella fastidiosa Ann-1]
 gi|167965738|gb|ACA12748.1| OmpA family protein [Xylella fastidiosa M12]
 gi|182632420|gb|ACB93196.1| OmpA/MotB domain protein [Xylella fastidiosa M23]
          Length = 241

 Score = 91.3 bits (225), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 48/138 (34%), Positives = 79/138 (57%), Gaps = 2/138 (1%)

Query: 48  DKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKF 106
           D+ E   + +  +TGI V R GD IT  +P  ++F   +  L+ +F   L+ +A+ L ++
Sbjct: 93  DRQERALRERTANTGIDVKRDGDNITLNLPDGITFDFGKSMLKPQFYGALKNVASTLREY 152

Query: 107 PSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTN 166
             T+I +  +TDSIG+   N  +S++RA  + SYL  +GV   R + + G   +YPI  N
Sbjct: 153 NQTMIEVVGYTDSIGSDVVNQRLSEDRAGAVASYLAAQGVQRER-MEISGMGKRYPIADN 211

Query: 167 DTKVGRQNNQRIEIQIFP 184
            T+ GR  N+R+EI + P
Sbjct: 212 STEAGRSKNRRVEIHLIP 229


>gi|85858041|ref|YP_460243.1| outer membrane OmpA family protein [Syntrophus aciditrophicus SB]
 gi|85721132|gb|ABC76075.1| outer membrane OmpA family protein [Syntrophus aciditrophicus SB]
          Length = 223

 Score = 91.3 bits (225), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 44/123 (35%), Positives = 75/123 (60%), Gaps = 2/123 (1%)

Query: 64  VVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGT 122
            VSR G+++       V+F  +   +       +  +A ++ ++P T+I ++ HTDS+G+
Sbjct: 96  AVSREGNLLAVTFKGDVTFDTNSAEVRPGLYSEINRVAGVMTQYPETLIRVEGHTDSVGS 155

Query: 123 LKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
              N+ +S  RA+ +K+ L+QRGV+ +R I V G+    PI TNDT+ GRQ N+R+EI+I
Sbjct: 156 DAYNMDLSTRRANAVKTLLVQRGVADSR-IEVVGYGETMPIATNDTEAGRQKNRRVEIKI 214

Query: 183 FPR 185
            P+
Sbjct: 215 APQ 217


>gi|156936282|ref|YP_001440198.1| putative outer membrane lipoprotein [Cronobacter sakazakii ATCC
           BAA-894]
 gi|156534536|gb|ABU79362.1| hypothetical protein ESA_04181 [Cronobacter sakazakii ATCC BAA-894]
          Length = 220

 Score = 90.9 bits (224), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 47/139 (33%), Positives = 81/139 (58%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D  E + + ++Q TG+ V+R GD I   +P +V+F  S+  L+      L  +A +L +
Sbjct: 81  MDVQEAKLRQKMQGTGVSVTRSGDNIILNMPNNVTFDSSQANLKPAGANTLTGVAMVLKE 140

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +P T + +  +TDS G    N+ +SQ+RA+ + S LI +GV++NR I   G     P+ +
Sbjct: 141 YPKTAVNVVGYTDSTGGQALNMKLSQQRAESVASALITQGVAANR-IRTSGMGPANPVAS 199

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T+ G+  N+R+EI + P
Sbjct: 200 NSTEEGKAQNRRVEITLSP 218


>gi|289662994|ref|ZP_06484575.1| OmpA family outer membrane lipoprotein [Xanthomonas campestris pv.
           vasculorum NCPPB702]
          Length = 241

 Score = 90.9 bits (224), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 47/143 (32%), Positives = 79/143 (55%), Gaps = 2/143 (1%)

Query: 43  FGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIAT 101
            G   D+ E   + +  +TGI V R GD I+  +P  ++F   +  L+ +F   L  +A+
Sbjct: 87  IGQYQDRQERALRERTANTGIEVQRQGDNISLNLPDGITFDFGKSALKPEFYTALNGVAS 146

Query: 102 ILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKY 161
            L ++  T++ +  HTDS+G+   N  +S+ERA  +  YL  +GV   R  ++ G   +Y
Sbjct: 147 TLREYNQTMVEVVGHTDSVGSDAVNQRLSEERAGAVAQYLTAQGVQRERMDTM-GAGKRY 205

Query: 162 PIDTNDTKVGRQNNQRIEIQIFP 184
           PI  N+T  GR  N+R+EI++ P
Sbjct: 206 PIADNNTDAGRAKNRRVEIRLIP 228


>gi|190573806|ref|YP_001971651.1| putative outer membrane lipoprotein [Stenotrophomonas maltophilia
           K279a]
 gi|190011728|emb|CAQ45347.1| putative outer membrane lipoprotein [Stenotrophomonas maltophilia
           K279a]
          Length = 231

 Score = 90.9 bits (224), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 58/181 (32%), Positives = 93/181 (51%), Gaps = 7/181 (3%)

Query: 5   LGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIV 64
           +G++  ++T     G ++ E+++  L  +    +     G   D+ E   + +  +TGI 
Sbjct: 54  IGVAAGLLT-----GDSATERRQHALIGAGIGALSGAAVGQYQDRQERALRERTANTGID 108

Query: 65  VSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTL 123
           V R GD I   +P  ++F   +  L+ +F   L  +A  L  +  T+I +  HTDSIG+ 
Sbjct: 109 VQRQGDNIMLNLPDGITFDFGKSTLKPQFYGALNGVAGTLRDYNQTMIEVVGHTDSIGSD 168

Query: 124 KNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
             N  +S+ERAD +  YLI +GV S R I   G    YPI  N T  GR  N+R+EI++ 
Sbjct: 169 AVNNRLSKERADSVAQYLIGQGVQSVR-IETLGAGKSYPIADNSTDAGRAKNRRVEIRVI 227

Query: 184 P 184
           P
Sbjct: 228 P 228


>gi|307578587|gb|ADN62556.1| OmpA family protein [Xylella fastidiosa subsp. fastidiosa GB514]
          Length = 240

 Score = 90.9 bits (224), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 48/138 (34%), Positives = 79/138 (57%), Gaps = 2/138 (1%)

Query: 48  DKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKF 106
           D+ E   + +  +TGI V R GD IT  +P  ++F   +  L+ +F   L+ +A+ L ++
Sbjct: 92  DRQERALRERTANTGIDVKRDGDNITLNLPDGITFDFGKSMLKPQFYGALKNVASTLREY 151

Query: 107 PSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTN 166
             T+I +  +TDSIG+   N  +S++RA  + SYL  +GV   R + + G   +YPI  N
Sbjct: 152 NQTMIEVVGYTDSIGSDVVNQRLSEDRAGAVASYLAAQGVQRER-MEISGMGKRYPIADN 210

Query: 167 DTKVGRQNNQRIEIQIFP 184
            T+ GR  N+R+EI + P
Sbjct: 211 STEAGRSKNRRVEIHLIP 228


>gi|71901865|ref|ZP_00683927.1| OmpA/MotB [Xylella fastidiosa Ann-1]
 gi|71728370|gb|EAO30539.1| OmpA/MotB [Xylella fastidiosa Ann-1]
          Length = 241

 Score = 90.9 bits (224), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 48/138 (34%), Positives = 79/138 (57%), Gaps = 2/138 (1%)

Query: 48  DKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKF 106
           D+ E   + +  +TGI V R GD IT  +P  ++F   +  L+ +F   L+ +A+ L ++
Sbjct: 93  DRQERALRERTANTGIDVKRDGDNITLNLPDGITFDFGKSMLKPQFYGALKNVASTLREY 152

Query: 107 PSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTN 166
             T+I +  +TDSIG+   N  +S++RA  + SYL  +GV   R + + G   +YPI  N
Sbjct: 153 NQTMIEVVGYTDSIGSDVVNQRLSEDRAGAVASYLAAQGVQRER-MEISGMGKRYPIADN 211

Query: 167 DTKVGRQNNQRIEIQIFP 184
            T+ GR  N+R+EI + P
Sbjct: 212 STEAGRSKNRRVEIHLIP 229


>gi|194365341|ref|YP_002027951.1| OmpA/MotB domain-containing protein [Stenotrophomonas maltophilia
           R551-3]
 gi|194348145|gb|ACF51268.1| OmpA/MotB domain protein [Stenotrophomonas maltophilia R551-3]
          Length = 231

 Score = 90.9 bits (224), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 57/181 (31%), Positives = 93/181 (51%), Gaps = 7/181 (3%)

Query: 5   LGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIV 64
           +G++  ++T     G ++ E+++  L  +    +     G   D+ E   + +  +TGI 
Sbjct: 54  IGVAAGLLT-----GDSATERRQHALIGAGIGALSGAAVGQYQDRQERALRERTANTGID 108

Query: 65  VSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTL 123
           V R GD I   +P  ++F   +  L+ +F   L  +A  L  +  T+I +  HTDSIG+ 
Sbjct: 109 VQRQGDNIMLNLPDGITFDFGKATLKPQFYGSLNGVAGTLRDYNQTMIEVVGHTDSIGSD 168

Query: 124 KNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
             N  +S+ERAD +  YL+ +GV S R I   G    YPI  N T  GR  N+R+EI++ 
Sbjct: 169 AVNNRLSKERADSVAQYLVGQGVQSVR-IETLGAGKSYPIADNSTDAGRAKNRRVEIRVI 227

Query: 184 P 184
           P
Sbjct: 228 P 228


>gi|260768688|ref|ZP_05877622.1| outer membrane protein [Vibrio furnissii CIP 102972]
 gi|260616718|gb|EEX41903.1| outer membrane protein [Vibrio furnissii CIP 102972]
          Length = 229

 Score = 90.9 bits (224), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 47/139 (33%), Positives = 83/139 (59%), Gaps = 3/139 (2%)

Query: 48  DKAEDEFQMQLQDTGIVVSRIGD-MITCYIPVHVSFVSEVF-LEKKFLPMLQLIATILNK 105
           D+ E   + +L ++G+ V R+G+  +   +   + F +  + L+      L+ +A IL +
Sbjct: 90  DQQEAALRQELLNSGVQVERVGENQLVLRMQNGIGFQTNSYQLDSSIHNTLRGVAKILVE 149

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +P T + I  HTDS G+   N ++S+ RA+ ++S+L+ +GV++ R I+ RG   +YP+ T
Sbjct: 150 YPDTSLVIDGHTDSTGSDTTNQILSERRAESVRSFLLSQGVAAGRAIA-RGNGERYPLCT 208

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T  GR  N+R+EIQI P
Sbjct: 209 NSTADGRSCNRRVEIQILP 227


>gi|315180390|gb|ADT87304.1| lipoprotein, hypothetical [Vibrio furnissii NCTC 11218]
          Length = 222

 Score = 90.9 bits (224), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 47/139 (33%), Positives = 83/139 (59%), Gaps = 3/139 (2%)

Query: 48  DKAEDEFQMQLQDTGIVVSRIGD-MITCYIPVHVSFVSEVF-LEKKFLPMLQLIATILNK 105
           D+ E   + +L ++G+ V R+G+  +   +   + F +  + L+      L+ +A IL +
Sbjct: 83  DQQEAALRQELLNSGVQVERVGENQLVLRMQNGIGFQTNSYQLDSSIHNTLRGVAKILVE 142

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +P T + I  HTDS G+   N ++S+ RA+ ++S+L+ +GV++ R I+ RG   +YP+ T
Sbjct: 143 YPDTSLVIDGHTDSTGSDTTNQILSERRAESVRSFLLSQGVAAGRAIA-RGNGERYPLCT 201

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T  GR  N+R+EIQI P
Sbjct: 202 NSTADGRSCNRRVEIQILP 220


>gi|262165460|ref|ZP_06033197.1| outer membrane protein [Vibrio mimicus VM223]
 gi|262025176|gb|EEY43844.1| outer membrane protein [Vibrio mimicus VM223]
          Length = 193

 Score = 90.9 bits (224), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 47/140 (33%), Positives = 84/140 (60%), Gaps = 3/140 (2%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGD-MITCYIPVHVSFVSEVF-LEKKFLPMLQLIATILN 104
            D+ E E +  L D+G+ V R+G+  +   +   + F S  + L+      L+ +A IL 
Sbjct: 53  FDQQEAELRKALLDSGVQVVRVGENQLMLRMENGIGFTSSSYQLDSYIHKTLRGVARILV 112

Query: 105 KFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPID 164
            +P T + I+ HTDS G+   N ++S++RA+ ++++L+ +GV++ R I+ RG   ++P+ 
Sbjct: 113 AYPDTSLVIEGHTDSTGSDTTNQVLSEKRAESVRAFLLSQGVAAGRAIA-RGNGERFPLC 171

Query: 165 TNDTKVGRQNNQRIEIQIFP 184
           +N T  GR  N+R+EIQI P
Sbjct: 172 SNSTAEGRACNRRVEIQILP 191


>gi|260599847|ref|YP_003212418.1| putative outer membrane lipoprotein [Cronobacter turicensis z3032]
 gi|260219024|emb|CBA34379.1| Inner membrane lipoprotein yiaD [Cronobacter turicensis z3032]
          Length = 220

 Score = 90.9 bits (224), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 47/139 (33%), Positives = 81/139 (58%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D  E + + ++Q TG+ V+R GD I   +P +V+F  S+  L+      L  +A +L +
Sbjct: 81  MDVQEAKLRQKMQGTGVSVTRSGDNIILNMPNNVTFDSSQANLKPAGANTLTGVAMVLKE 140

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +P T + +  +TDS G    N+ +SQ+RA+ + S LI +GV++NR I   G     P+ +
Sbjct: 141 YPKTAVNVVGYTDSTGGQALNMKLSQQRAESVASALITQGVAANR-IRTSGMGPANPVAS 199

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T+ G+  N+R+EI + P
Sbjct: 200 NSTEEGKAQNRRVEITLSP 218


>gi|15836965|ref|NP_297653.1| hypothetical protein XF0363 [Xylella fastidiosa 9a5c]
 gi|9105193|gb|AAF83173.1|AE003888_6 conserved hypothetical protein [Xylella fastidiosa 9a5c]
          Length = 242

 Score = 90.9 bits (224), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 48/138 (34%), Positives = 79/138 (57%), Gaps = 2/138 (1%)

Query: 48  DKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKF 106
           D+ E   + +  +TGI V R GD IT  +P  ++F   +  L+ +F   L+ +A+ L ++
Sbjct: 94  DRQERALRERTANTGIDVKRDGDNITLNLPDGITFDFGKSMLKPQFYGALKNVASTLREY 153

Query: 107 PSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTN 166
             T+I +  +TDSIG+   N  +S++RA  + SYL  +GV   R + + G   +YPI  N
Sbjct: 154 NQTMIEVVGYTDSIGSDVVNQRLSEDRAGAVASYLAGQGVQRER-MEISGMGKRYPIADN 212

Query: 167 DTKVGRQNNQRIEIQIFP 184
            T+ GR  N+R+EI + P
Sbjct: 213 STEAGRSKNRRVEIHLIP 230


>gi|237740687|ref|ZP_04571168.1| outer membrane protein [Fusobacterium sp. 2_1_31]
 gi|229422704|gb|EEO37751.1| outer membrane protein [Fusobacterium sp. 2_1_31]
          Length = 212

 Score = 90.9 bits (224), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 77/143 (53%), Gaps = 2/143 (1%)

Query: 43  FGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSE-VFLEKKFLPMLQLIAT 101
           +G+  D    E +  L+ T   V   G+ +   +P  V+F S+   +   F   L  +A 
Sbjct: 69  WGAYKDNQARELRAALKGTQAEVRNDGNALVVNLPGGVTFASDSANISSGFYSALNGVAQ 128

Query: 102 ILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKY 161
            L ++P T I +  +TDS G   +N  +SQ RA+ +  YLI +GVSS+R ++  GF    
Sbjct: 129 TLVRYPETRIQVNGYTDSTGGDAHNQELSQRRANSVAQYLISQGVSSSRIVA-NGFGSSN 187

Query: 162 PIDTNDTKVGRQNNQRIEIQIFP 184
           PI +N T  GRQ N+R+E++I P
Sbjct: 188 PIASNATPEGRQANRRVEVRILP 210


>gi|3493603|gb|AAC33455.1| outer membrane protein homolog [Vitreoscilla sp. C1]
          Length = 217

 Score = 90.9 bits (224), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 80/143 (55%), Gaps = 2/143 (1%)

Query: 43  FGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVF-LEKKFLPMLQLIAT 101
            G+ +D  E + +  L +T + V+R+GD I   +P  ++F +  + L       L  +++
Sbjct: 73  VGAYMDHQERQLRQSLANTQVEVNRVGDEIRLVMPESITFATGSYQLNSSASTSLNSVSS 132

Query: 102 ILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKY 161
           +L ++  T I I  HTDS G+   N  +S+ RA  + +YL+ R V+SNR  +V G   + 
Sbjct: 133 VLAQYTDTTINIVGHTDSTGSDAINEPLSRNRASAVANYLVSRNVASNRITTV-GAGCRQ 191

Query: 162 PIDTNDTKVGRQNNQRIEIQIFP 184
           P+ +N+T  GR  N+R+EI + P
Sbjct: 192 PVASNNTVAGRAENRRVEITVNP 214


>gi|170723577|ref|YP_001751265.1| OmpA/MotB domain-containing protein [Pseudomonas putida W619]
 gi|169761580|gb|ACA74896.1| OmpA/MotB domain protein [Pseudomonas putida W619]
          Length = 240

 Score = 90.9 bits (224), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 47/138 (34%), Positives = 77/138 (55%), Gaps = 2/138 (1%)

Query: 48  DKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSE-VFLEKKFLPMLQLIATILNKF 106
           DK E E + Q+ +TG+ V R GD I   +P +++F ++   +   F   L  +AT   +F
Sbjct: 88  DKQEAELRAQMANTGVEVQRQGDQIKLIMPGNITFATDSANIAPSFYSPLNNLATSFKQF 147

Query: 107 PSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTN 166
               I +   TDS G+ ++N+ +SQ RA  + +YL  +GV ++R +SVRG     PI +N
Sbjct: 148 NQNTIEVVGFTDSTGSRQHNMDLSQRRAQAVSAYLTSQGVDASR-VSVRGMGPDQPIASN 206

Query: 167 DTKVGRQNNQRIEIQIFP 184
               GR  N+R+E+ + P
Sbjct: 207 ADANGRAQNRRVEVNLKP 224


>gi|317046265|ref|YP_004113913.1| OmpA/MotB domain-containing protein [Pantoea sp. At-9b]
 gi|316947882|gb|ADU67357.1| OmpA/MotB domain protein [Pantoea sp. At-9b]
          Length = 220

 Score = 90.5 bits (223), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 47/141 (33%), Positives = 82/141 (58%), Gaps = 2/141 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D  E + + +++ TG+ V+R GD I   +P +V+F  S   L+      L  +A +L +
Sbjct: 81  MDVQEAKLRDKMRGTGVSVTRQGDNIVLNMPNNVTFDSSSSNLKPAGANTLTGVAMVLKE 140

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +P T + +  +TDS GT   N+ +SQ+RA+ + S LI +GV +NR +  +G     P+ +
Sbjct: 141 YPKTAVNVTGYTDSTGTRALNMRLSQQRAESVASALIVQGVEANR-LRTQGLGPDNPVAS 199

Query: 166 NDTKVGRQNNQRIEIQIFPRG 186
           N T+ G+  N+R+EI + P G
Sbjct: 200 NSTEAGKAQNRRVEITLTPLG 220


>gi|300719120|ref|YP_003743923.1| outer membrane protein [Erwinia billingiae Eb661]
 gi|299064956|emb|CAX62076.1| Putative outer membrane protein [Erwinia billingiae Eb661]
          Length = 220

 Score = 90.5 bits (223), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 46/139 (33%), Positives = 81/139 (58%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D  E + + +++ TG+ V+R GD I   +P +V+F  S   L+      L  +A +L +
Sbjct: 81  MDVQEAKLRDKMKGTGVSVTRQGDNIVLNMPNNVTFDSSSSTLKPAGANTLTGVAMVLKE 140

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +P T + +  +TDS G+ + N+ +SQ+RAD + S LI +GV++NR +   G     P+ +
Sbjct: 141 YPKTAVNVAGYTDSTGSRQLNMTLSQQRADSVGSALITQGVAANR-VRTSGMGPDNPVAS 199

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T  G+  N+R+EI + P
Sbjct: 200 NSTAEGKAQNRRVEITLSP 218


>gi|148979919|ref|ZP_01815777.1| outer membrane protein [Vibrionales bacterium SWAT-3]
 gi|145961523|gb|EDK26825.1| outer membrane protein [Vibrionales bacterium SWAT-3]
          Length = 221

 Score = 90.5 bits (223), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 47/139 (33%), Positives = 83/139 (59%), Gaps = 3/139 (2%)

Query: 48  DKAEDEFQMQLQDTGIVVSRIGD-MITCYIPVHVSFVSEVF-LEKKFLPMLQLIATILNK 105
           D+ E   + +L ++G+ V R+G+  +   +   + F S  + LE      L+ +A IL +
Sbjct: 82  DRQEAALREELMNSGVQVERVGENQLLLRLENGIGFDSGSYALESSIHNTLRGVARILVE 141

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +P T + I+ HTDS G+   N ++S+ RA+ ++++LI + V++ R I+ RG   +YP+  
Sbjct: 142 YPDTSLVIEGHTDSTGSESTNQILSERRAESVRAFLISQDVAAGRAIA-RGNGERYPLCD 200

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N+T  GR  N+R+EIQI P
Sbjct: 201 NNTSRGRACNRRVEIQILP 219


>gi|323497435|ref|ZP_08102453.1| putative outer membrane protein [Vibrio sinaloensis DSM 21326]
 gi|323317518|gb|EGA70511.1| putative outer membrane protein [Vibrio sinaloensis DSM 21326]
          Length = 222

 Score = 90.5 bits (223), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 48/139 (34%), Positives = 81/139 (58%), Gaps = 3/139 (2%)

Query: 48  DKAEDEFQMQLQDTGIVVSRIGD-MITCYIPVHVSFVSEVF-LEKKFLPMLQLIATILNK 105
           DK E+  + +L ++G+ V R+G+  +   +   + F +    L+      L  +A IL +
Sbjct: 83  DKQEEALRQELLNSGVQVERVGENQLLLRLENGIGFATASHTLDSGIRNTLNGVARILVE 142

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +P T + I   TDS G+   N L+S+ RA+ ++SYL+ +GV++ R I+ RG   ++P+ T
Sbjct: 143 YPDTSLVIDGFTDSTGSDTTNQLLSERRAESVRSYLVSQGVAAGRAIA-RGNGERHPLCT 201

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T  GR  N+R+EIQI P
Sbjct: 202 NSTAEGRACNRRVEIQILP 220


>gi|330447262|ref|ZP_08310912.1| ompA family protein [Photobacterium leiognathi subsp. mandapamensis
           svers.1.1.]
 gi|328491453|dbj|GAA05409.1| ompA family protein [Photobacterium leiognathi subsp. mandapamensis
           svers.1.1.]
          Length = 223

 Score = 90.5 bits (223), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 50/141 (35%), Positives = 81/141 (57%), Gaps = 2/141 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D  E + + QL  +GI V+R G+ I   +P  ++F   +  L  + +  L  +A +  +
Sbjct: 84  MDVQEAKLRQQLASSGISVTRDGNNIILNMPNEITFGFDQANLNDRAMNALHNVALVAKE 143

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +P T + +   TDS G    NL +SQ RAD + +YLI++GV++NR IS +G     PI +
Sbjct: 144 YPKTQLNVLGFTDSKGAASYNLRLSQVRADAVGNYLIRQGVNANRVIS-QGRGEANPIAS 202

Query: 166 NDTKVGRQNNQRIEIQIFPRG 186
           N T+ GR  N+R+EI + P G
Sbjct: 203 NSTENGRAQNRRVEIILSPLG 223


>gi|86147507|ref|ZP_01065818.1| outer membrane protein [Vibrio sp. MED222]
 gi|218709202|ref|YP_002416823.1| putative outer membrane protein [Vibrio splendidus LGP32]
 gi|85834675|gb|EAQ52822.1| outer membrane protein [Vibrio sp. MED222]
 gi|218322221|emb|CAV18335.1| putative outer membrane protein [Vibrio splendidus LGP32]
          Length = 222

 Score = 90.5 bits (223), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 47/139 (33%), Positives = 84/139 (60%), Gaps = 3/139 (2%)

Query: 48  DKAEDEFQMQLQDTGIVVSRIGD-MITCYIPVHVSFVSEVF-LEKKFLPMLQLIATILNK 105
           D+ E   + +L ++G+ V R+G+  +   +   + F S  + LE      L+ +A IL +
Sbjct: 83  DQQEAALREELMNSGVQVERVGENQLLLRLENGIGFDSGSYALESSIHKTLRGVARILVE 142

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +P T + I+ HTDS G+  +N ++S+ RA+ ++++LI + V++ R I+ RG   +YP+  
Sbjct: 143 YPDTSLVIEGHTDSTGSESSNQVLSERRAESVRAFLISQDVAAGRAIA-RGNGERYPLCD 201

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N+T  GR  N+R+EIQI P
Sbjct: 202 NNTSQGRACNRRVEIQILP 220


>gi|254506333|ref|ZP_05118476.1| outer membrane protein [Vibrio parahaemolyticus 16]
 gi|219550813|gb|EED27795.1| outer membrane protein [Vibrio parahaemolyticus 16]
          Length = 225

 Score = 90.1 bits (222), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 48/139 (34%), Positives = 83/139 (59%), Gaps = 3/139 (2%)

Query: 48  DKAEDEFQMQLQDTGIVVSRIGD-MITCYIPVHVSFVSEVFLEKKFLP-MLQLIATILNK 105
           D+ E   + +L ++G+ V R+G+  +   +   + F S  +     +   L+ +A IL +
Sbjct: 86  DQQEAALRQELLNSGVQVERVGENQLLLRLENGIGFSSSSYQLDSSIHNTLRGVARILVE 145

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +P T + I+ HTDS G+   N ++S+ RA+ ++SYL+ +GV++ R I+ RG   +YP+ T
Sbjct: 146 YPDTSLVIEGHTDSTGSDTTNQILSERRAESVRSYLVSQGVAAGRAIA-RGNGERYPLCT 204

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T  GR  N+R+EIQI P
Sbjct: 205 NSTAEGRACNRRVEIQILP 223


>gi|78047093|ref|YP_363268.1| OmpA family outer membrane lipoprotein [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|294626580|ref|ZP_06705178.1| OmpA family outer membrane lipoprotein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|294665669|ref|ZP_06730945.1| OmpA family outer membrane lipoprotein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
 gi|78035523|emb|CAJ23169.1| OmpA family outer membrane lipoprotein [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|292599147|gb|EFF43286.1| OmpA family outer membrane lipoprotein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|292604564|gb|EFF47939.1| OmpA family outer membrane lipoprotein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
          Length = 241

 Score = 90.1 bits (222), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 51/181 (28%), Positives = 95/181 (52%), Gaps = 7/181 (3%)

Query: 5   LGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIV 64
           +G++  ++T     G ++ E+++  +  +    +     G   D+ E   + +  +TGI 
Sbjct: 54  IGVAAGLLT-----GDSATERRQHAMVGAGIGALSGAAIGQYQDRQERALRERTANTGIE 108

Query: 65  VSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTL 123
           V R GD I+  +P  ++F   +  L+ +F   L  +A+ L ++  T++ +  HTDS+G+ 
Sbjct: 109 VQRQGDNISLNLPDGITFDFGKSALKPQFYTALNGVASTLREYNQTMVEVVGHTDSVGSD 168

Query: 124 KNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
             N  +S+ERA  +  YL  +GV   R  ++ G   +YPI  N T  GR  N+R+EI++ 
Sbjct: 169 AVNQRLSEERASAVAQYLTAQGVQRERMETM-GAGKRYPIADNTTDAGRAKNRRVEIRLI 227

Query: 184 P 184
           P
Sbjct: 228 P 228


>gi|332185595|ref|ZP_08387343.1| rickettsia 17 kDa surface antigen family protein [Sphingomonas sp.
           S17]
 gi|332014573|gb|EGI56630.1| rickettsia 17 kDa surface antigen family protein [Sphingomonas sp.
           S17]
          Length = 225

 Score = 90.1 bits (222), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 49/139 (35%), Positives = 75/139 (53%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEV-FLEKKFLPMLQLIATILNK 105
           +DK E + + +   T + V R GD +   +P  ++F  +   ++ +F   L  +A IL++
Sbjct: 81  MDKQERDLRARTAGTDVQVVRQGDDLLLNLPSGITFAYDSSTVQPQFRQTLDQVADILSQ 140

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +  T I +  HTDS G+   N  +S+ RA  +  YL  RGV   R I  RGF    PI +
Sbjct: 141 YKQTYIDVYGHTDSTGSDSYNQALSERRAVAVADYLASRGVQPAR-IGTRGFGKSQPIAS 199

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           NDT  GR  N+R+EI+I P
Sbjct: 200 NDTDAGRAANRRVEIKIVP 218


>gi|325928737|ref|ZP_08189907.1| outer membrane protein/peptidoglycan-associated (lipo)protein
           [Xanthomonas perforans 91-118]
 gi|325540905|gb|EGD12477.1| outer membrane protein/peptidoglycan-associated (lipo)protein
           [Xanthomonas perforans 91-118]
          Length = 229

 Score = 90.1 bits (222), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 51/181 (28%), Positives = 95/181 (52%), Gaps = 7/181 (3%)

Query: 5   LGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIV 64
           +G++  ++T     G ++ E+++  +  +    +     G   D+ E   + +  +TGI 
Sbjct: 42  IGVAAGLLT-----GDSATERRQHAMVGAGIGALSGAAIGQYQDRQERALRERTANTGIE 96

Query: 65  VSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTL 123
           V R GD I+  +P  ++F   +  L+ +F   L  +A+ L ++  T++ +  HTDS+G+ 
Sbjct: 97  VQRQGDNISLNLPDGITFDFGKSALKPQFYTALNGVASTLREYNQTMVEVVGHTDSVGSD 156

Query: 124 KNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
             N  +S+ERA  +  YL  +GV   R  ++ G   +YPI  N T  GR  N+R+EI++ 
Sbjct: 157 AVNQRLSEERASAVAQYLTAQGVQRERMETM-GAGKRYPIADNTTDAGRAKNRRVEIRLI 215

Query: 184 P 184
           P
Sbjct: 216 P 216


>gi|119944065|ref|YP_941745.1| OmpA/MotB domain-containing protein [Psychromonas ingrahamii 37]
 gi|119862669|gb|ABM02146.1| OmpA/MotB domain protein [Psychromonas ingrahamii 37]
          Length = 215

 Score = 90.1 bits (222), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 47/140 (33%), Positives = 81/140 (57%), Gaps = 3/140 (2%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDM-ITCYIPVHVSFVSEVF-LEKKFLPMLQLIATILN 104
            D+ E   + +L ++G+ V R+G+  +   +   + F +  + L       L  +A +LN
Sbjct: 76  FDQQEAALRQELLNSGVQVKRVGEYELQLIMADGIGFDTGNYQLSGSIFSTLNGVAKVLN 135

Query: 105 KFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPID 164
           ++P + + I  HTDS+G+ ++NL +S+ RA+ + +YL+QR V S R +S  G+  + PI 
Sbjct: 136 EYPKSSLRIIGHTDSVGSSESNLTLSERRAESVSNYLMQRNVKSGR-LSTLGYGERRPIA 194

Query: 165 TNDTKVGRQNNQRIEIQIFP 184
           TNDT  GR  N+R+EI I  
Sbjct: 195 TNDTPYGRAANRRVEINIIA 214


>gi|293393749|ref|ZP_06638056.1| OmpA family protein [Serratia odorifera DSM 4582]
 gi|291423576|gb|EFE96798.1| OmpA family protein [Serratia odorifera DSM 4582]
          Length = 220

 Score = 89.7 bits (221), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 47/139 (33%), Positives = 82/139 (58%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEV-FLEKKFLPMLQLIATILNK 105
           +D  E + + +++ TG+ V+R GD I   +P +V+F ++   L+      L  +A +L +
Sbjct: 81  MDVQEAKLRDKMRGTGVSVTRQGDNIVLNMPNNVTFDTDSSTLKPAGANTLTGVAMVLKE 140

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +P T + +  +TDS G   +N+ +SQ+RAD + S LI +GV++NR I  +G     PI +
Sbjct: 141 YPKTAVNVVGYTDSTGARAHNMTLSQQRADGVASALITQGVAANR-IRTQGAGPDNPIAS 199

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T  G+  N+R+EI + P
Sbjct: 200 NSTTEGKAQNRRVEITLSP 218


>gi|262039107|ref|ZP_06012440.1| inner membrane lipoprotein YiaD [Leptotrichia goodfellowii F0264]
 gi|261746896|gb|EEY34402.1| inner membrane lipoprotein YiaD [Leptotrichia goodfellowii F0264]
          Length = 164

 Score = 89.7 bits (221), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 50/141 (35%), Positives = 78/141 (55%), Gaps = 3/141 (2%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGD-MITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILN 104
            D+ E E + +L  +G+ V R G+  I    P +++F  +   ++ +F   L  +A +L 
Sbjct: 25  FDRQEKELKNRLDGSGVKVERTGEGEIKLTAPENITFDTNSSVIKSRFTGSLNSVADVLK 84

Query: 105 KFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPID 164
           K+P + I +  HTDS G    N  +S  RA  +KSYL+  GV S+R  SV G+  K PI 
Sbjct: 85  KYPDSNIIVSGHTDSTGNDSINNPLSVNRAASVKSYLVGAGVPSSRITSV-GYGSKEPIA 143

Query: 165 TNDTKVGRQNNQRIEIQIFPR 185
           +N T  GR  N+R+EI+I  +
Sbjct: 144 SNSTANGRAQNRRVEIKIVAK 164


>gi|157368311|ref|YP_001476300.1| putative outer membrane lipoprotein [Serratia proteamaculans 568]
 gi|157320075|gb|ABV39172.1| OmpA/MotB domain protein [Serratia proteamaculans 568]
          Length = 220

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 48/139 (34%), Positives = 80/139 (57%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D  E + + +++ TG+ V+R GD I   +P +V+F  S   L+      L  +A +L +
Sbjct: 81  MDVQEAKLRDKMKGTGVSVTRQGDNIVLNMPNNVTFDSSSATLKPAGANTLTGVAMVLKE 140

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +P T + I  +TDS G+   N+ +SQ+RAD + S LI +GV++NR +   G     PI +
Sbjct: 141 YPKTAVNIIGYTDSTGSRALNMTLSQQRADGVGSALITQGVAANR-VRTSGAGPDNPIAS 199

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T  G+  N+R+EI + P
Sbjct: 200 NSTTEGKAQNRRVEITLSP 218


>gi|84391232|ref|ZP_00991563.1| outer membrane protein [Vibrio splendidus 12B01]
 gi|84376521|gb|EAP93399.1| outer membrane protein [Vibrio splendidus 12B01]
          Length = 222

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 47/139 (33%), Positives = 83/139 (59%), Gaps = 3/139 (2%)

Query: 48  DKAEDEFQMQLQDTGIVVSRIGD-MITCYIPVHVSFVSEVF-LEKKFLPMLQLIATILNK 105
           D+ E   + +L ++G+ V R+G+  +   +   + F S  + LE      L+ +A IL +
Sbjct: 83  DQQEAALREELMNSGVQVERVGENQLLLRLENGIGFGSGSYALESSIHNTLRGVARILVE 142

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +P T + I  HTDS G+  +N ++S+ RA+ ++++LI + V++ R I+ RG   +YP+  
Sbjct: 143 YPDTSLVIDGHTDSTGSESSNQILSERRAESVRAFLISQDVAAGRAIA-RGNGERYPLCD 201

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N+T  GR  N+R+EIQI P
Sbjct: 202 NNTSQGRACNRRVEIQILP 220


>gi|304311338|ref|YP_003810936.1| Putative outer membrane protein [gamma proteobacterium HdN1]
 gi|301797071|emb|CBL45284.1| Putative outer membrane protein [gamma proteobacterium HdN1]
          Length = 208

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 45/138 (32%), Positives = 81/138 (58%), Gaps = 2/138 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVS-EVFLEKKFLPMLQLIATILNK 105
            D+ E + +  L +TG+ V+R  + I   +P  +SF S +  L   F P+L+ +A +L +
Sbjct: 70  FDRQEAKLRETLNNTGVSVTRTPEGIKLNMPGAISFPSNQSGLMPSFYPVLESVALVLKE 129

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           F +T I +  HTDS G  + N  +S++RA+ + ++L  +GV+  R + V G+  +YP+  
Sbjct: 130 FNNTAIKVSGHTDSTGGAELNQRLSEQRAESVAAFLSGQGVARAR-MQVYGYGPRYPVAD 188

Query: 166 NDTKVGRQNNQRIEIQIF 183
           N ++ G+  N+R+EI I 
Sbjct: 189 NKSEAGKAANRRVEIDIL 206


>gi|91792625|ref|YP_562276.1| OmpA/MotB [Shewanella denitrificans OS217]
 gi|91714627|gb|ABE54553.1| OmpA/MotB [Shewanella denitrificans OS217]
          Length = 223

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 55/163 (33%), Positives = 86/163 (52%), Gaps = 2/163 (1%)

Query: 23  REKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF 82
           +++ K  L  +     V    G  +D  E + + QL+ TG+ V+R GD I   +P  V+F
Sbjct: 60  KDRAKGALIGAASGAAVGTGIGYYMDVQEAKLRKQLKSTGVSVTRSGDNIILNMPNDVTF 119

Query: 83  -VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYL 141
            V E  L  +   +L  +A +  +F  T + I  +TDS G+   NL +SQ RA+ +  YL
Sbjct: 120 GVDETVLSSRAKEVLASVALVAKEFDDTRLHITGYTDSSGSDSYNLRLSQVRANEVGQYL 179

Query: 142 IQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           +Q+ V++NR +S  G     PI  N T  GR  N+R+EI + P
Sbjct: 180 MQQKVAANRVVS-SGRGESSPIADNGTPAGRAQNRRVEIVLSP 221


>gi|330504866|ref|YP_004381735.1| OmpA/MotB domain-containing protein [Pseudomonas mendocina NK-01]
 gi|328919152|gb|AEB59983.1| OmpA/MotB domain-containing protein [Pseudomonas mendocina NK-01]
          Length = 222

 Score = 89.0 bits (219), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 44/138 (31%), Positives = 76/138 (55%), Gaps = 2/138 (1%)

Query: 48  DKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSE-VFLEKKFLPMLQLIATILNKF 106
           DK E+E +  +Q TG+ V R GD+I   +P +++F ++   +   F   L  +A    ++
Sbjct: 81  DKQEEELRRSMQGTGVEVQRQGDVIQLIMPGNITFATDSAQIASSFYQPLNNLANSFRQY 140

Query: 107 PSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTN 166
               I +  HTDS G+  +N+ +SQ RA  +  YL+ +G+  +R +S RG     P+ +N
Sbjct: 141 NQNSIEVVGHTDSTGSHSHNMALSQRRAQSVADYLLAQGIDPSR-VSTRGMGPDQPVASN 199

Query: 167 DTKVGRQNNQRIEIQIFP 184
            T  GR  N+R+E+ + P
Sbjct: 200 ATADGRAQNRRVEVTLRP 217


>gi|146309839|ref|YP_001174913.1| putative outer membrane lipoprotein [Enterobacter sp. 638]
 gi|145316715|gb|ABP58862.1| OmpA/MotB domain protein [Enterobacter sp. 638]
          Length = 220

 Score = 89.0 bits (219), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 48/139 (34%), Positives = 80/139 (57%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D  E + + ++Q TG+ V+R GD I   +P +V+F  S   L+      L  +A +L +
Sbjct: 81  MDVQEAKLRDKMQGTGVSVTRNGDNIILNMPSNVTFDSSSATLKPAGANTLTGVAMVLKE 140

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +  T + +  +TDS G+   N+ +SQ+RAD + S LI +GV++NR I   G     PI +
Sbjct: 141 YSKTAVNVIGYTDSTGSQDLNMRLSQQRADSVASSLITQGVAANR-IRTSGMGPANPIAS 199

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N+T  G+  N+R+EI + P
Sbjct: 200 NNTAEGKAQNRRVEITLSP 218


>gi|225024888|ref|ZP_03714080.1| hypothetical protein EIKCOROL_01776 [Eikenella corrodens ATCC
           23834]
 gi|224942346|gb|EEG23555.1| hypothetical protein EIKCOROL_01776 [Eikenella corrodens ATCC
           23834]
          Length = 219

 Score = 89.0 bits (219), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 47/139 (33%), Positives = 76/139 (54%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVS-EVFLEKKFLPMLQLIATILNK 105
           +D  E+  + +L +T + V R GD I   +P  V+F +    L    +  L  +A +L +
Sbjct: 75  MDVQENRLRQELANTPVEVQRQGDQIKLTMPSGVTFATNSSSLSPDAVNSLNTVANVLTQ 134

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +P T I +  HTD+ G  + N  +S+ RA  +  YL  RGV+++R IS  G+  + P+  
Sbjct: 135 YPETTITVAGHTDNTGNDRINNPLSKNRARSVAGYLTGRGVAASR-ISTVGYGSRSPVAD 193

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T+ GR  N+R+EI I P
Sbjct: 194 NSTESGRAQNRRVEILINP 212


>gi|307547058|ref|YP_003899537.1| OmpA/MotB domain protein [Halomonas elongata DSM 2581]
 gi|307219082|emb|CBV44352.1| OmpA/MotB domain protein [Halomonas elongata DSM 2581]
          Length = 223

 Score = 89.0 bits (219), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 46/139 (33%), Positives = 75/139 (53%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D+ E + +  +Q TGI V R G+ I   +P  V+F      L       L  ++ +L +
Sbjct: 82  MDRQEQQLRSSMQGTGIGVERQGNDIVLNMPSEVTFGFDSSDLTPAATSALNDVSNVLTQ 141

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +  T I I  HTDS G    N  +S+ RA  +  YL Q GVS+ R ++++G+    P+ +
Sbjct: 142 YTDTRINIAGHTDSTGDAGYNQRLSERRAQAVGQYLSQSGVSAGR-LNMQGYGENQPVAS 200

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           NDT+ GR  N+R+E+ + P
Sbjct: 201 NDTEAGRAQNRRVEMTLTP 219


>gi|237745869|ref|ZP_04576349.1| OmpA/MotB domain-containing protein [Oxalobacter formigenes HOxBLS]
 gi|229377220|gb|EEO27311.1| OmpA/MotB domain-containing protein [Oxalobacter formigenes HOxBLS]
          Length = 218

 Score = 89.0 bits (219), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 52/146 (35%), Positives = 83/146 (56%), Gaps = 3/146 (2%)

Query: 43  FGSSLDKAEDEFQMQLQDTGIVVSRIGD-MITCYIPVHVSFVS-EVFLEKKFLPMLQLIA 100
           +G+ ++K + E Q   Q TG+ V +  D  I   IP  VSF +    +  +F  +L+ +A
Sbjct: 73  WGNHMEKQKQEMQTATQGTGVEVVQTSDNQIKVSIPSDVSFATNSATISPQFKTILRDLA 132

Query: 101 TILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYK 160
           T L   PST I +  +TD+ G+   N  +S+ERA  +++YL+ +GV++NRF +V G    
Sbjct: 133 TTLKNNPSTSITVIGYTDNTGSDAINQPLSRERAMSVRNYLVSQGVAANRF-TVEGRGSS 191

Query: 161 YPIDTNDTKVGRQNNQRIEIQIFPRG 186
            PI +N T  GR  N+R+EI +  R 
Sbjct: 192 DPIASNLTAAGRAENRRVEIYVGERA 217


>gi|311277523|ref|YP_003939754.1| OmpA/MotB domain-containing protein [Enterobacter cloacae SCF1]
 gi|308746718|gb|ADO46470.1| OmpA/MotB domain protein [Enterobacter cloacae SCF1]
          Length = 220

 Score = 89.0 bits (219), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 48/139 (34%), Positives = 79/139 (56%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D  E + + ++Q TG+ V+R GD I   +P +V+F  S   L+      L  +A +L +
Sbjct: 81  MDVQEAKLRQKMQGTGVSVTRSGDNIILNMPNNVTFDSSSANLKPAGANTLTGVAMVLKE 140

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +  T + +  +TDS G+   N+ +SQ+RAD + S LI +GV++NR I   G     PI +
Sbjct: 141 YEKTAVNVVGYTDSTGSKDLNMRLSQQRADSVASSLITQGVAANR-IRTTGMGQANPIAS 199

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T  G+  N+R+EI + P
Sbjct: 200 NSTAEGKAQNRRVEITLSP 218


>gi|270264140|ref|ZP_06192407.1| hypothetical protein SOD_g00710 [Serratia odorifera 4Rx13]
 gi|270041789|gb|EFA14886.1| hypothetical protein SOD_g00710 [Serratia odorifera 4Rx13]
          Length = 219

 Score = 89.0 bits (219), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 48/139 (34%), Positives = 80/139 (57%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D  E + + +++ TG+ V+R GD I   +P +V+F  S   L+      L  +A +L +
Sbjct: 80  MDVQEAKLRDKMKGTGVSVTRQGDNIVLNMPNNVTFDSSSATLKPAGANTLTGVAMVLKE 139

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +P T + +  +TDS G+   N+ +SQ+RAD + S LI +GV++NR I   G     PI +
Sbjct: 140 YPKTAVNVIGYTDSSGSRALNMTLSQQRADGVGSALITQGVAANR-IRTSGAGPDNPIAS 198

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T  G+  N+R+EI + P
Sbjct: 199 NSTAEGKAQNRRVEITLSP 217


>gi|26987509|ref|NP_742934.1| OmpA/MotB domain protein [Pseudomonas putida KT2440]
 gi|24982176|gb|AAN66398.1|AE016267_7 OmpA family protein [Pseudomonas putida KT2440]
          Length = 236

 Score = 89.0 bits (219), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 47/138 (34%), Positives = 76/138 (55%), Gaps = 2/138 (1%)

Query: 48  DKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSE-VFLEKKFLPMLQLIATILNKF 106
           DK E E + Q+ +TG+ V R GD I   +P +++F ++   +   F   L  +A    +F
Sbjct: 84  DKQEAELRAQMANTGVEVQRQGDQIKLIMPGNITFATDSANIAPSFYSPLNNLAGSFKQF 143

Query: 107 PSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTN 166
               I +   TDS G+ ++N+ +SQ RA  + +YL  +GV ++R ISVRG     PI +N
Sbjct: 144 NQNTIEVVGFTDSTGSRQHNMDLSQRRAQAVSTYLTSQGVDASR-ISVRGMGPDQPIASN 202

Query: 167 DTKVGRQNNQRIEIQIFP 184
               GR  N+R+E+ + P
Sbjct: 203 ADANGRAQNRRVEVNLKP 220


>gi|148546044|ref|YP_001266146.1| OmpA/MotB domain-containing protein [Pseudomonas putida F1]
 gi|148510102|gb|ABQ76962.1| OmpA/MotB domain protein [Pseudomonas putida F1]
          Length = 247

 Score = 89.0 bits (219), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 47/138 (34%), Positives = 76/138 (55%), Gaps = 2/138 (1%)

Query: 48  DKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSE-VFLEKKFLPMLQLIATILNKF 106
           DK E E + Q+ +TG+ V R GD I   +P +++F ++   +   F   L  +A    +F
Sbjct: 95  DKQEAELRAQMANTGVEVQRQGDQIKLIMPGNITFATDSANIAPSFYSPLNNLAGSFKQF 154

Query: 107 PSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTN 166
               I +   TDS G+ ++N+ +SQ RA  + +YL  +GV ++R ISVRG     PI +N
Sbjct: 155 NQNTIEVVGFTDSTGSRQHNMDLSQRRAQAVSTYLTSQGVDASR-ISVRGMGPDQPIASN 213

Query: 167 DTKVGRQNNQRIEIQIFP 184
               GR  N+R+E+ + P
Sbjct: 214 ADANGRAQNRRVEVNLKP 231


>gi|313497139|gb|ADR58505.1| OmpA/MotB domain-containing protein [Pseudomonas putida BIRD-1]
          Length = 239

 Score = 89.0 bits (219), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 47/138 (34%), Positives = 76/138 (55%), Gaps = 2/138 (1%)

Query: 48  DKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSE-VFLEKKFLPMLQLIATILNKF 106
           DK E E + Q+ +TG+ V R GD I   +P +++F ++   +   F   L  +A    +F
Sbjct: 87  DKQEAELRAQMANTGVEVQRQGDQIKLIMPGNITFATDSANIAPSFYSPLNNLAGSFKQF 146

Query: 107 PSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTN 166
               I +   TDS G+ ++N+ +SQ RA  + +YL  +GV ++R ISVRG     PI +N
Sbjct: 147 NQNTIEVVGFTDSTGSRQHNMDLSQRRAQAVSTYLTSQGVDASR-ISVRGMGPDQPIASN 205

Query: 167 DTKVGRQNNQRIEIQIFP 184
               GR  N+R+E+ + P
Sbjct: 206 ADANGRAQNRRVEVNLKP 223


>gi|295691294|ref|YP_003594987.1| OmpA/MotB domain-containing protein [Caulobacter segnis ATCC 21756]
 gi|295433197|gb|ADG12369.1| OmpA/MotB domain protein [Caulobacter segnis ATCC 21756]
          Length = 224

 Score = 89.0 bits (219), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 45/142 (31%), Positives = 77/142 (54%), Gaps = 1/142 (0%)

Query: 44  GSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATI 102
           G+ +D+ + +F+  L+ +G+++ R GD I   +P  V+F V    ++ +F+ +L  +A  
Sbjct: 80  GNYMDRQQADFRRSLEGSGVMIRRNGDQIVLVMPSDVTFDVDRSDIQPRFVRVLDDVART 139

Query: 103 LNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYP 162
           LN +P T I +  H DS G  + N ++S+ RA  +  YL  +G      + V G   + P
Sbjct: 140 LNAYPQTTIDVVGHADSSGADEYNQVLSERRASAVAGYLTSQGRVLPDRVFVAGMGERQP 199

Query: 163 IDTNDTKVGRQNNQRIEIQIFP 184
           I  N T  GR  N+R+EI + P
Sbjct: 200 IADNSTAAGRAENRRVEIVLRP 221


>gi|167031827|ref|YP_001667058.1| OmpA/MotB domain-containing protein [Pseudomonas putida GB-1]
 gi|166858315|gb|ABY96722.1| OmpA/MotB domain protein [Pseudomonas putida GB-1]
          Length = 240

 Score = 89.0 bits (219), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 47/138 (34%), Positives = 76/138 (55%), Gaps = 2/138 (1%)

Query: 48  DKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSE-VFLEKKFLPMLQLIATILNKF 106
           DK E E + Q+ +TG+ V R GD I   +P +++F ++   +   F   L  +A    +F
Sbjct: 87  DKQEAELRAQMANTGVEVQRQGDQIKLIMPGNITFATDSANIAPSFYSPLNNLAGSFKQF 146

Query: 107 PSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTN 166
               I +   TDS G+ ++N+ +SQ RA  + +YL  +GV ++R ISVRG     PI +N
Sbjct: 147 NQNTIEVVGFTDSTGSRQHNMDLSQRRAQAVSTYLTSQGVDASR-ISVRGMGPDQPIASN 205

Query: 167 DTKVGRQNNQRIEIQIFP 184
               GR  N+R+E+ + P
Sbjct: 206 ADANGRAQNRRVEVNLKP 223


>gi|332143465|ref|YP_004429203.1| Outer membrane protein and related peptidoglycan-associated
           (lipo)protein [Alteromonas macleodii str. 'Deep
           ecotype']
 gi|327553487|gb|AEB00206.1| Outer membrane protein and related peptidoglycan-associated
           (lipo)protein [Alteromonas macleodii str. 'Deep
           ecotype']
          Length = 213

 Score = 89.0 bits (219), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 46/139 (33%), Positives = 79/139 (56%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSE-VFLEKKFLPMLQLIATILNK 105
           +DK E+E + +L DTG+ V R GD +   +P  ++F ++   +   F P+LQ +A ++N 
Sbjct: 70  MDKQEEELRTELSDTGVQVVREGDNLRLIMPGDITFATDSASISPNFNPVLQDVAKVVNN 129

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +  TV+ I+ HTD  G+ + N  +S+ RA  +K+ LI   V+  R  +V G     P   
Sbjct: 130 YEKTVLMIKGHTDDTGSEQYNQSLSERRAGAVKNLLINYSVNPTRITTV-GMGEYSPKVP 188

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N++   R  N+R+E++I P
Sbjct: 189 NNSAANRSMNRRVEMEIQP 207


>gi|209809526|ref|YP_002265064.1| outer membrane protein, OmpA family [Aliivibrio salmonicida
           LFI1238]
 gi|208011088|emb|CAQ81507.1| outer membrane protein, OmpA family [Aliivibrio salmonicida
           LFI1238]
          Length = 222

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 47/139 (33%), Positives = 79/139 (56%), Gaps = 3/139 (2%)

Query: 48  DKAEDEFQMQLQDTGIVVSRIGD-MITCYIPVHVSFVSEVF-LEKKFLPMLQLIATILNK 105
           D  E   + +L+ +G+ V R+GD  +   +   V F S  + L+      L  +A IL +
Sbjct: 83  DSQEQALRDELKSSGVQVERVGDNELKLIMDNGVGFQSSSYQLDASIYNTLNGVARILVE 142

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +P T + I  HTDS G    N  +S++RA+ +++YLI++ V++ R ++ RG+  +YP+  
Sbjct: 143 YPDTALQIDGHTDSSGNDTKNQTLSEQRAESVRTYLIKQKVAAGR-VNARGYGERYPVFD 201

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T  GR  N+R+EI I P
Sbjct: 202 NSTSQGRACNRRVEITILP 220


>gi|90581117|ref|ZP_01236916.1| Putative OmpA family protein [Vibrio angustum S14]
 gi|90437638|gb|EAS62830.1| Putative OmpA family protein [Vibrio angustum S14]
          Length = 229

 Score = 88.6 bits (218), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 49/141 (34%), Positives = 79/141 (56%), Gaps = 2/141 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D  E + + QL  +GI V+R GD I   +P  ++F   +  L  + +  L  +A +  +
Sbjct: 90  MDVQEAKLRKQLSSSGITVTRNGDNIVLNMPNEITFGFDQANLNDRAMNALHNVAIVAKE 149

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +  T + +   TDS G    NL +SQ RAD + +YLI++GV++NR +S +G     PI +
Sbjct: 150 YEKTQLNVLGFTDSKGAASYNLRLSQVRADAVANYLIRQGVNANRVVS-QGRGESNPIAS 208

Query: 166 NDTKVGRQNNQRIEIQIFPRG 186
           N T  GR  N+R+EI + P G
Sbjct: 209 NSTANGRAQNRRVEIILSPLG 229


>gi|312884493|ref|ZP_07744197.1| putative lipoprotein [Vibrio caribbenthicus ATCC BAA-2122]
 gi|309367805|gb|EFP95353.1| putative lipoprotein [Vibrio caribbenthicus ATCC BAA-2122]
          Length = 222

 Score = 88.6 bits (218), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 47/139 (33%), Positives = 82/139 (58%), Gaps = 3/139 (2%)

Query: 48  DKAEDEFQMQLQDTGIVVSRIGD-MITCYIPVHVSFVS-EVFLEKKFLPMLQLIATILNK 105
           D+ E   + +L ++G+ V R G+  +   +   + F S    L+      L+ +A IL +
Sbjct: 83  DQQEAALRKELLNSGVQVERTGENQLRLRMENGIGFSSGSSTLDNSIHKTLRGVARILVE 142

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +P T + I+ +TDS G+ + N ++S++RA+ ++ YL+ +GV+  R +S RG   + PI T
Sbjct: 143 YPETSLVIEGNTDSTGSDRTNQILSEKRAESVRGYLVGQGVAPGRAVS-RGLGERQPICT 201

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N TK GR  N+R+EI+I P
Sbjct: 202 NSTKEGRACNRRVEIKILP 220


>gi|332995852|gb|AEF05907.1| outer membrane protein and related peptidoglycan-associated
           (lipo)protein [Alteromonas sp. SN2]
          Length = 202

 Score = 88.2 bits (217), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 46/139 (33%), Positives = 79/139 (56%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVF-LEKKFLPMLQLIATILNK 105
           +DK E+  + +L DTG+ V R GD +   +P  ++F ++   +   F P+LQ +A ++N 
Sbjct: 61  MDKQEEALRSELSDTGVQVVREGDNLRLIMPGDITFATDSSSISPNFNPVLQDVAKVVNN 120

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +  TV+ I+ HTD  G+ + N  +S+ RA  +++ L+   V+S R  +V G     P   
Sbjct: 121 YEKTVLMIKGHTDDTGSEQYNQGLSERRAGAVRNVLLNYSVNSTRITTV-GMGEYQPKVP 179

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           NDT   R  N+R+E++I P
Sbjct: 180 NDTAANRSMNRRVELEIQP 198


>gi|261341826|ref|ZP_05969684.1| hypothetical protein ENTCAN_08313 [Enterobacter cancerogenus ATCC
           35316]
 gi|288316202|gb|EFC55140.1| OmpA family protein [Enterobacter cancerogenus ATCC 35316]
          Length = 220

 Score = 88.2 bits (217), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 48/139 (34%), Positives = 79/139 (56%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D  E + + ++Q TG+ V+R GD I   +P +V+F  S   L+      L  +A +L +
Sbjct: 81  MDVQEAKLRDKMQGTGVSVTRSGDNIILNMPNNVTFDSSSATLKPAGANTLTGVAMVLKE 140

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +  T + +  +TDS G+   N+ +SQ+RAD + S LI +GV++NR I   G     PI +
Sbjct: 141 YSKTAVNVIGYTDSTGSQDLNMRLSQQRADSVASALITQGVAANR-IRTSGMGPANPIAS 199

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T  G+  N+R+EI + P
Sbjct: 200 NSTAEGKAQNRRVEITLSP 218


>gi|89092082|ref|ZP_01165037.1| hypothetical protein MED92_07941 [Oceanospirillum sp. MED92]
 gi|89083817|gb|EAR63034.1| hypothetical protein MED92_07941 [Oceanospirillum sp. MED92]
          Length = 218

 Score = 88.2 bits (217), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 78/137 (56%), Gaps = 2/137 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D+ E   + +L+ TG+ V RIGD I   +P +++F ++   +   F  +L  +A +L K
Sbjct: 78  MDQQEALLRQELEGTGVRVERIGDSIRLIMPGNITFALNSDQIAPSFYSVLDSVAKVLVK 137

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           F  T + +   TDS G+ + N  +S+ RA  +  YL+  G+S  R I+ +G+  +YPI  
Sbjct: 138 FDQTELNVDGFTDSTGSFEYNQQLSERRAARVGDYLVSSGISRLR-INAKGYGERYPIAD 196

Query: 166 NDTKVGRQNNQRIEIQI 182
           N T  GR  N+R+EI I
Sbjct: 197 NKTAAGRAQNRRVEINI 213


>gi|283787805|ref|YP_003367670.1| outer membrane protein [Citrobacter rodentium ICC168]
 gi|282951259|emb|CBG90953.1| putative outer membrane protein [Citrobacter rodentium ICC168]
          Length = 220

 Score = 88.2 bits (217), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 48/139 (34%), Positives = 77/139 (55%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D  E + + ++Q TG+ V+R GD I   +P +V+F  S   L+      L  +A +L +
Sbjct: 81  MDVQEAKLRDKMQGTGVSVTRSGDNIILNMPNNVTFDSSSATLKPAGANTLTGVAMVLKE 140

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +P T + +  +TDS G    N+ +SQ+RAD + S LI +GV + R I   G     PI +
Sbjct: 141 YPKTAVNVIGYTDSTGGQDLNMRLSQQRADSVASALITQGVEAGR-IRTSGMGPANPIAS 199

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T  G+  N+R+EI + P
Sbjct: 200 NSTAEGKAQNRRVEITLSP 218


>gi|326386301|ref|ZP_08207925.1| OmpA/MotB [Novosphingobium nitrogenifigens DSM 19370]
 gi|326209526|gb|EGD60319.1| OmpA/MotB [Novosphingobium nitrogenifigens DSM 19370]
          Length = 229

 Score = 88.2 bits (217), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 50/144 (34%), Positives = 80/144 (55%), Gaps = 4/144 (2%)

Query: 44  GSSLDKAEDEFQMQLQDTGIVVSRI--GDMITCYIPVHVSFVSE-VFLEKKFLPMLQLIA 100
           G ++DK   E + +   +G+ V  +  G  I   +P  V+F ++   ++  F   L  +A
Sbjct: 75  GYTMDKQIKELKEKTAGSGVDVKSVDDGQAILVNLPSGVTFDTDSTVIKPGFRDTLDKVA 134

Query: 101 TILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYK 160
             LN++P+++I +  HTDS G+   N  +S+ RA V+  YL  +GVSS R  S  GF   
Sbjct: 135 DSLNRYPNSLIDVYGHTDSTGSDAYNQTLSENRARVVADYLSSKGVSSARIRST-GFGKT 193

Query: 161 YPIDTNDTKVGRQNNQRIEIQIFP 184
            P+ +NDT  GR  N+R+EI+I P
Sbjct: 194 QPVASNDTPEGRAANRRVEIKIVP 217


>gi|90416505|ref|ZP_01224436.1| ompA family protein [marine gamma proteobacterium HTCC2207]
 gi|90331704|gb|EAS46932.1| ompA family protein [marine gamma proteobacterium HTCC2207]
          Length = 220

 Score = 88.2 bits (217), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 45/142 (31%), Positives = 78/142 (54%), Gaps = 2/142 (1%)

Query: 44  GSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVS-EVFLEKKFLPMLQLIATI 102
           G  +D  E + + QL+ +G+ V R+GD I   +P +++F S    +   F  +L  +A +
Sbjct: 77  GYYMDAQEAKLRQQLRGSGVSVERVGDNINLIMPGNITFASNSADINASFYSVLDSVALV 136

Query: 103 LNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYP 162
           L ++  T++ +  HTDS G    N  +S+ RA  +  YL+ + +   R  +V GF  + P
Sbjct: 137 LEEYDKTLVVVAGHTDSDGGAAFNEDLSERRAQSVSGYLVSQSILPIRLETV-GFGERQP 195

Query: 163 IDTNDTKVGRQNNQRIEIQIFP 184
           I  ND+  G+Q N+R+EI + P
Sbjct: 196 IAGNDSAAGKQLNRRVEITLLP 217


>gi|238020688|ref|ZP_04601114.1| hypothetical protein GCWU000324_00578 [Kingella oralis ATCC 51147]
 gi|237867668|gb|EEP68674.1| hypothetical protein GCWU000324_00578 [Kingella oralis ATCC 51147]
          Length = 224

 Score = 87.8 bits (216), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 51/145 (35%), Positives = 74/145 (51%), Gaps = 2/145 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVS-EVFLEKKFLPMLQLIATILNK 105
           +D  E + + QLQ +G+ V R GD I   +P  V+F +    L  +    L   A  L  
Sbjct: 77  MDYQEKKLREQLQGSGVAVDRQGDQIKLTMPAAVTFATNSATLSAQAQNSLSQAAQTLAT 136

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +  T I I  HTD+ G    N  +S  RA  + +YL Q GV++NR +SV G   + P+  
Sbjct: 137 YTDTTITIVGHTDNTGNDAINNPLSYNRAQSVANYLNQHGVAANR-MSVSGQGSRQPVAD 195

Query: 166 NDTKVGRQNNQRIEIQIFPRGNIKK 190
           N T+ GR  N+R+EI I P  N  +
Sbjct: 196 NSTEAGRAQNRRVEILINPDQNAAR 220


>gi|238754016|ref|ZP_04615375.1| Inner membrane lipoprotein yiaD [Yersinia ruckeri ATCC 29473]
 gi|238707768|gb|EEQ00127.1| Inner membrane lipoprotein yiaD [Yersinia ruckeri ATCC 29473]
          Length = 219

 Score = 87.8 bits (216), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 44/139 (31%), Positives = 81/139 (58%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D  E + + +++ TG+ V+R GD I   +P +V+F  +   L+      L  +A +L +
Sbjct: 81  MDVQEAKLRDKMRGTGVSVTRQGDNIVLNMPNNVTFDTNSSNLKPAGANTLTGVAMVLKE 140

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +  T + +  +TDS G   +N+++SQ+RA+ + S LI +GV++NR  ++ G     P+ T
Sbjct: 141 YEKTAVNVTGYTDSTGARAHNMILSQQRAETVGSALITQGVAANRIRTI-GAGPDNPVAT 199

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T  G+  N+R+EI + P
Sbjct: 200 NSTTAGKAQNRRVEITLSP 218


>gi|89074695|ref|ZP_01161153.1| Putative OmpA family protein [Photobacterium sp. SKA34]
 gi|89049459|gb|EAR55020.1| Putative OmpA family protein [Photobacterium sp. SKA34]
          Length = 229

 Score = 87.8 bits (216), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 49/141 (34%), Positives = 79/141 (56%), Gaps = 2/141 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D  E + + QL  +GI V+R GD I   +P  ++F   +  L  + +  L  +A +  +
Sbjct: 90  MDVQEAKLRKQLSSSGITVTRNGDNIVLNMPNEITFGFDQANLNDRAMNALHNVAIVAKE 149

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +  T + +   TDS G    NL +SQ RAD + +YLI++GV++NR +S +G     PI +
Sbjct: 150 YEKTQLNVLGFTDSKGAESYNLRLSQVRADAVANYLIRQGVNANRVVS-QGRGESNPIAS 208

Query: 166 NDTKVGRQNNQRIEIQIFPRG 186
           N T  GR  N+R+EI + P G
Sbjct: 209 NSTSNGRAQNRRVEIILSPLG 229


>gi|312174309|emb|CBX82562.1| putative outer membrane lipoprotein yiaD precursor [Erwinia
           amylovora ATCC BAA-2158]
          Length = 221

 Score = 87.8 bits (216), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 45/139 (32%), Positives = 81/139 (58%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D  E + + +++ TG+ V+R GD I   +P +V+F  S   L+      L  +A +L +
Sbjct: 82  MDVQEAKLRDKMKGTGVSVTRSGDNIVLNMPNNVTFDSSSSTLKPAGANTLTGVAMVLKE 141

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +P T + +  +TDS G+ + N+ +SQ+RAD + S LI +GV++NR +   G     P+ +
Sbjct: 142 YPKTAVNVVGYTDSSGSRQLNMNLSQQRADGVGSALIAQGVAANR-VRTNGMGSDNPVAS 200

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N +  G+  N+R+EI + P
Sbjct: 201 NSSAEGKAQNRRVEITLSP 219


>gi|237703321|ref|ZP_04533802.1| OmpA family protein [Escherichia sp. 3_2_53FAA]
 gi|226902585|gb|EEH88844.1| OmpA family protein [Escherichia sp. 3_2_53FAA]
 gi|315285303|gb|EFU44748.1| OmpA family protein [Escherichia coli MS 110-3]
 gi|323954903|gb|EGB50683.1| OmpA family protein [Escherichia coli H263]
          Length = 219

 Score = 87.8 bits (216), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 47/139 (33%), Positives = 80/139 (57%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D  E + + +++ TG+ V+R GD I   +P +V+F  S   L+      L  +A +L +
Sbjct: 81  MDVQEAKLRDKMRGTGVSVTRSGDNIILNMPNNVTFDSSSATLKPAGANTLTGVAMVLKE 140

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +P T + +  +TDS G+   N+ +SQ+RAD + S LI +GV ++R I  +G     PI +
Sbjct: 141 YPKTAVNVIGYTDSTGSHDLNMRLSQQRADSVASALITQGVDASR-IRTQGLGPANPIAS 199

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T  G+  N+R+EI + P
Sbjct: 200 NSTAEGKAQNRRVEITLSP 218


>gi|197364467|ref|YP_002144104.1| outer membrane lipoprotein [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|197095944|emb|CAR61525.1| putative outer membrane protein [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. AKU_12601]
          Length = 205

 Score = 87.8 bits (216), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 47/139 (33%), Positives = 79/139 (56%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D  E + + +++ TG+ V+R GD I   +P +V+F  S   L+      L  +A +L +
Sbjct: 66  MDVQEAKLRDKMRGTGVSVTRSGDNIILNMPNNVTFDSSSATLKPAGANTLTGVAMVLKE 125

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +P T + +  +TDS G+   N+ +SQ+RAD + S LI +GV ++R I   G     PI +
Sbjct: 126 YPKTAVNVVGYTDSTGSHDLNMRLSQQRADSVASSLITQGVDASR-IRTSGMGPANPIAS 184

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T  G+  N+R+EI + P
Sbjct: 185 NSTAEGKAQNRRVEITLSP 203


>gi|49081952|gb|AAT50376.1| PA0833 [synthetic construct]
          Length = 238

 Score = 87.8 bits (216), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 46/138 (33%), Positives = 74/138 (53%), Gaps = 2/138 (1%)

Query: 48  DKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSE-VFLEKKFLPMLQLIATILNKF 106
           DK E E + Q++ TG+ V R GD I   +P +++F ++   +   F   L  +A    ++
Sbjct: 87  DKQEAELRRQMEGTGVEVQRQGDDIKLIMPGNITFATDSANIAPSFYAPLNNLANSFKQY 146

Query: 107 PSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTN 166
               I I  +TDS G+ ++N+ +SQ RA  +  YL  +GV   R +S RG     PI +N
Sbjct: 147 NQNTIEIVGYTDSTGSRQHNMDLSQRRAQSVAGYLTAQGVDGTR-LSTRGMGPDQPIASN 205

Query: 167 DTKVGRQNNQRIEIQIFP 184
            T  GR  N+R+E+ + P
Sbjct: 206 STADGRAQNRRVEVNLRP 223


>gi|239993109|ref|ZP_04713633.1| Outer membrane protein and related peptidoglycan-associated
           (lipo)protein [Alteromonas macleodii ATCC 27126]
          Length = 213

 Score = 87.4 bits (215), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 46/139 (33%), Positives = 79/139 (56%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVF-LEKKFLPMLQLIATILNK 105
           +DK E+E + +L DTG+ V R GD +   +P  ++F ++   +   F P+LQ +A ++N 
Sbjct: 70  MDKQEEELRNELSDTGVQVVREGDNLRLIMPGDITFATDSSSISPNFNPVLQDVAKVVNN 129

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +  TV+ I+ HTD  G+ + N  +S+ RA  +K+ LI   V+  R  +V G     P   
Sbjct: 130 YEKTVLMIKGHTDDTGSEQYNQSLSERRAGAVKNLLINYSVNPTRITTV-GMGEYAPKVP 188

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N++   R  N+R+E++I P
Sbjct: 189 NNSAANRSMNRRVEMEIQP 207


>gi|152986735|ref|YP_001350031.1| hypothetical protein PSPA7_4687 [Pseudomonas aeruginosa PA7]
 gi|150961893|gb|ABR83918.1| lipoprotein, putative [Pseudomonas aeruginosa PA7]
          Length = 237

 Score = 87.4 bits (215), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 46/138 (33%), Positives = 74/138 (53%), Gaps = 2/138 (1%)

Query: 48  DKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSE-VFLEKKFLPMLQLIATILNKF 106
           DK E E + Q++ TG+ V R GD I   +P +++F ++   +   F   L  +A    ++
Sbjct: 87  DKQEAELRRQMEGTGVEVQRQGDDIKLIMPGNITFATDSANIAPSFYAPLNNLANSFKQY 146

Query: 107 PSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTN 166
               I I  +TDS G+ ++N+ +SQ RA  +  YL  +GV   R +S RG     PI +N
Sbjct: 147 NQNTIEIVGYTDSTGSRQHNMDLSQRRAQSVAGYLTAQGVDGTR-LSTRGMGPDQPIASN 205

Query: 167 DTKVGRQNNQRIEIQIFP 184
            T  GR  N+R+E+ + P
Sbjct: 206 STADGRAQNRRVEVNLRP 223


>gi|222035267|emb|CAP78012.1| Inner membrane lipoprotein yiad [Escherichia coli LF82]
 gi|312948118|gb|ADR28945.1| putative outer membrane lipoprotein [Escherichia coli O83:H1 str.
           NRG 857C]
 gi|320193935|gb|EFW68568.1| Outer membrane protein A precursor [Escherichia coli WV_060327]
          Length = 219

 Score = 87.4 bits (215), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 47/139 (33%), Positives = 80/139 (57%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D  E + + +++ TG+ V+R GD I   +P +V+F  S   L+      L  +A +L +
Sbjct: 81  MDVQEAKLRDKMRGTGVSVTRSGDNIILNMPNNVTFDSSSATLKPAGANTLTGVAMVLKE 140

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +P T + +  +TDS G+   N+ +SQ+RAD + S LI +GV ++R I  +G     PI +
Sbjct: 141 YPKTAVNVIGYTDSTGSHDLNMRLSQQRADSVASALITQGVDASR-IRTQGLGPANPIAS 199

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T  G+  N+R+EI + P
Sbjct: 200 NSTSEGKAQNRRVEITLSP 218


>gi|296390816|ref|ZP_06880291.1| hypothetical protein PaerPAb_21793 [Pseudomonas aeruginosa PAb1]
          Length = 237

 Score = 87.4 bits (215), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 46/138 (33%), Positives = 74/138 (53%), Gaps = 2/138 (1%)

Query: 48  DKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSE-VFLEKKFLPMLQLIATILNKF 106
           DK E E + Q++ TG+ V R GD I   +P +++F ++   +   F   L  +A    ++
Sbjct: 87  DKQEAELRRQMEGTGVEVQRQGDDIKLIMPGNITFATDSANIAPSFYAPLNNLANSFKQY 146

Query: 107 PSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTN 166
               I I  +TDS G+ ++N+ +SQ RA  +  YL  +GV   R +S RG     PI +N
Sbjct: 147 NQNTIEIVGYTDSTGSRQHNMDLSQRRAQSVAGYLTAQGVDGTR-LSTRGMGPDQPIASN 205

Query: 167 DTKVGRQNNQRIEIQIFP 184
            T  GR  N+R+E+ + P
Sbjct: 206 STADGRAQNRRVEVNLRP 223


>gi|91213065|ref|YP_543051.1| putative outer membrane lipoprotein [Escherichia coli UTI89]
 gi|117625836|ref|YP_859159.1| putative outer membrane lipoprotein [Escherichia coli APEC O1]
 gi|218560629|ref|YP_002393542.1| outer membrane lipoprotein [Escherichia coli S88]
 gi|306816094|ref|ZP_07450232.1| putative outer membrane lipoprotein [Escherichia coli NC101]
 gi|331649382|ref|ZP_08350468.1| inner membrane lipoprotein YiaD [Escherichia coli M605]
 gi|91074639|gb|ABE09520.1| putative outer membrane protein [Escherichia coli UTI89]
 gi|115514960|gb|ABJ03035.1| conserved hypothetical protein [Escherichia coli APEC O1]
 gi|218367398|emb|CAR05180.1| putative outer membrane lipoprotien [Escherichia coli S88]
 gi|281180597|dbj|BAI56927.1| conserved hypothetical protein [Escherichia coli SE15]
 gi|294489870|gb|ADE88626.1| OmpA family protein [Escherichia coli IHE3034]
 gi|305850490|gb|EFM50947.1| putative outer membrane lipoprotein [Escherichia coli NC101]
 gi|307628634|gb|ADN72938.1| putative outer membrane lipoprotein [Escherichia coli UM146]
 gi|323949796|gb|EGB45680.1| OmpA family protein [Escherichia coli H252]
 gi|330909615|gb|EGH38129.1| outer membrane protein A precursor [Escherichia coli AA86]
 gi|331041880|gb|EGI14024.1| inner membrane lipoprotein YiaD [Escherichia coli M605]
          Length = 219

 Score = 87.4 bits (215), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 47/139 (33%), Positives = 80/139 (57%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D  E + + +++ TG+ V+R GD I   +P +V+F  S   L+      L  +A +L +
Sbjct: 81  MDVQEAKLRDKMRGTGVSVTRSGDNIILNMPNNVTFDSSSATLKPAGANTLTGVAMVLKE 140

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +P T + +  +TDS G+   N+ +SQ+RAD + S LI +GV ++R I  +G     PI +
Sbjct: 141 YPKTAVNVIGYTDSTGSHDLNMRLSQQRADSVASALITQGVDASR-IRTQGLGPANPIAS 199

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T  G+  N+R+EI + P
Sbjct: 200 NSTAEGKAQNRRVEITLSP 218


>gi|15596030|ref|NP_249524.1| hypothetical protein PA0833 [Pseudomonas aeruginosa PAO1]
 gi|107100290|ref|ZP_01364208.1| hypothetical protein PaerPA_01001315 [Pseudomonas aeruginosa PACS2]
 gi|116048755|ref|YP_792445.1| hypothetical protein PA14_53500 [Pseudomonas aeruginosa UCBPP-PA14]
 gi|254239185|ref|ZP_04932508.1| hypothetical protein PACG_05376 [Pseudomonas aeruginosa C3719]
 gi|254245120|ref|ZP_04938442.1| hypothetical protein PA2G_06007 [Pseudomonas aeruginosa 2192]
 gi|313105709|ref|ZP_07791972.1| hypothetical protein PA39016_000110006 [Pseudomonas aeruginosa
           39016]
 gi|9946728|gb|AAG04222.1|AE004518_3 hypothetical protein PA0833 [Pseudomonas aeruginosa PAO1]
 gi|115583976|gb|ABJ09991.1| hypothetical protein PA14_53500 [Pseudomonas aeruginosa UCBPP-PA14]
 gi|126171116|gb|EAZ56627.1| hypothetical protein PACG_05376 [Pseudomonas aeruginosa C3719]
 gi|126198498|gb|EAZ62561.1| hypothetical protein PA2G_06007 [Pseudomonas aeruginosa 2192]
 gi|310878474|gb|EFQ37068.1| hypothetical protein PA39016_000110006 [Pseudomonas aeruginosa
           39016]
          Length = 237

 Score = 87.4 bits (215), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 46/138 (33%), Positives = 74/138 (53%), Gaps = 2/138 (1%)

Query: 48  DKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSE-VFLEKKFLPMLQLIATILNKF 106
           DK E E + Q++ TG+ V R GD I   +P +++F ++   +   F   L  +A    ++
Sbjct: 87  DKQEAELRRQMEGTGVEVQRQGDDIKLIMPGNITFATDSANIAPSFYAPLNNLANSFKQY 146

Query: 107 PSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTN 166
               I I  +TDS G+ ++N+ +SQ RA  +  YL  +GV   R +S RG     PI +N
Sbjct: 147 NQNTIEIVGYTDSTGSRQHNMDLSQRRAQSVAGYLTAQGVDGTR-LSTRGMGPDQPIASN 205

Query: 167 DTKVGRQNNQRIEIQIFP 184
            T  GR  N+R+E+ + P
Sbjct: 206 STADGRAQNRRVEVNLRP 223


>gi|148653943|ref|YP_001281036.1| OmpA/MotB domain-containing protein [Psychrobacter sp. PRwf-1]
 gi|148573027|gb|ABQ95086.1| OmpA/MotB domain protein [Psychrobacter sp. PRwf-1]
          Length = 218

 Score = 87.4 bits (215), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 47/139 (33%), Positives = 78/139 (56%), Gaps = 4/139 (2%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDM--ITCYIPVHVSFVSE-VFLEKKFLPMLQLIATIL 103
           ++  E + + Q+  TG+ V+R  +   I   +P +++F  +   +   F   L  +A+ +
Sbjct: 74  MENQEKQLKQQMAGTGVEVNRNPNTGNIDLVMPGNITFAHDSTNINGSFYNTLDKLASTM 133

Query: 104 NKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPI 163
            ++  T + +  HTDS+G    N  +S+ RA  + SYLIQRGVSSNR I   G+    P+
Sbjct: 134 VQYGDTTVNVMGHTDSVGNPSYNQGLSERRAQAVASYLIQRGVSSNR-IRTMGYGQNQPV 192

Query: 164 DTNDTKVGRQNNQRIEIQI 182
            +N T+ GR  N+R+EIQI
Sbjct: 193 ASNSTESGRLQNRRVEIQI 211


>gi|157149164|ref|YP_001456483.1| putative outer membrane lipoprotein [Citrobacter koseri ATCC
           BAA-895]
 gi|157086369|gb|ABV16047.1| hypothetical protein CKO_05004 [Citrobacter koseri ATCC BAA-895]
          Length = 220

 Score = 87.4 bits (215), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 48/139 (34%), Positives = 78/139 (56%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D  E + + ++Q TG+ V+R GD I   +P +V+F  S   L+      L  +A +L +
Sbjct: 81  MDVQEAKLRDKMQGTGVSVTRSGDNIILNMPNNVTFDSSSATLKPAGANTLTGVAMVLKE 140

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +  T + +  +TDS G    N+ +SQ+RAD + S LI +GV++NR I   G     PI +
Sbjct: 141 YNKTAVNVVGYTDSTGGQDLNMRLSQQRADSVASALITQGVAANR-IRTSGMGPANPIAS 199

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T  G+  N+R+EI + P
Sbjct: 200 NSTAEGKAQNRRVEITLSP 218


>gi|238757311|ref|ZP_04618497.1| Inner membrane lipoprotein yiaD [Yersinia aldovae ATCC 35236]
 gi|238704350|gb|EEP96881.1| Inner membrane lipoprotein yiaD [Yersinia aldovae ATCC 35236]
          Length = 226

 Score = 87.4 bits (215), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 46/139 (33%), Positives = 79/139 (56%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVF-LEKKFLPMLQLIATILNK 105
           +D  E + + ++  TG+ V+R GD I   +P +V+F ++   L+      L  +A +L +
Sbjct: 88  MDVQEAKLREKMSGTGVSVTRQGDNIVLNMPNNVTFDTDSSNLKPAGANTLTGVAMVLKE 147

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +  T + +  +TDS G   +N+ +SQ+RAD + S LI +GV++NR I   G     P+ T
Sbjct: 148 YDKTAVNVTGYTDSTGARAHNMTLSQQRADSVGSTLIVQGVAANR-IRTSGAGPDNPVAT 206

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T  G+  N+R+EI + P
Sbjct: 207 NSTAAGKAQNRRVEITLSP 225


>gi|152972417|ref|YP_001337563.1| putative outer membrane lipoprotein [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|206578997|ref|YP_002236080.1| OmpA family protein [Klebsiella pneumoniae 342]
 gi|238897010|ref|YP_002921755.1| putative outer membrane lipoprotein [Klebsiella pneumoniae
           NTUH-K2044]
 gi|262040618|ref|ZP_06013856.1| OmpA family protein [Klebsiella pneumoniae subsp. rhinoscleromatis
           ATCC 13884]
 gi|288933077|ref|YP_003437136.1| OmpA/MotB domain protein [Klebsiella variicola At-22]
 gi|290511871|ref|ZP_06551239.1| outer membrane lipoprotein [Klebsiella sp. 1_1_55]
 gi|329999890|ref|ZP_08303557.1| OmpA family protein [Klebsiella sp. MS 92-3]
 gi|150957266|gb|ABR79296.1| putative outer membrane protein [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|206568055|gb|ACI09831.1| OmpA family protein [Klebsiella pneumoniae 342]
 gi|238549337|dbj|BAH65688.1| putative outer membrane protein [Klebsiella pneumoniae subsp.
           pneumoniae NTUH-K2044]
 gi|259041982|gb|EEW43015.1| OmpA family protein [Klebsiella pneumoniae subsp. rhinoscleromatis
           ATCC 13884]
 gi|288887806|gb|ADC56124.1| OmpA/MotB domain protein [Klebsiella variicola At-22]
 gi|289775661|gb|EFD83661.1| outer membrane lipoprotein [Klebsiella sp. 1_1_55]
 gi|328538172|gb|EGF64327.1| OmpA family protein [Klebsiella sp. MS 92-3]
          Length = 220

 Score = 87.4 bits (215), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 48/139 (34%), Positives = 79/139 (56%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVS-EVFLEKKFLPMLQLIATILNK 105
           +D  E + + ++Q TG+ V+R GD I   +P +V+F S    L+      L  +A +L +
Sbjct: 81  MDVQEAKLRDKMQGTGVSVTRNGDNIVLNMPNNVTFDSNSANLKPAGANTLTGVAMVLKE 140

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +  T + +  +TDS G+   N+ +SQ+RAD + S LI +GV++NR I   G     PI +
Sbjct: 141 YEKTAVNVVGYTDSTGSKDLNMRLSQQRADSVASALITQGVAANR-IRTTGMGPANPIAS 199

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T  G+  N+R+EI + P
Sbjct: 200 NSTAEGKAQNRRVEITLSP 218


>gi|56415540|ref|YP_152615.1| outer membrane lipoprotein [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|56129797|gb|AAV79303.1| putative outer membrane protein [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. ATCC 9150]
          Length = 216

 Score = 87.4 bits (215), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 47/139 (33%), Positives = 79/139 (56%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D  E + + +++ TG+ V+R GD I   +P +V+F  S   L+      L  +A +L +
Sbjct: 77  MDVQEAKLRDKMRGTGVSVTRSGDNIILNMPNNVTFDSSSATLKPAGANTLTGVAMVLKE 136

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +P T + +  +TDS G+   N+ +SQ+RAD + S LI +GV ++R I   G     PI +
Sbjct: 137 YPKTAVNVVGYTDSTGSHDLNMRLSQQRADSVASSLITQGVDASR-IRTSGMGPANPIAS 195

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T  G+  N+R+EI + P
Sbjct: 196 NSTAEGKAQNRRVEITLSP 214


>gi|205354747|ref|YP_002228548.1| outer membrane lipoprotein [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|207858882|ref|YP_002245533.1| outer membrane lipoprotein [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|205274528|emb|CAR39567.1| putative outer membrane protein [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 287/91]
 gi|206710685|emb|CAR35045.1| putative outer membrane protein [Salmonella enterica subsp.
           enterica serovar Enteritidis str. P125109]
 gi|261248795|emb|CBG26648.1| putative outer membrane protein [Salmonella enterica subsp.
           enterica serovar Typhimurium str. D23580]
 gi|301160182|emb|CBW19704.1| putative outer membrane protein [Salmonella enterica subsp.
           enterica serovar Typhimurium str. SL1344]
          Length = 209

 Score = 87.4 bits (215), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 47/139 (33%), Positives = 79/139 (56%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D  E + + +++ TG+ V+R GD I   +P +V+F  S   L+      L  +A +L +
Sbjct: 70  MDVQEAKLRDKMRGTGVSVTRSGDNIILNMPNNVTFDSSSATLKPAGANTLTGVAMVLKE 129

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +P T + +  +TDS G+   N+ +SQ+RAD + S LI +GV ++R I   G     PI +
Sbjct: 130 YPKTAVNVVGYTDSTGSHDLNMRLSQQRADSVASSLITQGVDASR-IRTSGMGPANPIAS 188

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T  G+  N+R+EI + P
Sbjct: 189 NSTAEGKAQNRRVEITLSP 207


>gi|292490116|ref|YP_003533011.1| putative outer membrane lipoprotein yiaD [Erwinia amylovora
           CFBP1430]
 gi|292901121|ref|YP_003540490.1| outer membrane protein [Erwinia amylovora ATCC 49946]
 gi|291200969|emb|CBJ48108.1| putative outer membrane protein [Erwinia amylovora ATCC 49946]
 gi|291555558|emb|CBA24133.1| putative outer membrane lipoprotein yiaD precursor [Erwinia
           amylovora CFBP1430]
          Length = 221

 Score = 87.0 bits (214), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 45/139 (32%), Positives = 81/139 (58%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D  E + + +++ TG+ V+R GD I   +P +V+F  S   L+      L  +A +L +
Sbjct: 82  MDVQEAKLRDKMKGTGVSVTRSGDNIVLNMPNNVTFDSSSSTLKPAGANTLTGVAMVLKE 141

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +P T + +  +TDS G+ + N+ +SQ+RAD + S LI +GV++NR +   G     P+ +
Sbjct: 142 YPKTAVNVVGYTDSSGSRQLNMNLSQQRADGVGSALIAQGVAANR-VRTNGMGPDNPVAS 200

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N +  G+  N+R+EI + P
Sbjct: 201 NSSAEGKAQNRRVEITLSP 219


>gi|168260613|ref|ZP_02682586.1| inner membrane lipoprotein YiaD [Salmonella enterica subsp.
           enterica serovar Hadar str. RI_05P066]
 gi|205350258|gb|EDZ36889.1| inner membrane lipoprotein YiaD [Salmonella enterica subsp.
           enterica serovar Hadar str. RI_05P066]
          Length = 220

 Score = 87.0 bits (214), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 47/139 (33%), Positives = 79/139 (56%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D  E + + +++ TG+ V+R GD I   +P +V+F  S   L+      L  +A +L +
Sbjct: 81  MDVQEAKLRDKMRGTGVSVTRSGDNIILNMPNNVTFDSSSATLKPAGADTLTGVAMVLKE 140

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +P T + +  +TDS G+   N+ +SQ+RAD + S LI +GV ++R I   G     PI +
Sbjct: 141 YPKTAVNVVGYTDSTGSHDLNMRLSQQRADSVASSLITQGVDASR-IRTSGMGPANPIAS 199

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T  G+  N+R+EI + P
Sbjct: 200 NSTAEGKAQNRRVEITLSP 218


>gi|149919600|ref|ZP_01908079.1| OmpA domain protein [Plesiocystis pacifica SIR-1]
 gi|149819543|gb|EDM78971.1| OmpA domain protein [Plesiocystis pacifica SIR-1]
          Length = 458

 Score = 87.0 bits (214), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 41/99 (41%), Positives = 59/99 (59%), Gaps = 1/99 (1%)

Query: 90  KKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSN 149
           K  +P L+  A +LN+FP   + I  HTDS G  ++N+ +S+ RA+ +K +L+  GV  +
Sbjct: 354 KDSIPQLEQAAEVLNRFPDLRVEISGHTDSRGGYQHNMDLSRRRAEAVKKWLVDNGVDGS 413

Query: 150 RFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGNI 188
           R +  RG     PIDTNDT  GR NN+RIE  I   G +
Sbjct: 414 R-LETRGAGPDEPIDTNDTSAGRFNNRRIEFTILGGGPV 451


>gi|237728863|ref|ZP_04559344.1| OmpA/MotB domain-containing protein [Citrobacter sp. 30_2]
 gi|226909485|gb|EEH95403.1| OmpA/MotB domain-containing protein [Citrobacter sp. 30_2]
          Length = 220

 Score = 87.0 bits (214), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 48/139 (34%), Positives = 79/139 (56%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D  E + + ++Q TG+ V+R GD I   +P +V+F  S   L+      L  +A +L +
Sbjct: 81  MDVQEAKLREKMQGTGVSVTRSGDNIILNMPNNVTFDSSSANLKPAGANTLTGVAMVLKE 140

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +  T + +   TDS G+   N+ +SQ+RAD + S LI +GV++NR I  +G     PI +
Sbjct: 141 YNKTAVNVLGFTDSTGSQDLNMRLSQQRADSVASALITQGVAANR-IRTQGMGPANPIAS 199

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T  G+  N+R+EI + P
Sbjct: 200 NSTAEGKAQNRRVEITLSP 218


>gi|167990874|ref|ZP_02571973.1| inner membrane lipoprotein YiaD [Salmonella enterica subsp.
           enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|205330659|gb|EDZ17423.1| inner membrane lipoprotein YiaD [Salmonella enterica subsp.
           enterica serovar 4,[5],12:i:- str. CVM23701]
          Length = 220

 Score = 87.0 bits (214), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 47/139 (33%), Positives = 79/139 (56%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D  E + + +++ TG+ V+R GD I   +P +V+F  S   L+      L  +A +L +
Sbjct: 81  MDVQEAKLRDKMRGTGVSVTRSGDNIILNMPNNVTFDSSSATLKPAGANTLTGVAMVLKE 140

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +P T + +  +TDS G+   N+ +SQ+RAD + S LI +GV ++R I   G     PI +
Sbjct: 141 YPKTAVNVVGYTDSTGSHDLNMRLSQQRADSVASSLITQGVDASR-IRTSGMGPANPIAS 199

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T  G+  N+R+EI + P
Sbjct: 200 NSTAEGKAQNRRVEITLSP 218


>gi|16762663|ref|NP_458280.1| outer membrane lipoprotein [Salmonella enterica subsp. enterica
           serovar Typhi str. CT18]
 gi|16766931|ref|NP_462546.1| outer membrane lipoprotein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|29144150|ref|NP_807492.1| outer membrane lipoprotein [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|62182147|ref|YP_218564.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. SC-B67]
 gi|161505818|ref|YP_001572930.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|161616710|ref|YP_001590675.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|167549121|ref|ZP_02342880.1| inner membrane lipoprotein YiaD [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA29]
 gi|168232486|ref|ZP_02657544.1| inner membrane lipoprotein YiaD [Salmonella enterica subsp.
           enterica serovar Kentucky str. CDC 191]
 gi|168235246|ref|ZP_02660304.1| inner membrane lipoprotein YiaD [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. SL480]
 gi|168241813|ref|ZP_02666745.1| inner membrane lipoprotein YiaD [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL486]
 gi|168465059|ref|ZP_02698951.1| inner membrane lipoprotein YiaD [Salmonella enterica subsp.
           enterica serovar Newport str. SL317]
 gi|168818532|ref|ZP_02830532.1| inner membrane lipoprotein YiaD [Salmonella enterica subsp.
           enterica serovar Weltevreden str. HI_N05-537]
 gi|194446335|ref|YP_002042894.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|194450414|ref|YP_002047675.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|194470919|ref|ZP_03076903.1| inner membrane lipoprotein YiaD [Salmonella enterica subsp.
           enterica serovar Kentucky str. CVM29188]
 gi|194738075|ref|YP_002116578.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|197250152|ref|YP_002148575.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
 gi|197264832|ref|ZP_03164906.1| inner membrane lipoprotein YiaD [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA23]
 gi|198245549|ref|YP_002217605.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Dublin str. CT_02021853]
 gi|200387506|ref|ZP_03214118.1| inner membrane lipoprotein YiaD [Salmonella enterica subsp.
           enterica serovar Virchow str. SL491]
 gi|204928737|ref|ZP_03219936.1| inner membrane lipoprotein YiaD [Salmonella enterica subsp.
           enterica serovar Javiana str. GA_MM04042433]
 gi|213426937|ref|ZP_03359687.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Typhi str. E02-1180]
 gi|213580286|ref|ZP_03362112.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-0664]
 gi|213622354|ref|ZP_03375137.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-2068]
 gi|213646868|ref|ZP_03376921.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Typhi str. J185]
 gi|213852846|ref|ZP_03382378.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Typhi str. M223]
 gi|224585444|ref|YP_002639243.1| outer membrane lipoprotein [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|238910327|ref|ZP_04654164.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Tennessee str. CDC07-0191]
 gi|289811587|ref|ZP_06542216.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Typhi str. AG3]
 gi|289824292|ref|ZP_06543885.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-3139]
 gi|25512154|pir||AC0982 probable outer membrane protein STY4157 [imported] - Salmonella
           enterica subsp. enterica serovar Typhi (strain CT18)
 gi|16422210|gb|AAL22505.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|16504969|emb|CAD07983.1| putative outer membrane protein [Salmonella enterica subsp.
           enterica serovar Typhi]
 gi|29139787|gb|AAO71352.1| putative outer membrane protein [Salmonella enterica subsp.
           enterica serovar Typhi str. Ty2]
 gi|62129780|gb|AAX67483.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. SC-B67]
 gi|160867165|gb|ABX23788.1| hypothetical protein SARI_03994 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
 gi|161366074|gb|ABX69842.1| hypothetical protein SPAB_04529 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194404998|gb|ACF65220.1| inner membrane lipoprotein YiaD [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|194408718|gb|ACF68937.1| inner membrane lipoprotein YiaD [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|194457283|gb|EDX46122.1| inner membrane lipoprotein YiaD [Salmonella enterica subsp.
           enterica serovar Kentucky str. CVM29188]
 gi|194713577|gb|ACF92798.1| inner membrane lipoprotein YiaD [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|195632363|gb|EDX50847.1| inner membrane lipoprotein YiaD [Salmonella enterica subsp.
           enterica serovar Newport str. SL317]
 gi|197213855|gb|ACH51252.1| inner membrane lipoprotein YiaD [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
 gi|197243087|gb|EDY25707.1| inner membrane lipoprotein YiaD [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA23]
 gi|197291562|gb|EDY30914.1| inner membrane lipoprotein YiaD [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. SL480]
 gi|197940065|gb|ACH77398.1| inner membrane lipoprotein YiaD [Salmonella enterica subsp.
           enterica serovar Dublin str. CT_02021853]
 gi|199604604|gb|EDZ03149.1| inner membrane lipoprotein YiaD [Salmonella enterica subsp.
           enterica serovar Virchow str. SL491]
 gi|204322170|gb|EDZ07368.1| inner membrane lipoprotein YiaD [Salmonella enterica subsp.
           enterica serovar Javiana str. GA_MM04042433]
 gi|205325701|gb|EDZ13540.1| inner membrane lipoprotein YiaD [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA29]
 gi|205333235|gb|EDZ19999.1| inner membrane lipoprotein YiaD [Salmonella enterica subsp.
           enterica serovar Kentucky str. CDC 191]
 gi|205338706|gb|EDZ25470.1| inner membrane lipoprotein YiaD [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL486]
 gi|205344463|gb|EDZ31227.1| inner membrane lipoprotein YiaD [Salmonella enterica subsp.
           enterica serovar Weltevreden str. HI_N05-537]
 gi|224469972|gb|ACN47802.1| putative outer membrane protein [Salmonella enterica subsp.
           enterica serovar Paratyphi C strain RKS4594]
 gi|267995894|gb|ACY90779.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 14028S]
 gi|312914671|dbj|BAJ38645.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Typhimurium str. T000240]
 gi|320088065|emb|CBY97827.1| Inner membrane lipoprotein yiaD Flags: Precursor [Salmonella
           enterica subsp. enterica serovar Weltevreden str.
           2007-60-3289-1]
 gi|321226700|gb|EFX51750.1| putative outer membrane protein [Salmonella enterica subsp.
           enterica serovar Typhimurium str. TN061786]
 gi|322613966|gb|EFY10902.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315996572]
 gi|322620335|gb|EFY17203.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-1]
 gi|322625340|gb|EFY22167.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-3]
 gi|322629993|gb|EFY26766.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-4]
 gi|322634183|gb|EFY30918.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-1]
 gi|322635916|gb|EFY32625.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-2]
 gi|322643166|gb|EFY39740.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 531954]
 gi|322644613|gb|EFY41149.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Montevideo str. NC_MB110209-0054]
 gi|322650855|gb|EFY47247.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Montevideo str. OH_2009072675]
 gi|322652981|gb|EFY49316.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Montevideo str. CASC_09SCPH15965]
 gi|322659944|gb|EFY56184.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 19N]
 gi|322663277|gb|EFY59481.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 81038-01]
 gi|322668763|gb|EFY64916.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Montevideo str. MD_MDA09249507]
 gi|322674434|gb|EFY70527.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 414877]
 gi|322678358|gb|EFY74419.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 366867]
 gi|322680864|gb|EFY76898.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 413180]
 gi|322687200|gb|EFY83173.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 446600]
 gi|322716635|gb|EFZ08206.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. A50]
 gi|323132006|gb|ADX19436.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 4/74]
 gi|323192159|gb|EFZ77392.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609458-1]
 gi|323200663|gb|EFZ85737.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556150-1]
 gi|323201373|gb|EFZ86439.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609460]
 gi|323206773|gb|EFZ91727.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 507440-20]
 gi|323211797|gb|EFZ96629.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556152]
 gi|323216156|gb|EGA00884.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB101509-0077]
 gi|323220379|gb|EGA04833.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB102109-0047]
 gi|323226236|gb|EGA10451.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB110209-0055]
 gi|323228356|gb|EGA12487.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB111609-0052]
 gi|323234177|gb|EGA18265.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009083312]
 gi|323237162|gb|EGA21229.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009085258]
 gi|323244681|gb|EGA28685.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315731156]
 gi|323249162|gb|EGA33080.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2009159199]
 gi|323250719|gb|EGA34599.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008282]
 gi|323257594|gb|EGA41281.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008283]
 gi|323262303|gb|EGA45864.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008284]
 gi|323266142|gb|EGA49633.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008285]
 gi|323268777|gb|EGA52235.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008287]
 gi|326625391|gb|EGE31736.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Dublin str. 3246]
 gi|326629887|gb|EGE36230.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 9]
 gi|332990496|gb|AEF09479.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Typhimurium str. UK-1]
          Length = 220

 Score = 87.0 bits (214), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 47/139 (33%), Positives = 79/139 (56%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D  E + + +++ TG+ V+R GD I   +P +V+F  S   L+      L  +A +L +
Sbjct: 81  MDVQEAKLRDKMRGTGVSVTRSGDNIILNMPNNVTFDSSSATLKPAGANTLTGVAMVLKE 140

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +P T + +  +TDS G+   N+ +SQ+RAD + S LI +GV ++R I   G     PI +
Sbjct: 141 YPKTAVNVVGYTDSTGSHDLNMRLSQQRADSVASSLITQGVDASR-IRTSGMGPANPIAS 199

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T  G+  N+R+EI + P
Sbjct: 200 NSTAEGKAQNRRVEITLSP 218


>gi|237748606|ref|ZP_04579086.1| OmpA/MotB domain-containing protein [Oxalobacter formigenes OXCC13]
 gi|229379968|gb|EEO30059.1| OmpA/MotB domain-containing protein [Oxalobacter formigenes OXCC13]
          Length = 217

 Score = 87.0 bits (214), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 52/138 (37%), Positives = 80/138 (57%), Gaps = 3/138 (2%)

Query: 47  LDKAEDEFQMQLQDTGI-VVSRIGDMITCYIPVHVSFVS-EVFLEKKFLPMLQLIATILN 104
           ++K + E Q   Q TG+ VV    +MI   IP  VSF +    L  +F  +L+ +AT L 
Sbjct: 77  MEKQKQEMQAATQGTGVEVVQTENNMIRVSIPSDVSFATGSSTLSPQFKTILRDLATTLK 136

Query: 105 KFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPID 164
             PS+ I +  +TD+ G+   NL +S++RA  +  YL+ +GV++NRF +V G   K PI 
Sbjct: 137 NNPSSSIFVVGYTDNTGSDSVNLPLSRKRAMSVMEYLVSQGVAANRF-TVEGMGSKDPIA 195

Query: 165 TNDTKVGRQNNQRIEIQI 182
           +N T  GR  N+R+EI +
Sbjct: 196 SNATAEGRAQNRRVEIYV 213


>gi|308188742|ref|YP_003932873.1| OOP family outer membrane lipoprotein yiaD precursor [Pantoea
           vagans C9-1]
 gi|308059252|gb|ADO11424.1| Putative OOP family outer membrane lipoprotein yiaD precursor
           [Pantoea vagans C9-1]
          Length = 220

 Score = 87.0 bits (214), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 46/141 (32%), Positives = 83/141 (58%), Gaps = 2/141 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D  E + + +++ TG+ V+R GD I   +P +V+F  S   L+      L  ++ +L +
Sbjct: 81  MDVQEAKLRDKMRGTGVSVTRNGDNIVLNMPNNVTFDSSSSNLKPAGANTLTGVSMVLKE 140

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +P T + +  +TDS G+   N+ +SQ+RA+ + S LI +GV+S+R +  +G     P+ T
Sbjct: 141 YPKTAVNVVGYTDSTGSRALNMRLSQQRAESVASALIVQGVASDR-LRTQGAGPDNPVAT 199

Query: 166 NDTKVGRQNNQRIEIQIFPRG 186
           N T+ G+  N+R+EI + P G
Sbjct: 200 NSTEAGKAQNRRVEITLSPLG 220


>gi|253771615|ref|YP_003034446.1| outer membrane lipoprotein [Escherichia coli 'BL21-Gold(DE3)pLysS
           AG']
 gi|254163475|ref|YP_003046583.1| putative outer membrane lipoprotein [Escherichia coli B str.
           REL606]
 gi|297520666|ref|ZP_06939052.1| putative outer membrane lipoprotein [Escherichia coli OP50]
 gi|300928223|ref|ZP_07143762.1| OmpA family protein [Escherichia coli MS 187-1]
 gi|242379069|emb|CAQ33870.1| predicted outer membrane lipoprotein [Escherichia coli BL21(DE3)]
 gi|253322659|gb|ACT27261.1| OmpA/MotB domain protein [Escherichia coli 'BL21-Gold(DE3)pLysS
           AG']
 gi|253975376|gb|ACT41047.1| predicted outer membrane lipoprotein [Escherichia coli B str.
           REL606]
 gi|253979532|gb|ACT45202.1| predicted outer membrane lipoprotein [Escherichia coli BL21(DE3)]
 gi|300463768|gb|EFK27261.1| OmpA family protein [Escherichia coli MS 187-1]
          Length = 219

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 47/139 (33%), Positives = 79/139 (56%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D  E + + +++ TG+ V+R GD I   +P +V+F  S   L+      L  +A +L +
Sbjct: 81  MDVQEAKLRDKMRGTGVSVTRSGDNIILNMPNNVTFDSSSATLKPAGANTLTGVAMVLKE 140

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +P T + +  +TDS G    N+ +SQ+RAD + S LI +GV ++R I  +G     PI +
Sbjct: 141 YPKTAVNVIGYTDSTGGHDLNMRLSQQRADSVASALITQGVDASR-IRTQGLGPANPIAS 199

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T  G+  N+R+EI + P
Sbjct: 200 NSTAEGKAQNRRVEITLSP 218


>gi|332969616|gb|EGK08634.1| OmpA family protein [Kingella kingae ATCC 23330]
          Length = 258

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 55/147 (37%), Positives = 78/147 (53%), Gaps = 2/147 (1%)

Query: 44  GSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVF-LEKKFLPMLQLIATI 102
           G  +D  E + + QL +TG+ V R G+ I   +P +V+F +  + L       L   A  
Sbjct: 111 GGYMDYQETKLREQLANTGVEVERQGNQIKLTMPENVTFATGRYDLSPAAQSALANAAQT 170

Query: 103 LNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYP 162
           L  +  T I I  HTDS G+   N  +S  RA+ + SYL QRGV++NR +SV G   + P
Sbjct: 171 LATYNETTITIVGHTDSTGSDAINNPLSYNRANAVASYLNQRGVAANR-MSVSGQGSRQP 229

Query: 163 IDTNDTKVGRQNNQRIEIQIFPRGNIK 189
           I  N T  GR  N+R+EI I P  N +
Sbjct: 230 IADNSTDYGRAQNRRVEILINPNPNAQ 256


>gi|74314194|ref|YP_312613.1| putative outer membrane lipoprotein [Shigella sonnei Ss046]
 gi|73857671|gb|AAZ90378.1| putative outer membrane protein [Shigella sonnei Ss046]
 gi|323166955|gb|EFZ52694.1| inner membrane lipoprotein yiaD [Shigella sonnei 53G]
          Length = 219

 Score = 86.7 bits (213), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 47/139 (33%), Positives = 79/139 (56%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D  E + + +++ TG+ V+R GD I   +P +V+F  S   L+      L  +A +L +
Sbjct: 81  MDVQEAKLRDKMRGTGVSVTRSGDNIILNMPNNVTFDSSSATLKPAGANTLTGVAMVLTE 140

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +P T + +  +TDS G    N+ +SQ+RAD + S LI +GV ++R I  +G     PI +
Sbjct: 141 YPKTAVNVIGYTDSTGGHDLNMRLSQQRADSVASALITQGVDASR-IRTQGLGPANPIAS 199

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T  G+  N+R+EI + P
Sbjct: 200 NSTAEGKAQNRRVEITLSP 218


>gi|15804098|ref|NP_290137.1| putative outer membrane lipoprotein [Escherichia coli O157:H7
           EDL933]
 gi|15833691|ref|NP_312464.1| outer membrane lipoprotein [Escherichia coli O157:H7 str. Sakai]
 gi|26250192|ref|NP_756232.1| putative outer membrane lipoprotein [Escherichia coli CFT073]
 gi|49176370|ref|YP_026228.1| outer membrane lipoprotein [Escherichia coli str. K-12 substr.
           MG1655]
 gi|89110462|ref|AP_004242.1| predicted outer membrane lipoprotien [Escherichia coli str. K-12
           substr. W3110]
 gi|110643800|ref|YP_671530.1| putative outer membrane lipoprotein [Escherichia coli 536]
 gi|157158823|ref|YP_001465027.1| putative outer membrane lipoprotein [Escherichia coli E24377A]
 gi|157163027|ref|YP_001460345.1| putative outer membrane lipoprotein [Escherichia coli HS]
 gi|168746904|ref|ZP_02771926.1| OmpA family protein [Escherichia coli O157:H7 str. EC4113]
 gi|168753370|ref|ZP_02778377.1| OmpA family protein [Escherichia coli O157:H7 str. EC4401]
 gi|168759642|ref|ZP_02784649.1| OmpA family protein [Escherichia coli O157:H7 str. EC4501]
 gi|168765965|ref|ZP_02790972.1| OmpA family protein [Escherichia coli O157:H7 str. EC4486]
 gi|168772488|ref|ZP_02797495.1| OmpA family protein [Escherichia coli O157:H7 str. EC4196]
 gi|168779701|ref|ZP_02804708.1| OmpA family protein [Escherichia coli O157:H7 str. EC4076]
 gi|168785422|ref|ZP_02810429.1| OmpA family protein [Escherichia coli O157:H7 str. EC869]
 gi|168797388|ref|ZP_02822395.1| OmpA family protein [Escherichia coli O157:H7 str. EC508]
 gi|170018219|ref|YP_001723173.1| putative outer membrane lipoprotein [Escherichia coli ATCC 8739]
 gi|170083060|ref|YP_001732380.1| outer membrane lipoprotein [Escherichia coli str. K-12 substr.
           DH10B]
 gi|170680831|ref|YP_001745838.1| putative outer membrane lipoprotein [Escherichia coli SMS-3-5]
 gi|170766985|ref|ZP_02901438.1| OmpA family protein [Escherichia albertii TW07627]
 gi|188495948|ref|ZP_03003218.1| OmpA family protein [Escherichia coli 53638]
 gi|191165316|ref|ZP_03027159.1| OmpA family protein [Escherichia coli B7A]
 gi|191170332|ref|ZP_03031885.1| OmpA family protein [Escherichia coli F11]
 gi|193061844|ref|ZP_03042941.1| OmpA family protein [Escherichia coli E22]
 gi|193068535|ref|ZP_03049497.1| OmpA family protein [Escherichia coli E110019]
 gi|194427518|ref|ZP_03060067.1| OmpA family protein [Escherichia coli B171]
 gi|194435666|ref|ZP_03067769.1| OmpA family protein [Escherichia coli 101-1]
 gi|195935083|ref|ZP_03080465.1| putative outer membrane lipoprotein [Escherichia coli O157:H7 str.
           EC4024]
 gi|208808020|ref|ZP_03250357.1| OmpA family protein [Escherichia coli O157:H7 str. EC4206]
 gi|208812888|ref|ZP_03254217.1| OmpA family protein [Escherichia coli O157:H7 str. EC4045]
 gi|208819372|ref|ZP_03259692.1| OmpA family protein [Escherichia coli O157:H7 str. EC4042]
 gi|209400986|ref|YP_002273038.1| OmpA family protein [Escherichia coli O157:H7 str. EC4115]
 gi|209921016|ref|YP_002295100.1| putative outer membrane lipoprotein [Escherichia coli SE11]
 gi|215488837|ref|YP_002331268.1| putative outer membrane lipoprotein [Escherichia coli O127:H6 str.
           E2348/69]
 gi|217326256|ref|ZP_03442340.1| OmpA family protein [Escherichia coli O157:H7 str. TW14588]
 gi|218556112|ref|YP_002389025.1| putative outer membrane lipoprotein [Escherichia coli IAI1]
 gi|218691843|ref|YP_002400055.1| putative outer membrane lipoprotein [Escherichia coli ED1a]
 gi|218697269|ref|YP_002404936.1| putative outer membrane lipoprotein [Escherichia coli 55989]
 gi|218702317|ref|YP_002409946.1| putative outer membrane lipoprotein [Escherichia coli IAI39]
 gi|218707187|ref|YP_002414706.1| putative outer membrane lipoprotein [Escherichia coli UMN026]
 gi|227883718|ref|ZP_04001523.1| outer membrane lipoprotein [Escherichia coli 83972]
 gi|238902640|ref|YP_002928436.1| putative outer membrane lipoprotein [Escherichia coli BW2952]
 gi|254795509|ref|YP_003080346.1| putative outer membrane lipoprotein [Escherichia coli O157:H7 str.
           TW14359]
 gi|256020901|ref|ZP_05434766.1| putative outer membrane lipoprotein [Shigella sp. D9]
 gi|256025721|ref|ZP_05439586.1| putative outer membrane lipoprotein [Escherichia sp. 4_1_40B]
 gi|260846733|ref|YP_003224511.1| putative outer membrane lipoprotein [Escherichia coli O103:H2 str.
           12009]
 gi|260858052|ref|YP_003231943.1| putative outer membrane lipoprotein [Escherichia coli O26:H11 str.
           11368]
 gi|260870283|ref|YP_003236685.1| putative outer membrane lipoprotein [Escherichia coli O111:H- str.
           11128]
 gi|261224871|ref|ZP_05939152.1| outer membrane lipoprotein [Escherichia coli O157:H7 str. FRIK2000]
 gi|261254230|ref|ZP_05946763.1| putative outer membrane lipoprotein [Escherichia coli O157:H7 str.
           FRIK966]
 gi|291284929|ref|YP_003501747.1| Inner membrane lipoprotein yiaD precursor [Escherichia coli O55:H7
           str. CB9615]
 gi|293407175|ref|ZP_06651099.1| outer membrane lipoprotein [Escherichia coli FVEC1412]
 gi|293417001|ref|ZP_06659638.1| outer membrane lipoprotein [Escherichia coli B185]
 gi|293453862|ref|ZP_06664281.1| outer membrane lipoprotein [Escherichia coli B088]
 gi|298382924|ref|ZP_06992519.1| outer membrane lipoprotein [Escherichia coli FVEC1302]
 gi|300815222|ref|ZP_07095447.1| OmpA family protein [Escherichia coli MS 107-1]
 gi|300822046|ref|ZP_07102189.1| OmpA family protein [Escherichia coli MS 119-7]
 gi|300898736|ref|ZP_07117047.1| OmpA family protein [Escherichia coli MS 198-1]
 gi|300920432|ref|ZP_07136866.1| OmpA family protein [Escherichia coli MS 115-1]
 gi|300925626|ref|ZP_07141493.1| OmpA family protein [Escherichia coli MS 182-1]
 gi|300937157|ref|ZP_07152011.1| OmpA family protein [Escherichia coli MS 21-1]
 gi|300971377|ref|ZP_07171446.1| OmpA family protein [Escherichia coli MS 45-1]
 gi|300976951|ref|ZP_07173686.1| OmpA family protein [Escherichia coli MS 200-1]
 gi|301026191|ref|ZP_07189658.1| OmpA family protein [Escherichia coli MS 69-1]
 gi|301028182|ref|ZP_07191452.1| OmpA family protein [Escherichia coli MS 196-1]
 gi|301304604|ref|ZP_07210713.1| OmpA family protein [Escherichia coli MS 124-1]
 gi|301646016|ref|ZP_07245922.1| OmpA family protein [Escherichia coli MS 146-1]
 gi|307140242|ref|ZP_07499598.1| putative outer membrane lipoprotein [Escherichia coli H736]
 gi|307314313|ref|ZP_07593920.1| OmpA/MotB domain protein [Escherichia coli W]
 gi|309796193|ref|ZP_07690604.1| OmpA family protein [Escherichia coli MS 145-7]
 gi|312968105|ref|ZP_07782316.1| inner membrane lipoprotein yiaD [Escherichia coli 2362-75]
 gi|312972173|ref|ZP_07786347.1| inner membrane lipoprotein yiaD [Escherichia coli 1827-70]
 gi|331644263|ref|ZP_08345392.1| inner membrane lipoprotein YiaD [Escherichia coli H736]
 gi|331655189|ref|ZP_08356188.1| inner membrane lipoprotein YiaD [Escherichia coli M718]
 gi|331659868|ref|ZP_08360806.1| inner membrane lipoprotein YiaD [Escherichia coli TA206]
 gi|331665175|ref|ZP_08366076.1| inner membrane lipoprotein YiaD [Escherichia coli TA143]
 gi|331670386|ref|ZP_08371225.1| inner membrane lipoprotein YiaD [Escherichia coli TA271]
 gi|331675043|ref|ZP_08375800.1| inner membrane lipoprotein YiaD [Escherichia coli TA280]
 gi|331679633|ref|ZP_08380303.1| inner membrane lipoprotein YiaD [Escherichia coli H591]
 gi|331685215|ref|ZP_08385801.1| inner membrane lipoprotein YiaD [Escherichia coli H299]
 gi|332282119|ref|ZP_08394532.1| OmpA family protein [Shigella sp. D9]
 gi|54042327|sp|P37665|YIAD_ECOLI RecName: Full=Inner membrane lipoprotein yiaD; Flags: Precursor
 gi|12518287|gb|AAG58701.1|AE005582_4 putative outer membrane protein [Escherichia coli O157:H7 str.
           EDL933]
 gi|26110621|gb|AAN82806.1|AE016768_224 Hypothetical lipoprotein yiaD precursor [Escherichia coli CFT073]
 gi|13363911|dbj|BAB37860.1| putative outer membrane protein [Escherichia coli O157:H7 str.
           Sakai]
 gi|48994946|gb|AAT48190.1| outer membrane lipoprotein [Escherichia coli str. K-12 substr.
           MG1655]
 gi|85676493|dbj|BAE77743.1| predicted outer membrane lipoprotien [Escherichia coli str. K12
           substr. W3110]
 gi|110345392|gb|ABG71629.1| putative outer membrane lipoprotein [Escherichia coli 536]
 gi|157068707|gb|ABV07962.1| OmpA family protein [Escherichia coli HS]
 gi|157080853|gb|ABV20561.1| OmpA family protein [Escherichia coli E24377A]
 gi|169753147|gb|ACA75846.1| OmpA/MotB domain protein [Escherichia coli ATCC 8739]
 gi|169890895|gb|ACB04602.1| predicted outer membrane lipoprotein [Escherichia coli str. K-12
           substr. DH10B]
 gi|170124423|gb|EDS93354.1| OmpA family protein [Escherichia albertii TW07627]
 gi|170518549|gb|ACB16727.1| OmpA family protein [Escherichia coli SMS-3-5]
 gi|187771758|gb|EDU35602.1| OmpA family protein [Escherichia coli O157:H7 str. EC4196]
 gi|188018309|gb|EDU56431.1| OmpA family protein [Escherichia coli O157:H7 str. EC4113]
 gi|188491147|gb|EDU66250.1| OmpA family protein [Escherichia coli 53638]
 gi|189002241|gb|EDU71227.1| OmpA family protein [Escherichia coli O157:H7 str. EC4076]
 gi|189358800|gb|EDU77219.1| OmpA family protein [Escherichia coli O157:H7 str. EC4401]
 gi|189364720|gb|EDU83139.1| OmpA family protein [Escherichia coli O157:H7 str. EC4486]
 gi|189369665|gb|EDU88081.1| OmpA family protein [Escherichia coli O157:H7 str. EC4501]
 gi|189374556|gb|EDU92972.1| OmpA family protein [Escherichia coli O157:H7 str. EC869]
 gi|189380056|gb|EDU98472.1| OmpA family protein [Escherichia coli O157:H7 str. EC508]
 gi|190904718|gb|EDV64424.1| OmpA family protein [Escherichia coli B7A]
 gi|190909140|gb|EDV68726.1| OmpA family protein [Escherichia coli F11]
 gi|192932634|gb|EDV85231.1| OmpA family protein [Escherichia coli E22]
 gi|192958186|gb|EDV88627.1| OmpA family protein [Escherichia coli E110019]
 gi|194414558|gb|EDX30831.1| OmpA family protein [Escherichia coli B171]
 gi|194425209|gb|EDX41193.1| OmpA family protein [Escherichia coli 101-1]
 gi|208727821|gb|EDZ77422.1| OmpA family protein [Escherichia coli O157:H7 str. EC4206]
 gi|208734165|gb|EDZ82852.1| OmpA family protein [Escherichia coli O157:H7 str. EC4045]
 gi|208739495|gb|EDZ87177.1| OmpA family protein [Escherichia coli O157:H7 str. EC4042]
 gi|209162386|gb|ACI39819.1| OmpA family protein [Escherichia coli O157:H7 str. EC4115]
 gi|209755238|gb|ACI75931.1| putative outer membrane protein [Escherichia coli]
 gi|209755240|gb|ACI75932.1| putative outer membrane protein [Escherichia coli]
 gi|209755242|gb|ACI75933.1| putative outer membrane protein [Escherichia coli]
 gi|209755244|gb|ACI75934.1| putative outer membrane protein [Escherichia coli]
 gi|209755246|gb|ACI75935.1| putative outer membrane protein [Escherichia coli]
 gi|209914275|dbj|BAG79349.1| conserved hypothetical protein [Escherichia coli SE11]
 gi|215266909|emb|CAS11352.1| predicted outer membrane lipoprotien [Escherichia coli O127:H6 str.
           E2348/69]
 gi|217322477|gb|EEC30901.1| OmpA family protein [Escherichia coli O157:H7 str. TW14588]
 gi|218354001|emb|CAV00488.1| putative outer membrane lipoprotien [Escherichia coli 55989]
 gi|218362880|emb|CAR00514.1| putative outer membrane lipoprotien [Escherichia coli IAI1]
 gi|218372303|emb|CAR20168.1| putative outer membrane lipoprotien [Escherichia coli IAI39]
 gi|218429407|emb|CAR10226.1| putative outer membrane lipoprotien [Escherichia coli ED1a]
 gi|218434284|emb|CAR15206.1| putative outer membrane lipoprotien [Escherichia coli UMN026]
 gi|227839298|gb|EEJ49764.1| outer membrane lipoprotein [Escherichia coli 83972]
 gi|238862715|gb|ACR64713.1| predicted outer membrane lipoprotein [Escherichia coli BW2952]
 gi|254594909|gb|ACT74270.1| outer membrane lipoprotein [Escherichia coli O157:H7 str. TW14359]
 gi|257756701|dbj|BAI28203.1| predicted outer membrane lipoprotein [Escherichia coli O26:H11 str.
           11368]
 gi|257761880|dbj|BAI33377.1| predicted outer membrane lipoprotein [Escherichia coli O103:H2 str.
           12009]
 gi|257766639|dbj|BAI38134.1| predicted outer membrane lipoprotein [Escherichia coli O111:H- str.
           11128]
 gi|260447432|gb|ACX37854.1| OmpA/MotB domain protein [Escherichia coli DH1]
 gi|284923586|emb|CBG36682.1| putative outer membrane protein [Escherichia coli 042]
 gi|290764802|gb|ADD58763.1| Inner membrane lipoprotein yiaD precursor [Escherichia coli O55:H7
           str. CB9615]
 gi|291321988|gb|EFE61419.1| outer membrane lipoprotein [Escherichia coli B088]
 gi|291425986|gb|EFE99020.1| outer membrane lipoprotein [Escherichia coli FVEC1412]
 gi|291431577|gb|EFF04562.1| outer membrane lipoprotein [Escherichia coli B185]
 gi|298276760|gb|EFI18278.1| outer membrane lipoprotein [Escherichia coli FVEC1302]
 gi|299878738|gb|EFI86949.1| OmpA family protein [Escherichia coli MS 196-1]
 gi|300308421|gb|EFJ62941.1| OmpA family protein [Escherichia coli MS 200-1]
 gi|300357615|gb|EFJ73485.1| OmpA family protein [Escherichia coli MS 198-1]
 gi|300395632|gb|EFJ79170.1| OmpA family protein [Escherichia coli MS 69-1]
 gi|300411301|gb|EFJ94839.1| OmpA family protein [Escherichia coli MS 45-1]
 gi|300412565|gb|EFJ95875.1| OmpA family protein [Escherichia coli MS 115-1]
 gi|300418280|gb|EFK01591.1| OmpA family protein [Escherichia coli MS 182-1]
 gi|300457770|gb|EFK21263.1| OmpA family protein [Escherichia coli MS 21-1]
 gi|300525409|gb|EFK46478.1| OmpA family protein [Escherichia coli MS 119-7]
 gi|300532114|gb|EFK53176.1| OmpA family protein [Escherichia coli MS 107-1]
 gi|300840082|gb|EFK67842.1| OmpA family protein [Escherichia coli MS 124-1]
 gi|301075768|gb|EFK90574.1| OmpA family protein [Escherichia coli MS 146-1]
 gi|306906028|gb|EFN36548.1| OmpA/MotB domain protein [Escherichia coli W]
 gi|307555658|gb|ADN48433.1| putative outer membrane protein [Escherichia coli ABU 83972]
 gi|308120254|gb|EFO57516.1| OmpA family protein [Escherichia coli MS 145-7]
 gi|310334550|gb|EFQ00755.1| inner membrane lipoprotein yiaD [Escherichia coli 1827-70]
 gi|312287364|gb|EFR15273.1| inner membrane lipoprotein yiaD [Escherichia coli 2362-75]
 gi|315062837|gb|ADT77164.1| predicted outer membrane lipoprotein [Escherichia coli W]
 gi|315138128|dbj|BAJ45287.1| inner membrane lipoprotein yiaD precursor [Escherichia coli DH1]
 gi|315254081|gb|EFU34049.1| OmpA family protein [Escherichia coli MS 85-1]
 gi|315294130|gb|EFU53482.1| OmpA family protein [Escherichia coli MS 153-1]
 gi|315300095|gb|EFU59333.1| OmpA family protein [Escherichia coli MS 16-3]
 gi|315618412|gb|EFU98999.1| inner membrane lipoprotein yiaD [Escherichia coli 3431]
 gi|320191391|gb|EFW66041.1| putative outer membrane protein [Escherichia coli O157:H7 str.
           EC1212]
 gi|320201426|gb|EFW76007.1| putative outer membrane protein [Escherichia coli EC4100B]
 gi|320639873|gb|EFX09467.1| putative outer membrane lipoprotein [Escherichia coli O157:H7 str.
           G5101]
 gi|320645036|gb|EFX14060.1| putative outer membrane lipoprotein [Escherichia coli O157:H- str.
           493-89]
 gi|320650303|gb|EFX18786.1| putative outer membrane lipoprotein [Escherichia coli O157:H- str.
           H 2687]
 gi|320655878|gb|EFX23801.1| putative outer membrane lipoprotein [Escherichia coli O55:H7 str.
           3256-97 TW 07815]
 gi|320661658|gb|EFX29073.1| putative outer membrane lipoprotein [Escherichia coli O55:H7 str.
           USDA 5905]
 gi|320666682|gb|EFX33665.1| putative outer membrane lipoprotein [Escherichia coli O157:H7 str.
           LSU-61]
 gi|323153881|gb|EFZ40115.1| inner membrane lipoprotein yiaD [Escherichia coli EPECa14]
 gi|323160679|gb|EFZ46618.1| inner membrane lipoprotein yiaD [Escherichia coli E128010]
 gi|323174210|gb|EFZ59838.1| inner membrane lipoprotein yiaD [Escherichia coli LT-68]
 gi|323179484|gb|EFZ65051.1| inner membrane lipoprotein yiaD [Escherichia coli 1180]
 gi|323182708|gb|EFZ68110.1| inner membrane lipoprotein yiaD [Escherichia coli 1357]
 gi|323376572|gb|ADX48840.1| OmpA/MotB domain protein [Escherichia coli KO11]
 gi|323934746|gb|EGB31133.1| OmpA family protein [Escherichia coli E1520]
 gi|323939549|gb|EGB35757.1| OmpA family protein [Escherichia coli E482]
 gi|323944551|gb|EGB40622.1| OmpA family protein [Escherichia coli H120]
 gi|323959435|gb|EGB55094.1| OmpA family protein [Escherichia coli H489]
 gi|323966022|gb|EGB61463.1| OmpA family protein [Escherichia coli M863]
 gi|323971357|gb|EGB66598.1| OmpA family protein [Escherichia coli TA007]
 gi|323975035|gb|EGB70144.1| OmpA family protein [Escherichia coli TW10509]
 gi|324007339|gb|EGB76558.1| OmpA family protein [Escherichia coli MS 57-2]
 gi|324014213|gb|EGB83432.1| OmpA family protein [Escherichia coli MS 60-1]
 gi|324021134|gb|EGB90353.1| OmpA family protein [Escherichia coli MS 117-3]
 gi|324116568|gb|EGC10485.1| OmpA family protein [Escherichia coli E1167]
 gi|326337443|gb|EGD61278.1| putative outer membrane protein [Escherichia coli O157:H7 str.
           1044]
 gi|326339968|gb|EGD63775.1| putative outer membrane protein [Escherichia coli O157:H7 str.
           1125]
 gi|327251203|gb|EGE62896.1| inner membrane lipoprotein yiaD [Escherichia coli STEC_7v]
 gi|331036557|gb|EGI08783.1| inner membrane lipoprotein YiaD [Escherichia coli H736]
 gi|331047204|gb|EGI19282.1| inner membrane lipoprotein YiaD [Escherichia coli M718]
 gi|331053083|gb|EGI25116.1| inner membrane lipoprotein YiaD [Escherichia coli TA206]
 gi|331057685|gb|EGI29671.1| inner membrane lipoprotein YiaD [Escherichia coli TA143]
 gi|331062448|gb|EGI34368.1| inner membrane lipoprotein YiaD [Escherichia coli TA271]
 gi|331067952|gb|EGI39350.1| inner membrane lipoprotein YiaD [Escherichia coli TA280]
 gi|331072805|gb|EGI44130.1| inner membrane lipoprotein YiaD [Escherichia coli H591]
 gi|331077586|gb|EGI48798.1| inner membrane lipoprotein YiaD [Escherichia coli H299]
 gi|332104471|gb|EGJ07817.1| OmpA family protein [Shigella sp. D9]
 gi|332345519|gb|AEE58853.1| inner membrane lipoprotein YiaD [Escherichia coli UMNK88]
          Length = 219

 Score = 86.7 bits (213), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 47/139 (33%), Positives = 79/139 (56%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D  E + + +++ TG+ V+R GD I   +P +V+F  S   L+      L  +A +L +
Sbjct: 81  MDVQEAKLRDKMRGTGVSVTRSGDNIILNMPNNVTFDSSSATLKPAGANTLTGVAMVLKE 140

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +P T + +  +TDS G    N+ +SQ+RAD + S LI +GV ++R I  +G     PI +
Sbjct: 141 YPKTAVNVIGYTDSTGGHDLNMRLSQQRADSVASALITQGVDASR-IRTQGLGPANPIAS 199

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T  G+  N+R+EI + P
Sbjct: 200 NSTAEGKAQNRRVEITLSP 218


>gi|293412987|ref|ZP_06655655.1| conserved hypothetical protein [Escherichia coli B354]
 gi|291468634|gb|EFF11127.1| conserved hypothetical protein [Escherichia coli B354]
          Length = 219

 Score = 86.7 bits (213), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 47/139 (33%), Positives = 78/139 (56%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D  E + + +++ TG+ V+R GD I   +P +V+F  S   L+      L  +A +L +
Sbjct: 81  MDVQEAKLRDKMRGTGVSVTRSGDNIILNMPNNVTFDSSSATLKPAGANTLTGVAMVLKE 140

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +P T + +  +TDS G    N+ +SQ+RAD + S LI +GV + R I  +G     PI +
Sbjct: 141 YPKTAVNVIGYTDSTGGHDLNMRLSQQRADSVASALITQGVDAGR-IRTQGLGPANPIAS 199

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T  G+  N+R+EI + P
Sbjct: 200 NSTAEGKAQNRRVEITLSP 218


>gi|254038735|ref|ZP_04872791.1| conserved hypothetical protein [Escherichia sp. 1_1_43]
 gi|226839241|gb|EEH71264.1| conserved hypothetical protein [Escherichia sp. 1_1_43]
 gi|309703955|emb|CBJ03298.1| putative outer membrane protein [Escherichia coli ETEC H10407]
          Length = 219

 Score = 86.7 bits (213), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 47/139 (33%), Positives = 79/139 (56%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D  E + + +++ TG+ V+R GD I   +P +V+F  S   L+      L  +A +L +
Sbjct: 81  MDVQEAKLRDKMRGTGVSVTRSGDNIILNMPNNVTFDSSSATLKPAGANTLTGVAMVLKE 140

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +P T + +  +TDS G    N+ +SQ+RAD + S LI +GV ++R I  +G     PI +
Sbjct: 141 YPKTAVNVIGYTDSTGGHDLNMRLSQQRADSVASALITQGVDASR-IRTQGLGPANPIAS 199

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T  G+  N+R+EI + P
Sbjct: 200 NSTAEGKAQNRRVEITLSP 218


>gi|320182069|gb|EFW56974.1| Outer membrane protein A precursor [Shigella boydii ATCC 9905]
          Length = 219

 Score = 86.3 bits (212), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 47/139 (33%), Positives = 79/139 (56%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D  E + + +++ TG+ V+R GD I   +P +V+F  S   L+      L  +A +L +
Sbjct: 81  MDVQEAKLRDKMRGTGVSVTRSGDNIILNMPNNVTFDSSSATLKPAGANTLTGVAMVLKE 140

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +P T + +  +TDS G    N+ +SQ+RAD + S LI +GV ++R I  +G     PI +
Sbjct: 141 YPKTAVNVIGYTDSTGGHDLNMRLSQQRADSVASALITQGVDASR-IRTQGLGPANPIAS 199

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T  G+  N+R+EI + P
Sbjct: 200 NSTAEGKAQNRRVEITLSP 218


>gi|87201185|ref|YP_498442.1| OmpA/MotB [Novosphingobium aromaticivorans DSM 12444]
 gi|87136866|gb|ABD27608.1| OmpA/MotB [Novosphingobium aromaticivorans DSM 12444]
          Length = 230

 Score = 86.3 bits (212), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 52/140 (37%), Positives = 76/140 (54%), Gaps = 4/140 (2%)

Query: 48  DKAEDEFQMQLQDTGIVVSRI--GDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILN 104
           DK   E + Q   TG+ V+    G  I   +P  V+F V    ++  F   L  +A  L 
Sbjct: 79  DKQIRELREQTAGTGVDVTETDNGQAILVNLPNGVTFDVDSSTVKPAFATTLDRVAQSLV 138

Query: 105 KFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPID 164
           ++P+++I +  HTDS G+   N  +S+ RA  +  YLI RGV   R  S +GF    PI 
Sbjct: 139 QYPNSLIDVYGHTDSTGSDAYNQALSERRARAVADYLISRGVGYARIRS-QGFGESQPIA 197

Query: 165 TNDTKVGRQNNQRIEIQIFP 184
           +NDT+ GRQ N+R+EI+I P
Sbjct: 198 SNDTEQGRQANRRVEIKIVP 217


>gi|194430954|ref|ZP_03063247.1| OmpA family protein [Shigella dysenteriae 1012]
 gi|194420409|gb|EDX36485.1| OmpA family protein [Shigella dysenteriae 1012]
 gi|332085980|gb|EGI91144.1| inner membrane lipoprotein yiaD [Shigella dysenteriae 155-74]
          Length = 219

 Score = 86.3 bits (212), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 47/139 (33%), Positives = 79/139 (56%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D  E + + +++ TG+ V+R GD I   +P +V+F  S   L+      L  +A +L +
Sbjct: 81  MDVQEAKLRDKMRGTGVSVTRSGDNIILNMPNNVTFDSSSATLKPAGANTLTGVAMVLKE 140

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +P T + +  +TDS G    N+ +SQ+RAD + S LI +GV ++R I  +G     PI +
Sbjct: 141 YPKTAVNVIGYTDSTGGHDLNMRLSQQRADSVASALITQGVDASR-IRTQGLGPANPIAS 199

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T  G+  N+R+EI + P
Sbjct: 200 NSTAEGKAQNRRVEITLSP 218


>gi|82545917|ref|YP_409864.1| outer membrane lipoprotein [Shigella boydii Sb227]
 gi|187734257|ref|YP_001882255.1| putative outer membrane lipoprotein [Shigella boydii CDC 3083-94]
 gi|81247328|gb|ABB68036.1| putative outer membrane protein [Shigella boydii Sb227]
 gi|187431249|gb|ACD10523.1| OmpA family protein [Shigella boydii CDC 3083-94]
 gi|320187083|gb|EFW61791.1| Outer membrane protein A precursor [Shigella flexneri CDC 796-83]
 gi|332089323|gb|EGI94427.1| inner membrane lipoprotein yiaD [Shigella boydii 3594-74]
          Length = 219

 Score = 86.3 bits (212), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 47/139 (33%), Positives = 79/139 (56%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D  E + + +++ TG+ V+R GD I   +P +V+F  S   L+      L  +A +L +
Sbjct: 81  MDVQEAKLRDKMRGTGVSVTRSGDNIILNMPNNVTFDSSSATLKPAGANTLTGVAMVLKE 140

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +P T + +  +TDS G    N+ +SQ+RAD + S LI +GV ++R I  +G     PI +
Sbjct: 141 YPKTAVNVIGYTDSTGGHDLNMRLSQQRADSVASALITQGVDASR-IRTQGLGPANPIAS 199

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T  G+  N+R+EI + P
Sbjct: 200 NSTAEGKAQNRRVEITLSP 218


>gi|30043431|gb|AAP19151.1| putative outer membrane protein [Shigella flexneri 2a str. 2457T]
 gi|56383924|gb|AAN45037.2| putative outer membrane protein [Shigella flexneri 2a str. 301]
 gi|332763439|gb|EGJ93678.1| ompA family protein [Shigella flexneri 2930-71]
          Length = 208

 Score = 86.3 bits (212), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 47/139 (33%), Positives = 79/139 (56%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D  E + + +++ TG+ V+R GD I   +P +V+F  S   L+      L  +A +L +
Sbjct: 70  MDVQEAKLRDKMRGTGVSVTRSGDNIILNMPNNVTFDSSSAPLKPAGANTLTGVAMVLKE 129

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +P T + +  +TDS G    N+ +SQ+RAD + S LI +GV ++R I  +G     PI +
Sbjct: 130 YPKTAVNVIGYTDSTGGHDLNMRLSQQRADSVASALITQGVDASR-IRTQGLGPANPIAS 188

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T  G+  N+R+EI + P
Sbjct: 189 NSTAEGKAQNRRVEITLSP 207


>gi|123444325|ref|YP_001008290.1| putative outer membrane lipoprotein [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|122091286|emb|CAL14172.1| putative lipoprotein [Yersinia enterocolitica subsp. enterocolitica
           8081]
          Length = 219

 Score = 86.3 bits (212), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 45/139 (32%), Positives = 79/139 (56%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVF-LEKKFLPMLQLIATILNK 105
           +D  E + + ++  TG+ V+R GD I   +P +V+F ++   L+      L  +A +L +
Sbjct: 81  MDVQEAKLREKMSGTGVSVTRQGDNIVLNMPNNVTFDTDSSNLKPAGANTLTGVAMVLKE 140

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +  T + +  +TDS G   +N+ +SQ+RAD + S LI +GV++NR I   G     P+ +
Sbjct: 141 YDKTAVNVTGYTDSTGARAHNMTLSQQRADSVGSALIVQGVAANR-IRTSGAGPDNPVAS 199

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T  G+  N+R+EI + P
Sbjct: 200 NSTAAGKAQNRRVEITLSP 218


>gi|71281842|ref|YP_271675.1| ompA family protein [Colwellia psychrerythraea 34H]
 gi|71147582|gb|AAZ28055.1| ompA family protein [Colwellia psychrerythraea 34H]
          Length = 222

 Score = 86.3 bits (212), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 44/139 (31%), Positives = 79/139 (56%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV-SEVFLEKKFLPMLQLIATILNK 105
           +D  E + + QL+D+G+ + R GD I   +P +++F  S   +   F  +L  +A +L +
Sbjct: 81  MDSQEAKLRKQLRDSGVSIQREGDKINLIMPGNITFATSSSNINTNFTGVLNSVALVLEE 140

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +  T++ +  HTDS G+ + N  +S+ERA  + +YL  + + S R + V GF    P+  
Sbjct: 141 YNKTLVVVSGHTDSSGSAQYNQKLSEERAGSVANYLRGQKILSER-LEVVGFGEAQPVAD 199

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N +  GR+ N+R+EI + P
Sbjct: 200 NQSAGGRELNRRVEITLLP 218


>gi|329297799|ref|ZP_08255135.1| putative outer membrane lipoprotein [Plautia stali symbiont]
          Length = 177

 Score = 86.3 bits (212), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 46/141 (32%), Positives = 80/141 (56%), Gaps = 2/141 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D  E + + +++ TG+ V+R GD I   +P +V+F  S   L+      L  +A +L +
Sbjct: 38  MDVQEAKLRDKMRGTGVSVTRQGDNIVLNMPNNVTFDSSSANLKPAGANTLTGVAMVLKE 97

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +P   + +   TDS GT   N+ +SQ+RA+ + S LI +GV+ NR +  +G     P+ +
Sbjct: 98  YPKAAVNVVGFTDSTGTRALNMRLSQQRAESVASALIVQGVAQNR-LRTQGMGPDNPVAS 156

Query: 166 NDTKVGRQNNQRIEIQIFPRG 186
           N T+ G+  N+R+EI + P G
Sbjct: 157 NSTEAGKAQNRRVEIPLSPLG 177


>gi|295095145|emb|CBK84235.1| Outer membrane protein and related peptidoglycan-associated
           (lipo)proteins [Enterobacter cloacae subsp. cloacae NCTC
           9394]
          Length = 220

 Score = 86.3 bits (212), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 47/139 (33%), Positives = 78/139 (56%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D  E + + +++ TG+ V+R GD I   +P +V+F  S   L+      L  +A +L +
Sbjct: 81  MDVQEAKLRDKMKGTGVSVTRSGDNIILNMPNNVTFDSSSATLKPAGANTLTGVAAVLKE 140

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +  T + +  +TDS G+   N+ +SQ+RAD + S LI +GV +NR I   G     PI +
Sbjct: 141 YNKTAVNVIGYTDSTGSQDLNMRLSQQRADSVASSLIAQGVEANR-IRTSGMGPANPIAS 199

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T  G+  N+R+EI + P
Sbjct: 200 NSTAEGKAQNRRVEITLSP 218


>gi|283835926|ref|ZP_06355667.1| OmpA family protein [Citrobacter youngae ATCC 29220]
 gi|291068103|gb|EFE06212.1| OmpA family protein [Citrobacter youngae ATCC 29220]
          Length = 220

 Score = 86.3 bits (212), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 48/139 (34%), Positives = 79/139 (56%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVF-LEKKFLPMLQLIATILNK 105
           +D  E + + ++Q TG+ V+R GD I   +P +V+F S    L+      L  +A +L +
Sbjct: 81  MDVQEAKLREKMQGTGVSVTRSGDNIILNMPNNVTFDSNSSNLKPAGANTLTGVAMVLKE 140

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +  T + +   TDS G+   N+ +SQ+RAD + S LI +GV++NR I  +G     PI +
Sbjct: 141 YDKTAVNVLGFTDSTGSQDLNMRLSQQRADSVASALITQGVAANR-IRTQGMGPANPIAS 199

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T  G+  N+R+EI + P
Sbjct: 200 NSTAEGKAQNRRVEITLSP 218


>gi|257126323|ref|YP_003164437.1| OmpA/MotB domain protein [Leptotrichia buccalis C-1013-b]
 gi|257050262|gb|ACV39446.1| OmpA/MotB domain protein [Leptotrichia buccalis C-1013-b]
          Length = 215

 Score = 86.3 bits (212), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 47/139 (33%), Positives = 80/139 (57%), Gaps = 3/139 (2%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGD-MITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILN 104
            D+ E E + +L+ TG+ V R G+  I    P +++F ++   ++ +F   L  +AT+L 
Sbjct: 74  FDRQEKELKDKLKGTGVEVRRTGEGEIKLTAPENITFDLNSYVVKPQFRGTLDSVATVLK 133

Query: 105 KFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPID 164
            +P + I +  HTD+ G    N  +S  RA  + SYL  +G++S+R ++ RG+  K PI 
Sbjct: 134 TYPDSTIIVSGHTDTSGNDAINNPLSVNRAASVASYLQSQGIASSR-MTYRGYGSKMPIA 192

Query: 165 TNDTKVGRQNNQRIEIQIF 183
           +N T+ GR  N+R+EI I 
Sbjct: 193 SNATEAGRAQNRRVEIAII 211


>gi|332996326|gb|EGK15953.1| inner membrane lipoprotein yiaD [Shigella flexneri VA-6]
          Length = 219

 Score = 86.3 bits (212), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 47/139 (33%), Positives = 79/139 (56%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D  E + + +++ TG+ V+R GD I   +P +V+F  S   L+      L  +A +L +
Sbjct: 81  MDVQEAKLRDKMRGTGVSVTRSGDNIILNMPNNVTFDSSSAPLKPAGANTLTGVAMVLKE 140

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +P T + +  +TDS G    N+ +SQ+RAD + S LI +GV ++R I  +G     PI +
Sbjct: 141 YPKTAVNVIGYTDSTGGHDLNMRLSQQRADSVASALITQGVDASR-IRTQGLGPANPIAS 199

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T  G+  N+R+EI + P
Sbjct: 200 NSTAEGKAQNRRVEITLSP 218


>gi|167644153|ref|YP_001681816.1| OmpA/MotB domain-containing protein [Caulobacter sp. K31]
 gi|167346583|gb|ABZ69318.1| OmpA/MotB domain protein [Caulobacter sp. K31]
          Length = 224

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 48/142 (33%), Positives = 77/142 (54%), Gaps = 1/142 (0%)

Query: 44  GSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATI 102
           G+ +D+ + +F+  L+ +G+++ R GD I   +P  V+F V +  ++ +F  +L  +A  
Sbjct: 80  GNYMDRQQADFRRGLEGSGVMIRRNGDQIVLVMPSDVTFAVDKSEVQPQFTRVLDDVART 139

Query: 103 LNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYP 162
           LN +P T I I  H DS G    N  +S+ RA  + SYL   G      + V G   + P
Sbjct: 140 LNAYPQTTIDIVGHADSSGPDDYNQTLSERRASSVASYLTNVGRVVPDRVFVAGQGERQP 199

Query: 163 IDTNDTKVGRQNNQRIEIQIFP 184
           I +NDT  GR  N+R+EI + P
Sbjct: 200 IASNDTPEGRAQNRRVEIILRP 221


>gi|332085086|gb|EGI90266.1| inner membrane lipoprotein yiaD [Shigella boydii 5216-82]
          Length = 238

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 47/139 (33%), Positives = 79/139 (56%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D  E + + +++ TG+ V+R GD I   +P +V+F  S   L+      L  +A +L +
Sbjct: 100 MDVQEAKLRDKMRGTGVSVTRSGDNIILNMPNNVTFDSSSATLKPAGANTLTGVAMVLKE 159

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +P T + +  +TDS G    N+ +SQ+RAD + S LI +GV ++R I  +G     PI +
Sbjct: 160 YPKTAVNVIGYTDSTGGHDLNMRLSQQRADSVASALITQGVDASR-IRTQGLGPANPIAS 218

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T  G+  N+R+EI + P
Sbjct: 219 NSTAEGKAQNRRVEITLSP 237


>gi|320173827|gb|EFW49008.1| putative outer membrane lipoprotein [Shigella dysenteriae CDC
           74-1112]
          Length = 195

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 47/139 (33%), Positives = 79/139 (56%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D  E + + +++ TG+ V+R GD I   +P +V+F  S   L+      L  +A +L +
Sbjct: 57  MDVQEAKLRDKMRGTGVSVTRSGDNIILNMPNNVTFDSSSATLKPAGANTLTGVAMVLKE 116

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +P T + +  +TDS G    N+ +SQ+RAD + S LI +GV ++R I  +G     PI +
Sbjct: 117 YPKTAVNVIGYTDSTGGHDLNMRLSQQRADSVASALITQGVDASR-IRTQGLGPANPIAS 175

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T  G+  N+R+EI + P
Sbjct: 176 NSTAEGKAQNRRVEITLSP 194


>gi|332996878|gb|EGK16497.1| inner membrane lipoprotein yiaD [Shigella flexneri K-272]
 gi|333013437|gb|EGK32809.1| inner membrane lipoprotein yiaD [Shigella flexneri K-227]
          Length = 219

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 47/139 (33%), Positives = 79/139 (56%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D  E + + +++ TG+ V+R GD I   +P +V+F  S   L+      L  +A +L +
Sbjct: 81  MDVQEAKLRDKMRGTGVSVTRSGDNIILNMPNNVTFDSSSAPLKPAGANTLTGVAMVLKE 140

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +P T + +  +TDS G    N+ +SQ+RAD + S LI +GV ++R I  +G     PI +
Sbjct: 141 YPKTAVNVIGYTDSTGGHDLNMRLSQQRADSVASALITQGVDASR-IRTQGLGPANPIAS 199

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T  G+  N+R+EI + P
Sbjct: 200 NSTAEGKAQNRRVEITLSP 218


>gi|309787755|ref|ZP_07682366.1| inner membrane lipoyiaD domain protein [Shigella dysenteriae 1617]
 gi|308924505|gb|EFP70001.1| inner membrane lipoyiaD domain protein [Shigella dysenteriae 1617]
          Length = 147

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 48/143 (33%), Positives = 80/143 (55%), Gaps = 2/143 (1%)

Query: 43  FGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIAT 101
            G  +D  E + + +++ TG+ V+R GD I   +P +V+F  S   L+      L  +A 
Sbjct: 5   VGYYMDVQEAKLRDKMRGTGVSVTRSGDNIILNMPNNVTFDSSSATLKPAGANTLTGVAM 64

Query: 102 ILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKY 161
           +L ++P T + +  +TDS G    N+ +SQ+RAD + S LI +GV ++R I  +G     
Sbjct: 65  VLKEYPKTAVNVIGYTDSTGGHDLNMRLSQQRADSVASALITQGVDASR-IRTQGLGPAN 123

Query: 162 PIDTNDTKVGRQNNQRIEIQIFP 184
           PI +N T  G+  N+R+EI + P
Sbjct: 124 PIASNSTAEGKAQNRRVEITLSP 146


>gi|256827978|ref|YP_003156706.1| OmpA/MotB domain-containing protein [Desulfomicrobium baculatum DSM
           4028]
 gi|256577154|gb|ACU88290.1| OmpA/MotB domain protein [Desulfomicrobium baculatum DSM 4028]
          Length = 223

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 49/141 (34%), Positives = 81/141 (57%), Gaps = 5/141 (3%)

Query: 47  LDKAEDEFQMQL-QDTGIVVSRIGDMITCYIPVHVSFV--SEVFLEKKFLPMLQLIATIL 103
           +D  E + +  L Q   + V R GD++   +   V+F   S+V L   +   ++ IA +L
Sbjct: 78  MDNQEADMRQALSQSEEVAVRREGDLLALTLKGDVTFAVDSDVVLPGLYTE-IERIAQVL 136

Query: 104 NKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPI 163
            K+P T I ++ HTDS G+   N  +S+ RA  ++  L++RGV+ +R I+  G+    P+
Sbjct: 137 VKYPQTTIVVEGHTDSTGSDTYNQALSERRAWSVQRLLVERGVNPSR-ITAMGYGESRPV 195

Query: 164 DTNDTKVGRQNNQRIEIQIFP 184
            TNDT  GRQ N+R+EI++ P
Sbjct: 196 ATNDTPEGRQMNRRVEIRVNP 216


>gi|110807356|ref|YP_690876.1| putative outer membrane lipoprotein [Shigella flexneri 5 str. 8401]
 gi|229088112|ref|NP_709330.3| putative outer membrane lipoprotein [Shigella flexneri 2a str. 301]
 gi|229089132|ref|NP_839340.2| putative outer membrane lipoprotein [Shigella flexneri 2a str.
           2457T]
 gi|110616904|gb|ABF05571.1| putative outer membrane protein [Shigella flexneri 5 str. 8401]
 gi|281602912|gb|ADA75896.1| putative outer membrane protein [Shigella flexneri 2002017]
 gi|313647591|gb|EFS12041.1| inner membrane lipoprotein yiaD [Shigella flexneri 2a str. 2457T]
 gi|332750012|gb|EGJ80424.1| inner membrane lipoprotein yiaD [Shigella flexneri K-671]
 gi|332750169|gb|EGJ80580.1| inner membrane lipoprotein yiaD [Shigella flexneri 4343-70]
 gi|332751243|gb|EGJ81646.1| inner membrane lipoprotein yiaD [Shigella flexneri 2747-71]
 gi|332997456|gb|EGK17072.1| inner membrane lipoprotein yiaD [Shigella flexneri K-218]
 gi|333012432|gb|EGK31813.1| inner membrane lipoprotein yiaD [Shigella flexneri K-304]
          Length = 216

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 47/139 (33%), Positives = 79/139 (56%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D  E + + +++ TG+ V+R GD I   +P +V+F  S   L+      L  +A +L +
Sbjct: 78  MDVQEAKLRDKMRGTGVSVTRSGDNIILNMPNNVTFDSSSAPLKPAGANTLTGVAMVLKE 137

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +P T + +  +TDS G    N+ +SQ+RAD + S LI +GV ++R I  +G     PI +
Sbjct: 138 YPKTAVNVIGYTDSTGGHDLNMRLSQQRADSVASALITQGVDASR-IRTQGLGPANPIAS 196

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T  G+  N+R+EI + P
Sbjct: 197 NSTAEGKAQNRRVEITLSP 215


>gi|326562151|gb|EGE12479.1| OmpA/MotB domain protein [Moraxella catarrhalis 7169]
 gi|326565667|gb|EGE15830.1| OmpA/MotB domain protein [Moraxella catarrhalis 12P80B1]
 gi|326566236|gb|EGE16388.1| OmpA/MotB domain protein [Moraxella catarrhalis 103P14B1]
 gi|326567112|gb|EGE17234.1| OmpA/MotB domain protein [Moraxella catarrhalis BC1]
 gi|326576199|gb|EGE26114.1| OmpA/MotB domain protein [Moraxella catarrhalis CO72]
          Length = 224

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 48/144 (33%), Positives = 79/144 (54%), Gaps = 5/144 (3%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDM--ITCYIPVHVSFV-SEVFLEKKFLPMLQLIATIL 103
           +++   + + Q+Q TG+ V+   D   I   +P +++F   +  L   FL  L  +A  +
Sbjct: 81  MERQAKQIEQQMQGTGVTVTHDTDTGNINLTMPGNITFAHDDDTLNSAFLGRLNQLANTM 140

Query: 104 NKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPI 163
           N++  T I I  HTDS G    N  +S+ RAD ++ YLI +GV   R  +V G+  + PI
Sbjct: 141 NQYHETTIVIVGHTDSTGQAAYNQELSERRADSVRYYLINQGVDPYRIQTV-GYGMRQPI 199

Query: 164 DTNDTKVGRQNNQRIEIQIF-PRG 186
            +N T+ GR  N+R+E+ I  P+G
Sbjct: 200 ASNATEAGRAQNRRVELMILAPQG 223


>gi|317494692|ref|ZP_07953104.1| OmpA family protein [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316917294|gb|EFV38641.1| OmpA family protein [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 219

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 46/139 (33%), Positives = 80/139 (57%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D  E + + +++ TG+ V+R GD I   +P +V+F  S   L+      L  +A +L +
Sbjct: 81  MDVQESKLRDKMRGTGVSVTRQGDNIILNMPNNVTFDSSSSTLKPAGANTLTGVAMVLKE 140

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +P T + +  +TDS G+   N+ +SQ+RAD + S LI +GV ++R +  +G     PI +
Sbjct: 141 YPKTAVNVVGYTDSTGSQDLNMRLSQQRADSVASALIVQGVEASR-VRTQGMGPANPIAS 199

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T  G+  N+R+EI + P
Sbjct: 200 NSTAEGKAQNRRVEITLSP 218


>gi|296100590|ref|YP_003610736.1| putative outer membrane lipoprotein [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
 gi|295055049|gb|ADF59787.1| putative outer membrane lipoprotein [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
          Length = 220

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 47/139 (33%), Positives = 79/139 (56%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D  E + + +++ TG+ V+R GD I   +P +V+F  S   L+      L  +A +L +
Sbjct: 81  MDVQEAKLRDKMKGTGVSVTRSGDNIILNMPNNVTFDSSSATLKPAGANTLTGVAMVLKE 140

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +  T + +  +TDS G+ + N+ +SQ+RAD + S LI +GV +NR I   G     PI +
Sbjct: 141 YNKTAVNVIGYTDSTGSQELNMRLSQQRADSVASSLITQGVEANR-IRTSGMGPANPIAS 199

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T  G+  N+R+EI + P
Sbjct: 200 NSTAEGKAQNRRVEITLSP 218


>gi|301047095|ref|ZP_07194195.1| OmpA family protein [Escherichia coli MS 185-1]
 gi|300300982|gb|EFJ57367.1| OmpA family protein [Escherichia coli MS 185-1]
          Length = 219

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 47/139 (33%), Positives = 79/139 (56%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D  E + + +++ TG+ V+R GD I   +P +V+F  S   L+      L  +A +L +
Sbjct: 81  MDVQEAKLRDKMRGTGVSVTRSGDNIILNMPNNVTFDSSSATLKPAGANPLTGVAMVLKE 140

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +P T + +  +TDS G    N+ +SQ+RAD + S LI +GV ++R I  +G     PI +
Sbjct: 141 YPKTAVNVIGYTDSTGGHDLNMRLSQQRADSVASALIPQGVDASR-IRTQGLGPANPIAS 199

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T  G+  N+R+EI + P
Sbjct: 200 NSTAEGKAQNRRVEITLSP 218


>gi|218893200|ref|YP_002442069.1| hypothetical protein PLES_44851 [Pseudomonas aeruginosa LESB58]
 gi|218773428|emb|CAW29240.1| hypothetical protein PLES_44851 [Pseudomonas aeruginosa LESB58]
          Length = 237

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 46/138 (33%), Positives = 73/138 (52%), Gaps = 2/138 (1%)

Query: 48  DKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSE-VFLEKKFLPMLQLIATILNKF 106
           DK E E + Q++ TG+ V R GD I   +P +++F ++   +   F   L  +A    ++
Sbjct: 87  DKQEAELRRQMEGTGVEVQRQGDDIKLIMPGNITFATDSANIAPSFYAPLNNLANSFKQY 146

Query: 107 PSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTN 166
               I I  +TDS G+ ++N+ +SQ RA  +  YL   GV   R +S RG     PI +N
Sbjct: 147 NQNTIEIVGYTDSTGSRQHNMDLSQRRAQSVAGYLTALGVDGTR-LSTRGMGPDQPIASN 205

Query: 167 DTKVGRQNNQRIEIQIFP 184
            T  GR  N+R+E+ + P
Sbjct: 206 STADGRAQNRRVEVNLRP 223


>gi|90413724|ref|ZP_01221712.1| Putative OmpA family protein [Photobacterium profundum 3TCK]
 gi|90325193|gb|EAS41690.1| Putative OmpA family protein [Photobacterium profundum 3TCK]
          Length = 241

 Score = 85.9 bits (211), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 47/139 (33%), Positives = 80/139 (57%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D  E + + QL+ TGI V+R GD I   +P  ++F + +  L  + +  L+ +A +  +
Sbjct: 102 MDVQETKLRQQLESTGISVTRDGDNIVLNMPNEITFGIDQSDLSSRAVAALKNVALVAKE 161

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +  T+I +   TDS G+   N  +SQ RA  + S L++ GV++NR I+ +G     PI +
Sbjct: 162 YDKTLINVYGFTDSTGSASYNQRLSQVRASEVSSNLMRGGVAANRVIT-KGMGEAKPIAS 220

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T+ GR  N+R+EI + P
Sbjct: 221 NKTEQGRAENRRVEIVLSP 239


>gi|323189288|gb|EFZ74571.1| inner membrane lipoprotein yiaD [Escherichia coli RN587/1]
          Length = 219

 Score = 85.5 bits (210), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 47/139 (33%), Positives = 79/139 (56%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D  E + + +++ TG+ V+R GD I   +P +V+F  S   L+      L  +A +L +
Sbjct: 81  MDVQEAKLRDKMRGTGVSVTRSGDNIILNMPNNVTFDSSSATLKLAGANTLTGVAMVLKE 140

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +P T + +  +TDS G    N+ +SQ+RAD + S LI +GV ++R I  +G     PI +
Sbjct: 141 YPKTAVNVIGYTDSTGGHDLNMRLSQQRADSVASALITQGVDASR-IRTQGLGPANPIAS 199

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T  G+  N+R+EI + P
Sbjct: 200 NSTSEGKAQNRRVEITLSP 218


>gi|88810246|ref|ZP_01125503.1| OmpA-OmpF family porin [Nitrococcus mobilis Nb-231]
 gi|88791876|gb|EAR22986.1| OmpA-OmpF family porin [Nitrococcus mobilis Nb-231]
          Length = 230

 Score = 85.5 bits (210), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 48/139 (34%), Positives = 79/139 (56%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D  E + + ++Q TG+ V+R GD I   +P +V+F +    L+      L  +A +L +
Sbjct: 92  MDVQEAKLREKMQGTGVSVTRQGDAIILNMPNNVTFDIDSSSLKPAGANTLTGVAMVLKE 151

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +  T + +  HTDS G   +N+ +S++RAD + S LI +GV++NR I   G     PI +
Sbjct: 152 YDQTGVNVVGHTDSTGGHAHNMKLSKKRADSVASSLIIQGVAANR-IRTAGVGPDDPIAS 210

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T  GR  N+R+EI + P
Sbjct: 211 NSTAEGRAQNRRVEITLTP 229


>gi|269121368|ref|YP_003309545.1| OmpA/MotB domain protein [Sebaldella termitidis ATCC 33386]
 gi|268615246|gb|ACZ09614.1| OmpA/MotB domain protein [Sebaldella termitidis ATCC 33386]
          Length = 215

 Score = 85.5 bits (210), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 47/141 (33%), Positives = 79/141 (56%), Gaps = 3/141 (2%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGD-MITCYIPVHVSFVS-EVFLEKKFLPMLQLIATILN 104
            DK E + +  L+ TG+ V+R  +  I    P +V+F +    +  +F   L  IA++L 
Sbjct: 76  FDKQEAKLREDLKGTGVEVTRTAEGEIKLVAPENVTFATNSSTISSRFTNTLDSIASVLK 135

Query: 105 KFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPID 164
           ++P + I +  HTDS G    N  +S  RA+ + +YL Q G++S+R  +V G+  K P+ 
Sbjct: 136 EYPDSNITVSGHTDSTGNDAINNPLSVNRANSVANYLKQEGIASSRITAV-GYGSKQPVA 194

Query: 165 TNDTKVGRQNNQRIEIQIFPR 185
           +N T  GR  N+R+EI+I  +
Sbjct: 195 SNSTSDGRAQNRRVEIKITAK 215


>gi|466690|gb|AAB18529.1| unnamed protein product [Escherichia coli str. K-12 substr. MG1655]
          Length = 219

 Score = 85.5 bits (210), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 47/139 (33%), Positives = 78/139 (56%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D  E   + +++ TG+ V+R GD I   +P +V+F  S   L+      L  +A +L +
Sbjct: 81  MDVQEANVRDKMRGTGVSVTRSGDNIILNMPNNVTFDSSSATLKPAGANTLTGVAMVLKE 140

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +P T + +  +TDS G    N+ +SQ+RAD + S LI +GV ++R I  +G     PI +
Sbjct: 141 YPKTAVNVIGYTDSTGGHDLNMRLSQQRADSVASALITQGVDASR-IRTQGLGPANPIAS 199

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T  G+  N+R+EI + P
Sbjct: 200 NSTAEGKAQNRRVEITLSP 218


>gi|326564485|gb|EGE14711.1| OmpA/MotB domain protein [Moraxella catarrhalis 46P47B1]
 gi|326568376|gb|EGE18456.1| OmpA/MotB domain protein [Moraxella catarrhalis BC7]
 gi|326572277|gb|EGE22272.1| OmpA/MotB domain protein [Moraxella catarrhalis BC8]
 gi|326574291|gb|EGE24238.1| OmpA/MotB domain protein [Moraxella catarrhalis O35E]
 gi|326574875|gb|EGE24805.1| OmpA/MotB domain protein [Moraxella catarrhalis 101P30B1]
          Length = 224

 Score = 85.5 bits (210), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 48/144 (33%), Positives = 79/144 (54%), Gaps = 5/144 (3%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDM--ITCYIPVHVSFV-SEVFLEKKFLPMLQLIATIL 103
           +++   + + Q+Q TG+ V+   D   I   +P +++F   +  L   FL  L  +A  +
Sbjct: 81  MERQAKQIEQQMQGTGVTVTHDTDTGNINLTMPGNITFAHDDDTLNSAFLGRLNQLANTM 140

Query: 104 NKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPI 163
           N++  T I I  HTDS G    N  +S+ RAD ++ YLI +GV   R  +V G+  + PI
Sbjct: 141 NQYHETTIVIVGHTDSTGQAAYNQELSERRADSVRYYLINQGVDPYRIQTV-GYGIRQPI 199

Query: 164 DTNDTKVGRQNNQRIEIQIF-PRG 186
            +N T+ GR  N+R+E+ I  P+G
Sbjct: 200 ASNATEAGRAQNRRVELMILAPQG 223


>gi|188036026|pdb|2K1S|A Chain A, Solution Nmr Structure Of The Folded C-Terminal Fragment
           Of Yiad From Escherichia Coli. Northeast Structural
           Genomics Consortium Target Er553
          Length = 149

 Score = 85.5 bits (210), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 47/139 (33%), Positives = 79/139 (56%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D  E + + +++ TG+ V+R GD I   +P +V+F  S   L+      L  +A +L +
Sbjct: 3   MDVQEAKLRDKMRGTGVSVTRSGDNIILNMPNNVTFDSSSATLKPAGANTLTGVAMVLKE 62

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +P T + +  +TDS G    N+ +SQ+RAD + S LI +GV ++R I  +G     PI +
Sbjct: 63  YPKTAVNVIGYTDSTGGHDLNMRLSQQRADSVASALITQGVDASR-IRTQGLGPANPIAS 121

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T  G+  N+R+EI + P
Sbjct: 122 NSTAEGKAQNRRVEITLSP 140


>gi|104780138|ref|YP_606636.1| OmpA family outer membrane protein [Pseudomonas entomophila L48]
 gi|95109125|emb|CAK13822.1| putative outer membrane protein, OmpA family [Pseudomonas
           entomophila L48]
          Length = 239

 Score = 85.5 bits (210), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 44/138 (31%), Positives = 76/138 (55%), Gaps = 2/138 (1%)

Query: 48  DKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSE-VFLEKKFLPMLQLIATILNKF 106
           DK E E + ++ +TG+ V R GD I   +P +++F ++   +   F   L  +A    +F
Sbjct: 87  DKQEAELRAKMANTGVEVQRQGDQIKLIMPGNITFATDSANISPSFYSPLNNLANSFKQF 146

Query: 107 PSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTN 166
               I +   TDS G+ ++N+ +SQ RA  + +YL  +GV ++R ++VRG     PI +N
Sbjct: 147 NQNTIEVVGFTDSTGSRQHNMDLSQRRAQAVSTYLTSQGVDASR-VTVRGMGPDQPIASN 205

Query: 167 DTKVGRQNNQRIEIQIFP 184
               GR  N+R+E+ + P
Sbjct: 206 ADANGRAQNRRVEVNLKP 223


>gi|296113807|ref|YP_003627745.1| OmpA/MotB domain protein [Moraxella catarrhalis RH4]
 gi|295921501|gb|ADG61852.1| OmpA/MotB domain protein [Moraxella catarrhalis RH4]
          Length = 224

 Score = 85.5 bits (210), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 48/144 (33%), Positives = 79/144 (54%), Gaps = 5/144 (3%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDM--ITCYIPVHVSFV-SEVFLEKKFLPMLQLIATIL 103
           +++   + + Q+Q TG+ V+   D   I   +P +++F   +  L   FL  L  +A  +
Sbjct: 81  MERQAKQIEQQMQGTGVTVTHDTDTGNINLTMPGNITFAHDDDTLNSAFLGRLNQLANTM 140

Query: 104 NKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPI 163
           N++  T I I  HTDS G    N  +S+ RAD ++ YLI +GV   R  +V G+  + PI
Sbjct: 141 NQYHETTIVIVGHTDSTGQAAYNQELSERRADSVRYYLINQGVDPYRIQTV-GYGIRQPI 199

Query: 164 DTNDTKVGRQNNQRIEIQIF-PRG 186
            +N T+ GR  N+R+E+ I  P+G
Sbjct: 200 ASNATEAGRAQNRRVELMILAPQG 223


>gi|238793173|ref|ZP_04636801.1| Inner membrane lipoprotein yiaD [Yersinia intermedia ATCC 29909]
 gi|238727546|gb|EEQ19072.1| Inner membrane lipoprotein yiaD [Yersinia intermedia ATCC 29909]
          Length = 219

 Score = 85.5 bits (210), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 45/139 (32%), Positives = 79/139 (56%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVF-LEKKFLPMLQLIATILNK 105
           +D  E + + ++  TG+ V+R GD I   +P +V+F ++   L+      L  +A +L +
Sbjct: 81  MDVQEAKLREKMSGTGVSVTRQGDNIVLNMPNNVTFDTDSSNLKPAGANTLTGVAMVLKE 140

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +  T + +  +TDS G   +N+ +SQ+RAD + S LI +GV++NR I   G     P+ +
Sbjct: 141 YDKTAVNVTGYTDSSGARAHNMTLSQQRADSVGSALIVQGVAANR-IRTSGAGPDNPVAS 199

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T  G+  N+R+EI + P
Sbjct: 200 NSTAAGKAQNRRVEITLSP 218


>gi|304398041|ref|ZP_07379916.1| OmpA/MotB domain protein [Pantoea sp. aB]
 gi|304354327|gb|EFM18699.1| OmpA/MotB domain protein [Pantoea sp. aB]
          Length = 219

 Score = 85.5 bits (210), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 45/139 (32%), Positives = 82/139 (58%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVF-LEKKFLPMLQLIATILNK 105
           +D  E + + +++ TG+ V+R GD I   +P +V+F S    L+      L  ++ +L +
Sbjct: 81  MDVQEAKLRDKMRGTGVSVTRNGDNIVLNMPNNVTFDSNSSNLKPAGANTLTGVSMVLKE 140

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +P T + +  +TDS G+   N+ +SQ+RA+ + S LI +GV+S+R +  +G     P+ T
Sbjct: 141 YPKTAVNVVGYTDSTGSRALNMRLSQQRAESVASALIVQGVASDR-LRTQGAGPDNPVAT 199

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T+ G+  N+R+EI + P
Sbjct: 200 NSTEAGKAQNRRVEITLSP 218


>gi|260773001|ref|ZP_05881917.1| outer membrane protein [Vibrio metschnikovii CIP 69.14]
 gi|260612140|gb|EEX37343.1| outer membrane protein [Vibrio metschnikovii CIP 69.14]
          Length = 222

 Score = 85.5 bits (210), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 59/221 (26%), Positives = 104/221 (47%), Gaps = 39/221 (17%)

Query: 2   IKELGLSMFIMTTISGCGLASREKKKVFLHKSNDT-------------------DIVNKR 42
           +K++ L+M ++ T+SGC    R+       ++N                     D   +R
Sbjct: 1   MKKITLAMALVITLSGCAATQRQNATTGESETNAATRGALIGAVAGAAAGLATGDNAKQR 60

Query: 43  FGSSL-----------------DKAEDEFQMQLQDTGIVVSRIGD-MITCYIPVHVSFVS 84
              +L                 D+ E   + +L  +G+ V R+GD  +   +   + F +
Sbjct: 61  RQRALIGATGGAAVGGGVGYYFDQQEAALREELLHSGVQVQRVGDNQLLLRMENGIGFQT 120

Query: 85  EVF-LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQ 143
             + L+      L+ +A IL ++P T + I  HTDS G    N ++S+ RA+ ++S+L+ 
Sbjct: 121 NSYQLDSSIHRTLRGVAKILVQYPDTSLVIDGHTDSTGGDTTNQVLSERRAESVRSFLLS 180

Query: 144 RGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           +GV+  R I+ RG   ++PI TN T  GR  N+R++IQI P
Sbjct: 181 QGVAPGRAIA-RGNGSRFPICTNSTVEGRACNRRVDIQILP 220


>gi|322830754|ref|YP_004210781.1| OmpA/MotB domain protein [Rahnella sp. Y9602]
 gi|321165955|gb|ADW71654.1| OmpA/MotB domain protein [Rahnella sp. Y9602]
          Length = 220

 Score = 85.1 bits (209), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 46/139 (33%), Positives = 78/139 (56%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D  E + + +++ TG+ V+R GD I   +P +V+F  +   L+      L  +A +L +
Sbjct: 81  MDVQEAKLRDKMKGTGVSVTRQGDNIVLNMPNNVTFDTNSSTLKPAGANTLTGVAMVLKE 140

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +P T + +  +TDS GT   N+ +SQ+RAD + S LI +GV  +R +   G     PI  
Sbjct: 141 YPKTAVNVIGYTDSTGTRALNMKLSQQRADGVGSALITQGVEGSR-VHTTGAGPDNPIAG 199

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T+ G+  N+R+EI + P
Sbjct: 200 NSTEAGKAQNRRVEITLSP 218


>gi|127511841|ref|YP_001093038.1| OmpA/MotB domain-containing protein [Shewanella loihica PV-4]
 gi|126637136|gb|ABO22779.1| OmpA/MotB domain protein [Shewanella loihica PV-4]
          Length = 224

 Score = 85.1 bits (209), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 50/139 (35%), Positives = 76/139 (54%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D  E E + QLQ TG+ V+R GD I   +P  V+F V +  L  +   +L  +A +  +
Sbjct: 83  MDVQEAELRKQLQSTGVSVTRNGDNIILNMPNEVTFGVDQSVLSSRAKNVLDSVALVAKE 142

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +  T++ +   TDS G+   NL +SQ RA  + +YL+ R + S R  SV G     PI  
Sbjct: 143 YDETMLNVMGFTDSSGSESYNLRLSQVRAAEVANYLMSREIKSQRISSV-GMGESRPIAD 201

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T+ GR  N+R+EI + P
Sbjct: 202 NSTQQGRAQNRRVEIVLSP 220


>gi|149190355|ref|ZP_01868628.1| outer membrane protein [Vibrio shilonii AK1]
 gi|148835844|gb|EDL52808.1| outer membrane protein [Vibrio shilonii AK1]
          Length = 219

 Score = 85.1 bits (209), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 46/139 (33%), Positives = 84/139 (60%), Gaps = 3/139 (2%)

Query: 48  DKAEDEFQMQLQDTGIVVSRIGD-MITCYIPVHVSFVSEVF-LEKKFLPMLQLIATILNK 105
           D+ E   + +L ++G+ V R+GD  +   +   + F S    L       L+ +A IL +
Sbjct: 80  DQQEKALRQELLNSGVQVERVGDNQLLLRLENGIGFDSNSHALNSSIHNTLRGVARILVE 139

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +P+T + I+ +TDS G+ + N  +S++RA+ ++S+LI + V++ R ++ RG   ++PI +
Sbjct: 140 YPNTSLVIEGYTDSTGSAQYNQELSEKRAEQVRSFLISQNVAAGRAVA-RGNGERFPICS 198

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T  GRQ N+R+EI+I P
Sbjct: 199 NSTPEGRQCNRRVEIKILP 217


>gi|163801079|ref|ZP_02194979.1| putative lipoprotein [Vibrio sp. AND4]
 gi|159175428|gb|EDP60225.1| putative lipoprotein [Vibrio sp. AND4]
          Length = 219

 Score = 85.1 bits (209), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 46/139 (33%), Positives = 80/139 (57%), Gaps = 3/139 (2%)

Query: 48  DKAEDEFQMQLQDTGIVVSRIGD-MITCYIPVHVSFVSEVF-LEKKFLPMLQLIATILNK 105
           D+ E E +  L ++G+ V R+G+  +   +   + F S  + L+      L+ +A IL +
Sbjct: 80  DQQEAELRRALLNSGVQVERVGENQLLLRMENGIGFTSSSYQLDSSIHNTLRGVARILVE 139

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +P T + I  +TDS G+   N  +S+ RA+ ++ YL+ + V++ R I+ RG+  + PI +
Sbjct: 140 YPDTSLVIDGYTDSTGSDSYNQTLSERRAESVRQYLVSQNVAAGRAIA-RGYGERNPICS 198

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T  GR  N+R+EIQI P
Sbjct: 199 NQTSDGRACNRRVEIQILP 217


>gi|226946149|ref|YP_002801222.1| OmpA family protein [Azotobacter vinelandii DJ]
 gi|226721076|gb|ACO80247.1| OmpA family protein [Azotobacter vinelandii DJ]
          Length = 222

 Score = 84.7 bits (208), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 43/138 (31%), Positives = 75/138 (54%), Gaps = 2/138 (1%)

Query: 48  DKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVS-EVFLEKKFLPMLQLIATILNKF 106
           DK E + + Q+  TG+ V R G+ I   +P +++F +    +   F   L  +A    ++
Sbjct: 76  DKQEAQLRQQMAGTGVEVQRQGNDIKLIMPGNITFATGSAEIASNFYTPLNDLANSFKQY 135

Query: 107 PSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTN 166
               I +  HTDS G+ + N+ +SQ RA  + +YL+ +GV+  R ++ RG     P+ +N
Sbjct: 136 DQNSIEVIGHTDSTGSYQTNMSLSQRRAQSVANYLVAQGVNGAR-VTTRGAGPDSPVASN 194

Query: 167 DTKVGRQNNQRIEIQIFP 184
            T+ GR  N+R+EI + P
Sbjct: 195 ATESGRSQNRRVEINLRP 212


>gi|119776228|ref|YP_928968.1| OmpA family protein [Shewanella amazonensis SB2B]
 gi|119768728|gb|ABM01299.1| OmpA family protein [Shewanella amazonensis SB2B]
          Length = 222

 Score = 84.7 bits (208), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 48/141 (34%), Positives = 80/141 (56%), Gaps = 2/141 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D  E + + QLQ +G+ V+R GD I   +P  V+F V +  L  + + +L  +A +  +
Sbjct: 83  MDVQETKLRQQLQASGVSVTRNGDNIILNMPNDVTFAVDKTDLSPRAMQVLDSVALVAKE 142

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +  T + +  +TDS G    NL +SQ RA  + +YL+ +GV++ R +S +G     PI +
Sbjct: 143 YSKTRLNVLGYTDSSGADSYNLRLSQVRASEVGNYLLSKGVAAAR-VSTQGMGEASPIAS 201

Query: 166 NDTKVGRQNNQRIEIQIFPRG 186
           N T  GR  N+R+EI + P G
Sbjct: 202 NATAEGRAQNRRVEIILTPIG 222


>gi|238918002|ref|YP_002931516.1| outer membrane lipoprotein [Edwardsiella ictaluri 93-146]
 gi|238867570|gb|ACR67281.1| inner membrane lipoprotein YiaD [Edwardsiella ictaluri 93-146]
          Length = 219

 Score = 84.7 bits (208), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 47/139 (33%), Positives = 79/139 (56%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVF-LEKKFLPMLQLIATILNK 105
           +D  E + + +++ TG+ V+R GD I   +P +V+F S    L+      L  +A +L +
Sbjct: 81  MDVQEAKLRDKMRGTGVSVTRQGDNIVLNMPNNVTFDSNSSNLKPAGANTLTGVAMVLKE 140

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +  T + +  +TDS G+   N+ +SQ+RAD + S LI +GVS+ R  ++ G     PI T
Sbjct: 141 YQKTAVNVVGYTDSTGSRDLNMRLSQQRADSVASALIVQGVSAGRIRTI-GMGPANPIAT 199

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T  G+  N+R+EI + P
Sbjct: 200 NSTAAGKAQNRRVEITLSP 218


>gi|269137375|ref|YP_003294075.1| putative outer membrane lipoprotein [Edwardsiella tarda EIB202]
 gi|267983035|gb|ACY82864.1| putative outer membrane lipoprotein [Edwardsiella tarda EIB202]
 gi|304557476|gb|ADM40140.1| Outer membrane protein [Edwardsiella tarda FL6-60]
          Length = 219

 Score = 84.7 bits (208), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 47/139 (33%), Positives = 79/139 (56%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVF-LEKKFLPMLQLIATILNK 105
           +D  E + + +++ TG+ V+R GD I   +P +V+F S    L+      L  +A +L +
Sbjct: 81  MDVQEAKLRDKMRGTGVSVTRQGDNIVLNMPNNVTFDSNSSNLKPAGANTLTGVAMVLKE 140

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +  T + +  +TDS G+   N+ +SQ+RAD + S LI +GVS+ R  ++ G     PI T
Sbjct: 141 YQKTAVNVVGYTDSTGSRDLNMRLSQQRADSVASALIVQGVSAGRIRTI-GMGPANPIAT 199

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T  G+  N+R+EI + P
Sbjct: 200 NSTAAGKAQNRRVEITLSP 218


>gi|85858897|ref|YP_461099.1| outer membrane OmpA family protein [Syntrophus aciditrophicus SB]
 gi|85721988|gb|ABC76931.1| outer membrane OmpA family protein [Syntrophus aciditrophicus SB]
          Length = 180

 Score = 84.7 bits (208), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 43/120 (35%), Positives = 72/120 (60%), Gaps = 2/120 (1%)

Query: 64  VVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGT 122
            V+R G+++       V+F  +   +       +  +A +L ++P T I ++ +TDS G+
Sbjct: 53  AVTREGNLLAVTFKGDVTFDTNSAEIRPDLYFEIDRVAGVLKQYPDTFIRVEGYTDSKGS 112

Query: 123 LKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
              N+ +S+ RA+ +K+ L+QRGV+ NR I V GF    P+ TNDT+ GRQ N+R+EI+I
Sbjct: 113 DTYNMDLSKRRANAVKNLLVQRGVAENR-IEVVGFGETMPVATNDTEAGRQKNRRVEIKI 171


>gi|269103827|ref|ZP_06156524.1| putative OmpA family protein [Photobacterium damselae subsp.
           damselae CIP 102761]
 gi|268163725|gb|EEZ42221.1| putative OmpA family protein [Photobacterium damselae subsp.
           damselae CIP 102761]
          Length = 229

 Score = 84.3 bits (207), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 46/141 (32%), Positives = 78/141 (55%), Gaps = 2/141 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D    + + QL  +GI V+R G+ I   +P  ++F V +  L ++ +  L  +A +  +
Sbjct: 90  MDVQAAKLRKQLASSGITVTRNGNNIVLNMPNEITFGVDQTTLNQRAMNALHNVALVAKE 149

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +  T + +   TDS G    N  +SQ RA  + +YLI++GV++NR +S +G     PI T
Sbjct: 150 YNKTQLNVYGFTDSTGAASYNQRLSQVRAAEVGNYLIRQGVAANRVVS-QGMGEASPIAT 208

Query: 166 NDTKVGRQNNQRIEIQIFPRG 186
           N T  GR  N+R++I + P G
Sbjct: 209 NSTAAGRAENRRVQIVMSPLG 229


>gi|238798361|ref|ZP_04641844.1| Inner membrane lipoprotein yiaD [Yersinia mollaretii ATCC 43969]
 gi|238717819|gb|EEQ09652.1| Inner membrane lipoprotein yiaD [Yersinia mollaretii ATCC 43969]
          Length = 219

 Score = 84.3 bits (207), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 45/139 (32%), Positives = 78/139 (56%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVF-LEKKFLPMLQLIATILNK 105
           +D  E + + ++  TG+ V+R GD I   +P +V+F ++   L+      L  +A +L +
Sbjct: 81  MDVQEAKLREKMSGTGVSVTRQGDNIVLNMPNNVTFDTDSSNLKPAGANTLTGVAMVLKE 140

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +  T + +   TDS G   +N+ +SQ+RAD + S LI +GV++NR I   G     P+ +
Sbjct: 141 YDKTAVNVTGFTDSSGARAHNMTLSQQRADSVGSALIVQGVAANR-IRTSGAGPDNPVAS 199

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T  G+  N+R+EI + P
Sbjct: 200 NSTAAGKAQNRRVEITLSP 218


>gi|117620195|ref|YP_854667.1| putative outer membrane lipoprotein [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
 gi|117561602|gb|ABK38550.1| inner membrane lipoprotein YiaD [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
          Length = 218

 Score = 84.0 bits (206), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 46/139 (33%), Positives = 78/139 (56%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D  E + + +LQ TG+ V+R GD +   +P +V+F  S   L+      L  +A ++ +
Sbjct: 79  MDVQEAKLREKLQGTGVSVTRNGDQLILNMPNNVTFDSSSAQLKAAGANTLSGVAMVVGE 138

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           F  T + +  HTDS G+ + N+ +S +RAD + + LI +GV+ +R IS  G     P+ T
Sbjct: 139 FDKTRLNVVGHTDSTGSRELNMKLSAQRADAVAAQLIGQGVTGSR-ISTSGVGPDQPVAT 197

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T  G+  N+R+ I + P
Sbjct: 198 NSTAEGKAQNRRVTITLTP 216


>gi|145301089|ref|YP_001143930.1| outer membrane lipoprotein [Aeromonas salmonicida subsp.
           salmonicida A449]
 gi|142853861|gb|ABO92182.1| outer membrane lipoprotein [Aeromonas salmonicida subsp.
           salmonicida A449]
          Length = 218

 Score = 84.0 bits (206), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 46/139 (33%), Positives = 77/139 (55%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D  E + + +LQ TG+ V+R GD +   +P +V+F  S   L+      L  +A ++ +
Sbjct: 79  MDVQEAKLREKLQGTGVSVTRNGDELILNMPNNVTFDSSSAQLKAAGANTLSGVAMVVAE 138

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           F  T + +  HTDS G+   N+ +S +RAD + + LI  GV+ +R IS +G     P+ T
Sbjct: 139 FDKTRLNVVGHTDSTGSRDLNMKLSAQRADAVAAQLIGHGVTGSR-ISTQGVGPDQPVAT 197

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T  G+  N+R+ I + P
Sbjct: 198 NSTAAGKAQNRRVTITLIP 216


>gi|54307294|ref|YP_128314.1| putative OmpA family protein [Photobacterium profundum SS9]
 gi|46911714|emb|CAG18512.1| Putative OmpA family protein [Photobacterium profundum SS9]
          Length = 241

 Score = 84.0 bits (206), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 47/139 (33%), Positives = 79/139 (56%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D  E + + QL+ TGI V+R GD I   +P  ++F   +  L  + +  L+ +A +  +
Sbjct: 102 MDVQETKLRQQLESTGISVTRDGDNIVLNMPNEITFGFDQSDLSSRAVAALKNVALVAKE 161

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +  T+I +   TDS G+   N  +SQ RA  + S L++ GV++NR I+ +G     PI +
Sbjct: 162 YDKTLINVYGFTDSTGSASYNQRLSQVRASEVSSNLMRGGVAANRVIT-KGMGEANPIAS 220

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T+ GR  N+R+EI + P
Sbjct: 221 NKTEQGRAENRRVEIVLSP 239


>gi|254419256|ref|ZP_05032980.1| Rickettsia 17 kDa surface antigen family [Brevundimonas sp. BAL3]
 gi|196185433|gb|EDX80409.1| Rickettsia 17 kDa surface antigen family [Brevundimonas sp. BAL3]
          Length = 224

 Score = 84.0 bits (206), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 44/139 (31%), Positives = 80/139 (57%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVS-EVFLEKKFLPMLQLIATILNK 105
           +D+ +   + +L  +G+ V+R GD +   +P  V+F + +  ++ +FLP+L  +A +L +
Sbjct: 84  MDRQQRAMEAELSGSGVGVARQGDNLVLRMPSDVTFATNQSSIDPRFLPVLDDVARVLQE 143

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +  + I +  HTDS G    N  +S+ RA  + S L++RGV + R   V G + + P+ +
Sbjct: 144 YDRSTIDVIGHTDSTGGDAINQPLSERRAASVASELVRRGVIAERLY-VAGNSSRNPVAS 202

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T  G+  N+R+EI I P
Sbjct: 203 NATPEGKAQNRRVEILIRP 221


>gi|238783060|ref|ZP_04627087.1| Inner membrane lipoprotein yiaD [Yersinia bercovieri ATCC 43970]
 gi|238716061|gb|EEQ08046.1| Inner membrane lipoprotein yiaD [Yersinia bercovieri ATCC 43970]
          Length = 219

 Score = 84.0 bits (206), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 44/139 (31%), Positives = 78/139 (56%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVF-LEKKFLPMLQLIATILNK 105
           +D  E + + ++  TG+ V+R GD I   +P +V+F ++   L+      L  +A +L +
Sbjct: 81  MDVQEAKLREKMNGTGVSVTRQGDNIVLNMPNNVTFDTDSSNLKPAGANTLTGVAMVLKE 140

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +  T + +   TDS G   +N+ +SQ+RAD + S LI +GV++NR +   G     P+ +
Sbjct: 141 YDKTAVNVTGFTDSSGARAHNMTLSQQRADSVGSALIMQGVAANR-VRTSGAGPDNPVAS 199

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T  G+  N+R+EI + P
Sbjct: 200 NSTAAGKAQNRRVEITLSP 218


>gi|308048148|ref|YP_003911714.1| OmpA/MotB domain protein [Ferrimonas balearica DSM 9799]
 gi|307630338|gb|ADN74640.1| OmpA/MotB domain protein [Ferrimonas balearica DSM 9799]
          Length = 219

 Score = 84.0 bits (206), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 46/140 (32%), Positives = 79/140 (56%), Gaps = 2/140 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D+ E   + +L  TG+ V R GD I   +P  ++F V    L+   +  L  +A ++++
Sbjct: 80  MDRQEAALREKLAGTGVSVKRDGDHIQLVMPNSLTFDVGSDRLKMPAINALSGVAMVVSE 139

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           F  T + I  HTDS G    N+ +S+ERA+ + S L+++ +S+ R +S  G     PI +
Sbjct: 140 FDETNLQITGHTDSTGGRDLNMRLSRERAEAVASELLRQSISATR-MSTYGAGPDRPIAS 198

Query: 166 NDTKVGRQNNQRIEIQIFPR 185
           N ++ GR  N+R+EI + PR
Sbjct: 199 NQSEAGRAENRRVEIVLTPR 218


>gi|300950898|ref|ZP_07164778.1| OmpA family protein [Escherichia coli MS 116-1]
 gi|300449827|gb|EFK13447.1| OmpA family protein [Escherichia coli MS 116-1]
          Length = 217

 Score = 84.0 bits (206), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 46/137 (33%), Positives = 78/137 (56%), Gaps = 2/137 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D  E + + +++ TG+ V+R GD I   +P +V+F  S   L+      L  +A +L +
Sbjct: 81  MDVQEAKLRDKMRGTGVSVTRSGDNIILNMPNNVTFDSSSATLKPAGANTLTGVAMVLKE 140

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +P T + +  +TDS G    N+ +SQ+RAD + S LI +GV ++R I  +G     PI +
Sbjct: 141 YPKTAVNVIGYTDSTGGHDLNMRLSQQRADSVASALITQGVDASR-IRTQGLGPANPIAS 199

Query: 166 NDTKVGRQNNQRIEIQI 182
           N T  G+  N+R+EI +
Sbjct: 200 NSTAEGKAQNRRVEITL 216


>gi|313144174|ref|ZP_07806367.1| OmpA family protein [Helicobacter cinaedi CCUG 18818]
 gi|313129205|gb|EFR46822.1| OmpA family protein [Helicobacter cinaedi CCUG 18818]
          Length = 156

 Score = 84.0 bits (206), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 48/140 (34%), Positives = 78/140 (55%), Gaps = 4/140 (2%)

Query: 44  GSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVF-LEKKFLPMLQLIATI 102
           G  +D  + + + +LQ TG+ VSR GD I   +P  ++F S    L   F  +L     +
Sbjct: 7   GGYMDYQDKQLRKELQGTGVSVSREGDGIILNMPGDITFKSGSDDLSSDFYKVLN--KKV 64

Query: 103 LNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYP 162
           LNK+  T++ +   TD+ G+ K NL +S++RA+ + +YL  + V + RF+ V G     P
Sbjct: 65  LNKYDKTIVTVVGFTDNTGSDKTNLALSKKRAESVAAYLQNQKVKTERFV-VDGLGESEP 123

Query: 163 IDTNDTKVGRQNNQRIEIQI 182
           I +N T  GR  N+R+EI +
Sbjct: 124 IASNKTAEGRAKNRRVEISL 143


>gi|326334458|ref|ZP_08200670.1| OmpA family protein [Capnocytophaga sp. oral taxon 338 str. F0234]
 gi|325693425|gb|EGD35352.1| OmpA family protein [Capnocytophaga sp. oral taxon 338 str. F0234]
          Length = 455

 Score = 83.6 bits (205), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 41/88 (46%), Positives = 58/88 (65%), Gaps = 1/88 (1%)

Query: 95  MLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISV 154
           +L  I ++LNKFP++   I+ HTDS G    N ++SQ RAD +K YLIQ G+ +NR  SV
Sbjct: 367 VLNQIISVLNKFPNSRFRIEGHTDSTGKKAKNQVLSQNRADAVKVYLIQGGIDANRLESV 426

Query: 155 RGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
            G+    PI +N TK GR+ N+R+EI +
Sbjct: 427 -GYGQDKPIASNKTKKGRELNRRVEINL 453


>gi|226951234|ref|ZP_03821698.1| OmpA/MotB domain-containing protein [Acinetobacter sp. ATCC 27244]
 gi|226838028|gb|EEH70411.1| OmpA/MotB domain-containing protein [Acinetobacter sp. ATCC 27244]
          Length = 213

 Score = 83.6 bits (205), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 45/141 (31%), Positives = 78/141 (55%), Gaps = 3/141 (2%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGD-MITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILN 104
           LD  E + + Q+Q TG+ V R  D  +   +P  ++F  ++  ++  F   L  +A +L 
Sbjct: 73  LDNKEKKLRQQMQGTGVDVGRNPDGSVQLIMPGSITFDTNKSNIKPNFYATLNKVAQVLG 132

Query: 105 KFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPID 164
           +   + I +  +TD+ G    N+ +SQ RA  +K+YL  +G++SNR I  +G+    PI 
Sbjct: 133 EDNQSAILVTGYTDNTGNDSINIPLSQARAQSVKNYLAGKGIASNR-IDAQGYGSSNPIA 191

Query: 165 TNDTKVGRQNNQRIEIQIFPR 185
            N T  GR+ N+R+EI I+ +
Sbjct: 192 DNSTAAGREQNRRVEISIYAK 212


>gi|332519379|ref|ZP_08395846.1| OmpA/MotB domain protein [Lacinutrix algicola 5H-3-7-4]
 gi|332045227|gb|EGI81420.1| OmpA/MotB domain protein [Lacinutrix algicola 5H-3-7-4]
          Length = 476

 Score = 83.6 bits (205), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 36/88 (40%), Positives = 61/88 (69%), Gaps = 1/88 (1%)

Query: 95  MLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISV 154
           +L+ I  IL ++P +   I+ HTDS+G+  +N  +S+ RA+ ++ YLI  G+S++R +S 
Sbjct: 388 VLKNITAILKEYPDSNFTIEGHTDSVGSKSSNQKLSERRANAVRDYLIANGISASR-LSA 446

Query: 155 RGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
            GF   YP+D+N T+ GR+NN+R EI++
Sbjct: 447 YGFGEDYPVDSNATRNGRKNNRRTEIKL 474


>gi|237654130|ref|YP_002890444.1| OmpA/MotB domain protein [Thauera sp. MZ1T]
 gi|237625377|gb|ACR02067.1| OmpA/MotB domain protein [Thauera sp. MZ1T]
          Length = 222

 Score = 83.6 bits (205), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 50/140 (35%), Positives = 74/140 (52%), Gaps = 3/140 (2%)

Query: 43  FGSSLDKAEDEFQMQLQDTGIVVSRIGD-MITCYIPVHVSF-VSEVFLEKKFLPMLQLIA 100
           +  ++ K   E +     TGI +S+  D  +   IP  VSF V    ++    P+L  +A
Sbjct: 76  WSQNMQKQRAEMEQATAGTGIGISQTTDNQLKVDIPADVSFDVGRHAIKPNMRPVLDRLA 135

Query: 101 TILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYK 160
           + LN+ P T + I  HTDS G+   N  +S  RA   + YL+QRGVS+ R I+V G   +
Sbjct: 136 STLNQHPVTTVTIIGHTDSTGSDAVNDPLSINRAAATRDYLVQRGVSAQR-IAVDGRGSR 194

Query: 161 YPIDTNDTKVGRQNNQRIEI 180
            P+  N T  GR  N+R+EI
Sbjct: 195 QPVADNSTASGRAMNRRVEI 214


>gi|269963902|ref|ZP_06178214.1| putative lipoprotein [Vibrio harveyi 1DA3]
 gi|269831389|gb|EEZ85536.1| putative lipoprotein [Vibrio harveyi 1DA3]
          Length = 219

 Score = 83.6 bits (205), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 46/140 (32%), Positives = 79/140 (56%), Gaps = 3/140 (2%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGD-MITCYIPVHVSFVSEVF-LEKKFLPMLQLIATILN 104
            D+ E E +  L ++G+ V R+G+  +   +   + F S  + L+      L+ +A IL 
Sbjct: 79  FDQQEAELRRALLNSGVQVERVGENQLLLRMENGIGFSSSSYQLDASIHNTLRGVARILV 138

Query: 105 KFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPID 164
           ++P T + I  +TDS G+   N  +S+ RA+ ++ YL+ + V+  R I+ RG+  + PI 
Sbjct: 139 EYPDTSLVIDGYTDSTGSDSYNQTLSERRAESVRQYLVSQNVAPGRAIA-RGYGERNPIC 197

Query: 165 TNDTKVGRQNNQRIEIQIFP 184
           +N T  GR  N+R+EIQI P
Sbjct: 198 SNQTSEGRACNRRVEIQILP 217


>gi|294649621|ref|ZP_06727038.1| OmpA family protein [Acinetobacter haemolyticus ATCC 19194]
 gi|292824498|gb|EFF83284.1| OmpA family protein [Acinetobacter haemolyticus ATCC 19194]
          Length = 217

 Score = 83.6 bits (205), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 45/141 (31%), Positives = 78/141 (55%), Gaps = 3/141 (2%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGD-MITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILN 104
           LD  E + + Q+Q TG+ V R  D  +   +P  ++F  ++  ++  F   L  +A +L 
Sbjct: 77  LDNKEKKLRQQMQGTGVDVGRNPDGSVQLIMPGSITFDTNKSNIKPNFYATLNKVAQVLG 136

Query: 105 KFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPID 164
           +   + I +  +TD+ G    N+ +SQ RA  +K+YL  +G++SNR I  +G+    PI 
Sbjct: 137 EDNQSAILVTGYTDNTGNDSINIPLSQARAQSVKNYLAGKGIASNR-IDAQGYGSSNPIA 195

Query: 165 TNDTKVGRQNNQRIEIQIFPR 185
            N T  GR+ N+R+EI I+ +
Sbjct: 196 DNSTAAGREQNRRVEISIYAK 216


>gi|300955043|ref|ZP_07167452.1| OmpA family protein [Escherichia coli MS 175-1]
 gi|300318040|gb|EFJ67824.1| OmpA family protein [Escherichia coli MS 175-1]
          Length = 215

 Score = 83.6 bits (205), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 46/135 (34%), Positives = 77/135 (57%), Gaps = 2/135 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D  E + + +++ TG+ V+R GD I   +P +V+F  S   L+      L  +A +L +
Sbjct: 81  MDVQEAKLRDKMRGTGVSVTRSGDNIILNMPNNVTFDSSSATLKPAGANTLTGVAMVLKE 140

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +P T + +  +TDS G    N+ +SQ+RAD + S LI +GV ++R I  +G     PI +
Sbjct: 141 YPKTAVNVIGYTDSTGGHDLNMRLSQQRADSVASALITQGVDASR-IRTQGLGPANPIAS 199

Query: 166 NDTKVGRQNNQRIEI 180
           N T  G+  N+R+EI
Sbjct: 200 NSTAEGKAQNRRVEI 214


>gi|22127962|ref|NP_671385.1| putative outer membrane lipoprotein [Yersinia pestis KIM 10]
 gi|45443710|ref|NP_995249.1| putative outer membrane lipoprotein [Yersinia pestis biovar
           Microtus str. 91001]
 gi|51598197|ref|YP_072388.1| outer membrane lipoprotein [Yersinia pseudotuberculosis IP 32953]
 gi|108808999|ref|YP_652915.1| putative outer membrane lipoprotein [Yersinia pestis Antiqua]
 gi|108813881|ref|YP_649648.1| putative outer membrane lipoprotein [Yersinia pestis Nepal516]
 gi|145597343|ref|YP_001161418.1| putative outer membrane lipoprotein [Yersinia pestis Pestoides F]
 gi|150260986|ref|ZP_01917714.1| putative lipoprotein [Yersinia pestis CA88-4125]
 gi|162420588|ref|YP_001608097.1| putative outer membrane lipoprotein [Yersinia pestis Angola]
 gi|165926066|ref|ZP_02221898.1| OmpA family protein [Yersinia pestis biovar Orientalis str.
           F1991016]
 gi|165936922|ref|ZP_02225488.1| OmpA family protein [Yersinia pestis biovar Orientalis str. IP275]
 gi|166009516|ref|ZP_02230414.1| OmpA family protein [Yersinia pestis biovar Antiqua str. E1979001]
 gi|166213252|ref|ZP_02239287.1| OmpA family protein [Yersinia pestis biovar Antiqua str. B42003004]
 gi|167398489|ref|ZP_02304013.1| OmpA family protein [Yersinia pestis biovar Antiqua str. UG05-0454]
 gi|167421106|ref|ZP_02312859.1| OmpA family protein [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167425514|ref|ZP_02317267.1| OmpA family protein [Yersinia pestis biovar Mediaevalis str.
           K1973002]
 gi|167467912|ref|ZP_02332616.1| OmpA family protein [Yersinia pestis FV-1]
 gi|170022281|ref|YP_001718786.1| putative outer membrane lipoprotein [Yersinia pseudotuberculosis
           YPIII]
 gi|186897420|ref|YP_001874532.1| putative outer membrane lipoprotein [Yersinia pseudotuberculosis
           PB1/+]
 gi|218931056|ref|YP_002348931.1| putative outer membrane lipoprotein [Yersinia pestis CO92]
 gi|229839783|ref|ZP_04459942.1| putative lipoprotein [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|229841867|ref|ZP_04462023.1| putative lipoprotein [Yersinia pestis biovar Orientalis str. India
           195]
 gi|229896745|ref|ZP_04511909.1| putative lipoprotein [Yersinia pestis Pestoides A]
 gi|229904405|ref|ZP_04519516.1| putative lipoprotein [Yersinia pestis Nepal516]
 gi|270488345|ref|ZP_06205419.1| OmpA family protein [Yersinia pestis KIM D27]
 gi|294505605|ref|YP_003569667.1| putative lipoprotein [Yersinia pestis Z176003]
 gi|21961106|gb|AAM87636.1|AE014011_3 putative outer membrane protein [Yersinia pestis KIM 10]
 gi|45438580|gb|AAS64126.1| putative lipoprotein [Yersinia pestis biovar Microtus str. 91001]
 gi|51591479|emb|CAH23150.1| OmpA-OmpF family porin [Yersinia pseudotuberculosis IP 32953]
 gi|108777529|gb|ABG20048.1| lipoprotein [Yersinia pestis Nepal516]
 gi|108780912|gb|ABG14970.1| putative lipoprotein [Yersinia pestis Antiqua]
 gi|115349667|emb|CAL22647.1| putative lipoprotein [Yersinia pestis CO92]
 gi|145209039|gb|ABP38446.1| lipoprotein [Yersinia pestis Pestoides F]
 gi|149290394|gb|EDM40471.1| putative lipoprotein [Yersinia pestis CA88-4125]
 gi|162353403|gb|ABX87351.1| OmpA family protein [Yersinia pestis Angola]
 gi|165915164|gb|EDR33775.1| OmpA family protein [Yersinia pestis biovar Orientalis str. IP275]
 gi|165921926|gb|EDR39103.1| OmpA family protein [Yersinia pestis biovar Orientalis str.
           F1991016]
 gi|165991438|gb|EDR43739.1| OmpA family protein [Yersinia pestis biovar Antiqua str. E1979001]
 gi|166205550|gb|EDR50030.1| OmpA family protein [Yersinia pestis biovar Antiqua str. B42003004]
 gi|166961235|gb|EDR57256.1| OmpA family protein [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167050993|gb|EDR62401.1| OmpA family protein [Yersinia pestis biovar Antiqua str. UG05-0454]
 gi|167055528|gb|EDR65321.1| OmpA family protein [Yersinia pestis biovar Mediaevalis str.
           K1973002]
 gi|169748815|gb|ACA66333.1| OmpA/MotB domain protein [Yersinia pseudotuberculosis YPIII]
 gi|186700446|gb|ACC91075.1| OmpA/MotB domain protein [Yersinia pseudotuberculosis PB1/+]
 gi|229678523|gb|EEO74628.1| putative lipoprotein [Yersinia pestis Nepal516]
 gi|229691206|gb|EEO83259.1| putative lipoprotein [Yersinia pestis biovar Orientalis str. India
           195]
 gi|229696149|gb|EEO86196.1| putative lipoprotein [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|229700284|gb|EEO88319.1| putative lipoprotein [Yersinia pestis Pestoides A]
 gi|262363769|gb|ACY60490.1| putative lipoprotein [Yersinia pestis D106004]
 gi|262367705|gb|ACY64262.1| putative lipoprotein [Yersinia pestis D182038]
 gi|270336849|gb|EFA47626.1| OmpA family protein [Yersinia pestis KIM D27]
 gi|294356064|gb|ADE66405.1| putative lipoprotein [Yersinia pestis Z176003]
 gi|320017406|gb|ADW00978.1| putative lipoprotein [Yersinia pestis biovar Medievalis str. Harbin
           35]
          Length = 219

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 44/139 (31%), Positives = 79/139 (56%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D  E + + ++  TG+ V+R G+ I   +P +V+F  +   L+      L  +A +L +
Sbjct: 81  MDVQEAKLREKMSGTGVSVTRQGENIVLNMPNNVTFDTNSSNLKPAGANTLTGVAMVLKE 140

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +  T + +  +TDS G   +N+++SQ+RAD + S LI +GV++NR I   G     P+ +
Sbjct: 141 YDKTAVNVTGYTDSTGARAHNIVLSQQRADNVASALIVQGVAANR-IRTYGAGPDNPVAS 199

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T  G+  N+R+EI + P
Sbjct: 200 NSTAAGKAQNRRVEITLSP 218


>gi|153949077|ref|YP_001403078.1| outer membrane lipoprotein [Yersinia pseudotuberculosis IP 31758]
 gi|152960572|gb|ABS48033.1| OmpA family protein [Yersinia pseudotuberculosis IP 31758]
          Length = 219

 Score = 83.2 bits (204), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 44/139 (31%), Positives = 79/139 (56%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D  E + + ++  TG+ V+R G+ I   +P +V+F  +   L+      L  +A +L +
Sbjct: 81  MDVQEAKLREKMSGTGVSVTRQGENIVLNMPNNVTFDTNSSNLKPAGANTLTGVAMVLKE 140

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +  T + +  +TDS G   +N+++SQ+RAD + S LI +GV++NR I   G     P+ +
Sbjct: 141 YDKTAVNVTGYTDSTGARAHNIVLSQQRADNVASALIVQGVAANR-IRTYGAGPDNPVAS 199

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T  G+  N+R+EI + P
Sbjct: 200 NSTAAGKAQNRRVEITLSP 218


>gi|294638308|ref|ZP_06716561.1| OmpA family protein [Edwardsiella tarda ATCC 23685]
 gi|291088561|gb|EFE21122.1| OmpA family protein [Edwardsiella tarda ATCC 23685]
          Length = 219

 Score = 83.2 bits (204), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 45/139 (32%), Positives = 79/139 (56%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVF-LEKKFLPMLQLIATILNK 105
           +D  E + + +++ TG+ V+R GD I   +P +V+F S    L+      L  +A +L +
Sbjct: 81  MDVQEAKLRDKMRGTGVSVTRQGDNIVLNMPNNVTFDSNSSNLKPAGANTLTGVAMVLKE 140

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +  T + +  +TDS G+   N+ +SQ+RAD + S LI +GV++ R  ++ G     PI +
Sbjct: 141 YQKTAVNVVGYTDSTGSRDLNMRLSQQRADSVASALITQGVAAGRIRTI-GMGPANPIAS 199

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T  G+  N+R+EI + P
Sbjct: 200 NSTAAGKAQNRRVEITLSP 218


>gi|224823894|ref|ZP_03697003.1| OmpA/MotB domain protein [Lutiella nitroferrum 2002]
 gi|224604349|gb|EEG10523.1| OmpA/MotB domain protein [Lutiella nitroferrum 2002]
          Length = 221

 Score = 83.2 bits (204), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 50/129 (38%), Positives = 70/129 (54%), Gaps = 3/129 (2%)

Query: 54  FQMQLQDTGIVVSRIGD-MITCYIPVHVSFVSEVF-LEKKFLPMLQLIATILNKFPSTVI 111
            +   + TG+ VS+  D  +   IP  VSF S  + ++    P+L   AT LN+ P T +
Sbjct: 87  MEQATKGTGVSVSQTADNQLKLDIPSDVSFDSGRYDIKSNMRPILDRFATTLNQNPVTTV 146

Query: 112 AIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVG 171
            I  HTDS G+   N  +S  RA   +SYL+ RGV+ NR IS+ G     PI +N T  G
Sbjct: 147 KIIGHTDSTGSDAINGPLSVNRASATRSYLVARGVAMNR-ISIDGRGSSEPIASNGTAAG 205

Query: 172 RQNNQRIEI 180
           R  N+R+EI
Sbjct: 206 RAKNRRVEI 214


>gi|108524622|ref|YP_619844.1| hypothetical protein pQKH54_47 [Plasmid QKH54]
 gi|99644193|emb|CAJ43326.1| hypothetical protein [Plasmid QKH54]
          Length = 220

 Score = 83.2 bits (204), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 43/140 (30%), Positives = 75/140 (53%), Gaps = 2/140 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVS-EVFLEKKFLPMLQLIATILNK 105
           +DK E E +  ++ +G+ V R GD +   +P  ++F + +  ++  F   L  +A    +
Sbjct: 75  VDKQEAELRESMKGSGVEVEREGDQLKLVMPGSITFATGKSEIQPSFQYTLNQLAASFRQ 134

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           F  + + +  HTDS+G+ + N ++S  RAD +  +L   GV  +R  +  G     PI  
Sbjct: 135 FQDSDLIVTGHTDSVGSYEANQVLSARRADSVSQFLRSNGVDPSRLQTF-GAGSSSPIAP 193

Query: 166 NDTKVGRQNNQRIEIQIFPR 185
           NDT  GR  N+R+EI++ PR
Sbjct: 194 NDTTEGRAQNRRVEIKLVPR 213


>gi|121596298|ref|YP_988194.1| OmpA/MotB domain-containing protein [Acidovorax sp. JS42]
 gi|222112527|ref|YP_002554791.1| ompa/motb domain-containing protein [Acidovorax ebreus TPSY]
 gi|120608378|gb|ABM44118.1| OmpA/MotB domain protein [Acidovorax sp. JS42]
 gi|221731971|gb|ACM34791.1| OmpA/MotB domain protein [Acidovorax ebreus TPSY]
          Length = 216

 Score = 83.2 bits (204), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 48/145 (33%), Positives = 78/145 (53%), Gaps = 3/145 (2%)

Query: 43  FGSSLDKAEDEFQMQLQDTGIVVSRIGD-MITCYIPVHVSFVSEVF-LEKKFLPMLQLIA 100
           +   +++ + + Q   Q TG+ V++  D  +   IP  +SF +    ++  F P+L   A
Sbjct: 69  WSQHMERQKQDMQAATQGTGVTVTQTPDNQLKLDIPSDISFATNRSDIQPNFRPILDRFA 128

Query: 101 TILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYK 160
             L   P+T + I  HTDS G+   N  +S +RA+  ++YL  RGV+ NR I V G   +
Sbjct: 129 EGLRNNPNTEVRIVGHTDSTGSDAINNPLSLDRAESTRNYLTARGVNGNR-IHVEGRGSR 187

Query: 161 YPIDTNDTKVGRQNNQRIEIQIFPR 185
            P+ +NDT  GR  N+R+EI +  R
Sbjct: 188 EPVASNDTSDGRARNRRVEIYVGER 212


>gi|241759693|ref|ZP_04757793.1| inner membrane lipoprotein YiaD [Neisseria flavescens SK114]
 gi|241319701|gb|EER56097.1| inner membrane lipoprotein YiaD [Neisseria flavescens SK114]
          Length = 226

 Score = 83.2 bits (204), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 50/147 (34%), Positives = 76/147 (51%), Gaps = 2/147 (1%)

Query: 39  VNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVS-EVFLEKKFLPMLQ 97
           V    G  +D  E + +  L +T I V R G+ I   +P +V+F +    L  +    L 
Sbjct: 69  VGAGIGGYMDYQEKKLRQSLANTNIEVERQGNQIKLVMPENVTFATGSAALSGQAQSALS 128

Query: 98  LIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGF 157
           + A  L ++P T + I  HTD+ G    N  +S+ RA+ +  +L  RGVSS R +S  G+
Sbjct: 129 VAAQTLVQYPDTTLTINGHTDNTGNDAINEPLSRNRAESVAIFLQSRGVSSTR-LSTFGY 187

Query: 158 AYKYPIDTNDTKVGRQNNQRIEIQIFP 184
             + PI +N T  GR  N+R+EI I P
Sbjct: 188 GSRQPIASNATVEGRAQNRRVEILINP 214


>gi|157963436|ref|YP_001503470.1| OmpA/MotB domain-containing protein [Shewanella pealeana ATCC
           700345]
 gi|157848436|gb|ABV88935.1| OmpA/MotB domain protein [Shewanella pealeana ATCC 700345]
          Length = 224

 Score = 83.2 bits (204), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 49/142 (34%), Positives = 77/142 (54%), Gaps = 2/142 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D  E E + QLQ +G+ V+R GD I   +P  V+F V +  L ++   +L  +  +  +
Sbjct: 83  MDVQEAELRKQLQSSGVSVTRSGDNIILNMPNDVTFGVDQTDLSQRAKQVLNSVVLVALE 142

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +  T + +  HTDS G    NL +SQ RA  + +YL ++ V + R  S  G     PI +
Sbjct: 143 YDETKLNVMGHTDSSGAESYNLRLSQVRASEVANYLTRQKVPAQRVAS-HGMGESKPIAS 201

Query: 166 NDTKVGRQNNQRIEIQIFPRGN 187
           N+TK GR  N+R+EI + P  N
Sbjct: 202 NETKQGRAENRRVEIILSPMPN 223


>gi|71066360|ref|YP_265087.1| OmpA/OmpF family outer membrane protein [Psychrobacter arcticus
           273-4]
 gi|71039345|gb|AAZ19653.1| outer membrane protein, OmpA/OmpF family [Psychrobacter arcticus
           273-4]
          Length = 217

 Score = 82.8 bits (203), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 44/141 (31%), Positives = 77/141 (54%), Gaps = 3/141 (2%)

Query: 44  GSSLDKAEDEFQMQLQDTGIVVS-RIGDMITCYIPVHVSFV-SEVFLEKKFLPMLQLIAT 101
           G  +++   + + Q+  TG+ V+      I   +P  ++F   +  L   F P L  +A 
Sbjct: 71  GYYMERQAKQLEQQMAGTGVTVTPNANGNIDLVMPGSITFSFDDATLNNSFKPTLDKLAA 130

Query: 102 ILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKY 161
            +N++    I I  HTDS GT   N+ +S++RA  + +YL  RGV+SNR I+V  +    
Sbjct: 131 TMNEYNQNTITIAGHTDSKGTDAYNMKLSRDRAYAVANYLSARGVASNR-INVVAYGESR 189

Query: 162 PIDTNDTKVGRQNNQRIEIQI 182
           P+  N+++ GRQ N+R+E+ +
Sbjct: 190 PVADNNSEYGRQQNRRVELTV 210


>gi|126662605|ref|ZP_01733604.1| possible outer membrane protein [Flavobacteria bacterium BAL38]
 gi|126625984|gb|EAZ96673.1| possible outer membrane protein [Flavobacteria bacterium BAL38]
          Length = 467

 Score = 82.8 bits (203), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 33/95 (34%), Positives = 64/95 (67%), Gaps = 1/95 (1%)

Query: 88  LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVS 147
            +K+ +P+LQ +  IL ++P+   +++ HTDS G    N  +S+ERA  +K++L++ G+ 
Sbjct: 372 FQKQTIPVLQAMTAILKEYPTAKFSLEGHTDSTGADALNQKLSEERAAAVKNFLVENGID 431

Query: 148 SNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           ++R +S +GF    P+D+N T  G+ NN+R+E+++
Sbjct: 432 ASR-LSSKGFGESMPVDSNKTAKGKANNRRVEVKL 465


>gi|117919117|ref|YP_868309.1| OmpA/MotB domain-containing protein [Shewanella sp. ANA-3]
 gi|117611449|gb|ABK46903.1| OmpA/MotB domain protein [Shewanella sp. ANA-3]
          Length = 230

 Score = 82.8 bits (203), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 48/141 (34%), Positives = 76/141 (53%), Gaps = 2/141 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D  E + + QL  TG+ V+R GD I   +P  V+F V +  L      +L  +A +  +
Sbjct: 90  MDVQETKLRQQLASTGVSVTRDGDNIVLNMPNEVTFGVDQTELSDGAKRVLNSVALVAKE 149

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +  T + +  +TDS G+   NL +SQ RA  + +YL+ +GV+S R  S +G     PI +
Sbjct: 150 YSKTQLNVLGYTDSSGSDSYNLRLSQVRASEVGNYLMSKGVASARVKS-KGMGEASPIAS 208

Query: 166 NDTKVGRQNNQRIEIQIFPRG 186
           N    GR  N+R+EI + P G
Sbjct: 209 NANAAGRAQNRRVEIVLTPTG 229


>gi|254494341|ref|ZP_05107512.1| conserved hypothetical protein [Neisseria gonorrhoeae 1291]
 gi|226513381|gb|EEH62726.1| conserved hypothetical protein [Neisseria gonorrhoeae 1291]
          Length = 216

 Score = 82.8 bits (203), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 53/180 (29%), Positives = 85/180 (47%), Gaps = 4/180 (2%)

Query: 8   SMFIMTTISGCGL--ASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVV 65
           +M+ +   + CG+  A     K   + +     +    G  +D  E   +  L DT I +
Sbjct: 27  AMYGLGGAAVCGIVGALTHSGKGARNSALACGAIGAGVGGYMDYQEQRLRQNLADTQIEI 86

Query: 66  SRIGDMITCYIPVHVSFVS-EVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLK 124
            R G+ I   +P  V+F +    L       L   A  L ++P T + I  HTD+ G+  
Sbjct: 87  QRQGNQIRLVMPESVTFATGSAALGGSAQYALNTAAQTLVQYPDTTLTINGHTDNTGSDA 146

Query: 125 NNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
            N  +SQ RA  +  YL  RGV+++R ++V G+    P+ +N T  GR  N+R+EI I P
Sbjct: 147 VNNPLSQHRAQAVAYYLQTRGVAASR-LTVYGYGSHMPVASNATVEGRAQNRRVEILINP 205


>gi|110639902|ref|YP_680112.1| outer membrane protein [Cytophaga hutchinsonii ATCC 33406]
 gi|110282583|gb|ABG60769.1| possible outer membrane protein [Cytophaga hutchinsonii ATCC 33406]
          Length = 505

 Score = 82.4 bits (202), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 34/90 (37%), Positives = 62/90 (68%), Gaps = 1/90 (1%)

Query: 93  LPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFI 152
           LP L  + T++N++P  +I +  HTD++G+ K N+ +S+ R +  K YL+ +G+S++R  
Sbjct: 414 LPALDQLVTVMNQYPGMIIELSGHTDNVGSAKKNMELSKNRVESAKKYLVSKGISADRIK 473

Query: 153 SVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           SV G+  KYP+ +ND +  R+ N+R+E++I
Sbjct: 474 SV-GYGSKYPVASNDGEQTRKYNRRVELRI 502


>gi|224437727|ref|ZP_03658674.1| OmpA family protein [Helicobacter cinaedi CCUG 18818]
          Length = 147

 Score = 82.4 bits (202), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 77/137 (56%), Gaps = 4/137 (2%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVS-EVFLEKKFLPMLQLIATILNK 105
           +D  + + + +LQ TG+ VSR GD I   +P  ++F S    L   F  +L     +LNK
Sbjct: 1   MDYQDKQLRKELQGTGVSVSREGDGIILNMPGDITFKSGSDDLSSDFYKVLN--KKVLNK 58

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +  T++ +   TD+ G+ K NL +S++RA+ + +YL  + V + RF+ V G     PI +
Sbjct: 59  YDKTIVTVVGFTDNTGSDKTNLALSKKRAESVAAYLQNQKVKTERFV-VDGLGESEPIAS 117

Query: 166 NDTKVGRQNNQRIEIQI 182
           N T  GR  N+R+EI +
Sbjct: 118 NKTAEGRAKNRRVEISL 134


>gi|255067217|ref|ZP_05319072.1| OmpA family protein [Neisseria sicca ATCC 29256]
 gi|255048585|gb|EET44049.1| OmpA family protein [Neisseria sicca ATCC 29256]
          Length = 261

 Score = 82.4 bits (202), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 46/142 (32%), Positives = 74/142 (52%), Gaps = 2/142 (1%)

Query: 44  GSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVS-EVFLEKKFLPMLQLIATI 102
           G  +D  E + +  L++T I V R G+ I   +P +V+F +    L  +    L   +  
Sbjct: 109 GGYMDYQEKKLRENLKNTNIEVERQGNQIKLVMPENVTFATGSAALSDQARNALATASET 168

Query: 103 LNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYP 162
           L ++P T + I  HTD+ G    N  +S+ RA  +  YL  RGV+ +R  +  G+  ++P
Sbjct: 169 LVQYPDTTLTINGHTDNTGNDAINEPLSRNRALAVADYLQSRGVNGSRLTTA-GYGSRHP 227

Query: 163 IDTNDTKVGRQNNQRIEIQIFP 184
           I +N T  GR  N+R+EI I P
Sbjct: 228 IASNATAEGRAQNRRVEILINP 249


>gi|113969010|ref|YP_732803.1| OmpA/MotB domain-containing protein [Shewanella sp. MR-4]
 gi|113883694|gb|ABI37746.1| OmpA/MotB domain protein [Shewanella sp. MR-4]
          Length = 230

 Score = 82.4 bits (202), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 48/141 (34%), Positives = 76/141 (53%), Gaps = 2/141 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D  E + + QL  TG+ V+R GD I   +P  V+F V +  L      +L  +A +  +
Sbjct: 90  MDVQETKLRQQLASTGVSVTRDGDNIILNMPNEVTFGVDQTELSDGAKRVLNSVALVAKE 149

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +  T + +  +TDS G+   NL +SQ RA  + +YL+ +GV+S R  S +G     PI +
Sbjct: 150 YSKTQLNVLGYTDSSGSDSYNLRLSQVRASEVGNYLMSKGVASARVKS-KGMGEASPIAS 208

Query: 166 NDTKVGRQNNQRIEIQIFPRG 186
           N    GR  N+R+EI + P G
Sbjct: 209 NANAAGRAQNRRVEIVLTPTG 229


>gi|88798562|ref|ZP_01114146.1| Outer membrane protein and related peptidoglycan-associated
           (lipo)protein [Reinekea sp. MED297]
 gi|88778662|gb|EAR09853.1| Outer membrane protein and related peptidoglycan-associated
           (lipo)protein [Reinekea sp. MED297]
          Length = 224

 Score = 82.4 bits (202), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 44/138 (31%), Positives = 81/138 (58%), Gaps = 3/138 (2%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGD-MITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILN 104
           +D+ E E + +L  TG+ V R  +  I   +P +++F V+   +   F+P L+ +A +L 
Sbjct: 82  MDQQEKELRDELVGTGVQVKRTEEGQIDLIMPGNITFDVNSSTVADGFIPTLRSVAKVLK 141

Query: 105 KFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPID 164
           ++ +T++ I  HTDS G+   N L+S++RA  + + ++Q G+   R ++  G+    PI 
Sbjct: 142 EYENTLVTISGHTDSSGSEDYNQLLSEQRATSVANIILQEGIVVER-VAAAGYGELQPIA 200

Query: 165 TNDTKVGRQNNQRIEIQI 182
           +NDT  GR  N+R+EI +
Sbjct: 201 SNDTPEGRAENRRVEITL 218


>gi|91215422|ref|ZP_01252393.1| outer membrane protein, OmpA/MotB family [Psychroflexus torquis
           ATCC 700755]
 gi|91186374|gb|EAS72746.1| outer membrane protein, OmpA/MotB family [Psychroflexus torquis
           ATCC 700755]
          Length = 457

 Score = 82.4 bits (202), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 58/88 (65%), Gaps = 1/88 (1%)

Query: 95  MLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISV 154
            L  I  IL+++P+    ++ HTDS+G+ KNN  +S+ RA  +KSYL++ GV   R +S 
Sbjct: 369 ALTAIIAILDEYPNAKFTVEGHTDSVGSAKNNESLSEARALSVKSYLVKNGVDEFR-LSS 427

Query: 155 RGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
            GF  + P+++NDTK GR  N+R+EI +
Sbjct: 428 AGFGEQKPVESNDTKAGRAENRRVEINL 455


>gi|28868377|ref|NP_790996.1| ompA family protein [Pseudomonas syringae pv. tomato str. DC3000]
 gi|213967171|ref|ZP_03395320.1| ompA family protein [Pseudomonas syringae pv. tomato T1]
 gi|301381094|ref|ZP_07229512.1| ompA family protein [Pseudomonas syringae pv. tomato Max13]
 gi|302062421|ref|ZP_07253962.1| ompA family protein [Pseudomonas syringae pv. tomato K40]
 gi|302133214|ref|ZP_07259204.1| ompA family protein [Pseudomonas syringae pv. tomato NCPPB 1108]
 gi|28851615|gb|AAO54691.1| ompA family protein [Pseudomonas syringae pv. tomato str. DC3000]
 gi|213928013|gb|EEB61559.1| ompA family protein [Pseudomonas syringae pv. tomato T1]
 gi|330965011|gb|EGH65271.1| ompA family protein [Pseudomonas syringae pv. actinidiae str.
           M302091]
 gi|331018068|gb|EGH98124.1| ompA family protein [Pseudomonas syringae pv. lachrymans str.
           M302278PT]
          Length = 229

 Score = 82.0 bits (201), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 45/138 (32%), Positives = 75/138 (54%), Gaps = 2/138 (1%)

Query: 48  DKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEV-FLEKKFLPMLQLIATILNKF 106
           DK E   +  + +TG+ V R GD I   +P +++F ++   +   F   L  +A  L +F
Sbjct: 87  DKQEAALRASMANTGVEVQRQGDQIKLIMPGNITFATDSSAIASSFYSPLNNLANSLKQF 146

Query: 107 PSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTN 166
               I I  +TDS G+ ++N+ +SQ+RA  + +YL  +GV  +  +SVRG     PI +N
Sbjct: 147 NQNNIEIIGYTDSTGSRQHNMDLSQQRAQSVATYLTSQGVDQS-HLSVRGAGPDQPIASN 205

Query: 167 DTKVGRQNNQRIEIQIFP 184
               GR  N+R+E+ + P
Sbjct: 206 ADANGRAQNRRVEVNLKP 223


>gi|320325748|gb|EFW81809.1| ompA family protein [Pseudomonas syringae pv. glycinea str. B076]
 gi|320327336|gb|EFW83350.1| ompA family protein [Pseudomonas syringae pv. glycinea str. race 4]
 gi|330881603|gb|EGH15752.1| ompA family protein [Pseudomonas syringae pv. glycinea str. race 4]
          Length = 229

 Score = 82.0 bits (201), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 45/138 (32%), Positives = 76/138 (55%), Gaps = 2/138 (1%)

Query: 48  DKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEV-FLEKKFLPMLQLIATILNKF 106
           DK E   +  + +TG+ V R GD I   +P +++F ++   +   F   L  +A+ L +F
Sbjct: 87  DKQEAALRASMANTGVEVQRQGDQIKLIMPGNITFATDSSAIASSFYSPLNNLASSLKQF 146

Query: 107 PSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTN 166
               I I  +TDS G+ ++N+ +SQ+RA  + +YL  +GV  +  +SVRG     PI +N
Sbjct: 147 NQNNIEIVGYTDSTGSRQHNMDLSQQRAQSVATYLTSQGVDQS-HLSVRGAGPDQPIASN 205

Query: 167 DTKVGRQNNQRIEIQIFP 184
               GR  N+R+E+ + P
Sbjct: 206 ADVNGRAQNRRVEVNLKP 223


>gi|114048845|ref|YP_739395.1| OmpA/MotB domain-containing protein [Shewanella sp. MR-7]
 gi|113890287|gb|ABI44338.1| OmpA/MotB domain protein [Shewanella sp. MR-7]
          Length = 230

 Score = 81.6 bits (200), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 48/141 (34%), Positives = 76/141 (53%), Gaps = 2/141 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D  E + + QL  TG+ V+R GD I   +P  V+F V +  L      +L  +A +  +
Sbjct: 90  MDVQETKLREQLASTGVSVTRDGDNIILNMPNEVTFGVDQTELSDGAKRVLNSVALVAKE 149

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +  T + +  +TDS G+   NL +SQ RA  + +YL+ +GV+S R  S +G     PI +
Sbjct: 150 YSKTQLNVLGYTDSSGSDSYNLRLSQVRASEVGNYLMSKGVASARVKS-KGMGEASPIAS 208

Query: 166 NDTKVGRQNNQRIEIQIFPRG 186
           N    GR  N+R+EI + P G
Sbjct: 209 NANAAGRAQNRRVEIVLTPTG 229


>gi|330873229|gb|EGH07378.1| ompA family protein [Pseudomonas syringae pv. morsprunorum str.
           M302280PT]
          Length = 229

 Score = 81.6 bits (200), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 45/138 (32%), Positives = 75/138 (54%), Gaps = 2/138 (1%)

Query: 48  DKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEV-FLEKKFLPMLQLIATILNKF 106
           DK E   +  + +TG+ V R GD I   +P +++F ++   +   F   L  +A  L +F
Sbjct: 87  DKQEAALRASMANTGVEVQRQGDQIKLIMPGNITFATDSSAIASSFYSPLNNLANSLKQF 146

Query: 107 PSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTN 166
               I I  +TDS G+ ++N+ +SQ+RA  + +YL  +GV  +  +SVRG     PI +N
Sbjct: 147 NQNNIEIIGYTDSTGSRQHNMDLSQQRAQSVATYLTSQGVDQS-HLSVRGAGPDQPIASN 205

Query: 167 DTKVGRQNNQRIEIQIFP 184
               GR  N+R+E+ + P
Sbjct: 206 ADTNGRAQNRRVEVNLKP 223


>gi|114562313|ref|YP_749826.1| OmpA/MotB domain-containing protein [Shewanella frigidimarina NCIMB
           400]
 gi|114333606|gb|ABI70988.1| OmpA/MotB domain protein [Shewanella frigidimarina NCIMB 400]
          Length = 225

 Score = 81.6 bits (200), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 47/141 (33%), Positives = 76/141 (53%), Gaps = 2/141 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D  E E + QL+ TG+ V+R GD I   +P  V+F V +  L  +   +L  +  +  +
Sbjct: 85  MDVQEAELRKQLKSTGVSVTRNGDNIVLNMPNEVTFAVDQTVLSSRAKSVLNSVVLVAKE 144

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +  T + +  +TDS G+   NL +SQ RA  +  Y+  + VS +R +S  G     PI +
Sbjct: 145 YDDTRLNVIGYTDSSGSDSYNLRLSQVRASEVAQYMTSQKVSGSR-VSSTGMGESSPIAS 203

Query: 166 NDTKVGRQNNQRIEIQIFPRG 186
           N T+ GR  N+R+EI + P G
Sbjct: 204 NSTEQGRSQNRRVEIVLTPMG 224


>gi|126175870|ref|YP_001052019.1| OmpA/MotB domain-containing protein [Shewanella baltica OS155]
 gi|152999218|ref|YP_001364899.1| OmpA/MotB domain-containing protein [Shewanella baltica OS185]
 gi|160873831|ref|YP_001553147.1| OmpA/MotB domain-containing protein [Shewanella baltica OS195]
 gi|217971891|ref|YP_002356642.1| OmpA/MotB domain-containing protein [Shewanella baltica OS223]
 gi|304411219|ref|ZP_07392834.1| OmpA/MotB domain protein [Shewanella baltica OS183]
 gi|307306514|ref|ZP_07586257.1| OmpA/MotB domain protein [Shewanella baltica BA175]
 gi|125999075|gb|ABN63150.1| OmpA/MotB domain protein [Shewanella baltica OS155]
 gi|151363836|gb|ABS06836.1| OmpA/MotB domain protein [Shewanella baltica OS185]
 gi|160859353|gb|ABX47887.1| OmpA/MotB domain protein [Shewanella baltica OS195]
 gi|217497026|gb|ACK45219.1| OmpA/MotB domain protein [Shewanella baltica OS223]
 gi|304350412|gb|EFM14815.1| OmpA/MotB domain protein [Shewanella baltica OS183]
 gi|306910805|gb|EFN41233.1| OmpA/MotB domain protein [Shewanella baltica BA175]
 gi|315266058|gb|ADT92911.1| OmpA/MotB domain protein [Shewanella baltica OS678]
          Length = 230

 Score = 81.6 bits (200), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 48/141 (34%), Positives = 76/141 (53%), Gaps = 2/141 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D  E + + QL  TG+ V+R GD I   +P  V+F V +  L      +L  +A +  +
Sbjct: 90  MDVQETKLRQQLASTGVSVTRSGDNIILNMPNEVTFGVDQTELSDGAKRVLNSVAVVAKE 149

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +  T + +  +TDS G+   NL +SQ RA  + +YL+ +GV+S R  S +G     PI +
Sbjct: 150 YSKTQLNVLGYTDSSGSDSYNLRLSQVRAGEVGNYLMSKGVASARVKS-KGMGEASPIAS 208

Query: 166 NDTKVGRQNNQRIEIQIFPRG 186
           N    GR  N+R+EI + P G
Sbjct: 209 NANANGRAQNRRVEIVLTPTG 229


>gi|262394500|ref|YP_003286354.1| outer membrane protein [Vibrio sp. Ex25]
 gi|262338094|gb|ACY51889.1| outer membrane protein [Vibrio sp. Ex25]
          Length = 222

 Score = 81.6 bits (200), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 45/140 (32%), Positives = 79/140 (56%), Gaps = 3/140 (2%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGD-MITCYIPVHVSFVSEVF-LEKKFLPMLQLIATILN 104
            D+ E E +  L ++G+ V R+G+  +   +   + F S  + L+      L+ +A IL 
Sbjct: 82  FDQQEAELRRALLNSGVQVQRVGENQLLLRMENGIGFSSSSYQLDASIHNTLRGVARILV 141

Query: 105 KFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPID 164
           ++P T + I  +TDS G+   N  +S+ RA+ ++ +L+ + V+  R I+ RG+  + PI 
Sbjct: 142 EYPDTSLVIDGYTDSTGSESYNQTLSERRAESVRQFLVSQNVAPGRAIA-RGYGERNPIC 200

Query: 165 TNDTKVGRQNNQRIEIQIFP 184
           +N T  GR  N+R+EIQI P
Sbjct: 201 SNQTSEGRACNRRVEIQILP 220


>gi|91226490|ref|ZP_01261239.1| putative lipoprotein [Vibrio alginolyticus 12G01]
 gi|91189122|gb|EAS75403.1| putative lipoprotein [Vibrio alginolyticus 12G01]
          Length = 219

 Score = 81.6 bits (200), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 45/140 (32%), Positives = 79/140 (56%), Gaps = 3/140 (2%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGD-MITCYIPVHVSFVSEVF-LEKKFLPMLQLIATILN 104
            D+ E E +  L ++G+ V R+G+  +   +   + F S  + L+      L+ +A IL 
Sbjct: 79  FDQQEAELRRALLNSGVQVQRVGENQLLLRMENGIGFSSSSYQLDASIHNTLRGVARILV 138

Query: 105 KFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPID 164
           ++P T + I  +TDS G+   N  +S+ RA+ ++ +L+ + V+  R I+ RG+  + PI 
Sbjct: 139 EYPDTSLVIDGYTDSTGSESYNQTLSERRAESVRQFLVSQNVAPGRAIA-RGYGERNPIC 197

Query: 165 TNDTKVGRQNNQRIEIQIFP 184
           +N T  GR  N+R+EIQI P
Sbjct: 198 SNQTSEGRACNRRVEIQILP 217


>gi|241764375|ref|ZP_04762401.1| OmpA/MotB domain protein [Acidovorax delafieldii 2AN]
 gi|241366218|gb|EER60782.1| OmpA/MotB domain protein [Acidovorax delafieldii 2AN]
          Length = 215

 Score = 81.6 bits (200), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 50/145 (34%), Positives = 75/145 (51%), Gaps = 3/145 (2%)

Query: 43  FGSSLDKAEDEFQMQLQDTGIVVSRIGD-MITCYIPVHVSF-VSEVFLEKKFLPMLQLIA 100
           +  ++++ + E +   + TGI VS+  D  +   IP  +SF V    ++  F P+L   A
Sbjct: 69  WSQNMERQKREMEQATRGTGIAVSQTQDNQLKLDIPSDISFAVGRADIQPNFAPVLDRFA 128

Query: 101 TILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYK 160
             L   P T + I  HTD+ G+   N  +S  RA   ++YL+ RGV   R ISV G   +
Sbjct: 129 EGLRAHPETDVRIVGHTDNTGSDAVNDPLSVNRASSTRNYLMNRGVDGRR-ISVEGMGER 187

Query: 161 YPIDTNDTKVGRQNNQRIEIQIFPR 185
            PI TN T  GR  N+R+EI +  R
Sbjct: 188 QPIATNATAEGRSRNRRVEIFVGER 212


>gi|149922900|ref|ZP_01911321.1| OmpA domain protein [Plesiocystis pacifica SIR-1]
 gi|149816217|gb|EDM75723.1| OmpA domain protein [Plesiocystis pacifica SIR-1]
          Length = 517

 Score = 81.6 bits (200), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 56/90 (62%), Gaps = 1/90 (1%)

Query: 96  LQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVR 155
           L     +L  FP   I +  HTDS G   +N+ +S+ RA+ +K+YL++ G+ ++R I+  
Sbjct: 427 LDKAVKVLTDFPDIRIKVTGHTDSRGDHDHNVDLSKRRAESVKTYLVEHGIDASR-ITTD 485

Query: 156 GFAYKYPIDTNDTKVGRQNNQRIEIQIFPR 185
           GF    P+DTNDT+ GR NN+RIE +I  R
Sbjct: 486 GFGPDKPVDTNDTRAGRANNRRIEFEIVQR 515


>gi|24375456|ref|NP_719499.1| OmpA family protein [Shewanella oneidensis MR-1]
 gi|24350304|gb|AAN56943.1|AE015827_15 OmpA family protein [Shewanella oneidensis MR-1]
          Length = 228

 Score = 81.6 bits (200), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 48/141 (34%), Positives = 76/141 (53%), Gaps = 2/141 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D  E + + QL  TG+ V+R GD I   +P  V+F V +  L      +L  +A +  +
Sbjct: 89  MDVQETKLRQQLASTGVSVTRSGDNIILNMPNEVTFGVDQTELSDGAKRVLNSVALVAKE 148

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +  T + +  +TDS G+   NL +SQ RA  + +YL+ +GV+S R  S +G     PI +
Sbjct: 149 YSKTQLNVLGYTDSSGSDSYNLRLSQVRASEVGNYLMSKGVASARVKS-KGMGEASPIAS 207

Query: 166 NDTKVGRQNNQRIEIQIFPRG 186
           N    GR  N+R+EI + P G
Sbjct: 208 NANAEGRAQNRRVEIVLTPTG 228


>gi|28898041|ref|NP_797646.1| putative lipoprotein [Vibrio parahaemolyticus RIMD 2210633]
 gi|308094661|ref|ZP_05890745.2| outer membrane protein [Vibrio parahaemolyticus AN-5034]
 gi|308095662|ref|ZP_05907484.2| outer membrane protein [Vibrio parahaemolyticus Peru-466]
 gi|308125455|ref|ZP_05775378.2| outer membrane protein [Vibrio parahaemolyticus K5030]
 gi|308126686|ref|ZP_05911817.2| outer membrane protein [Vibrio parahaemolyticus AQ4037]
 gi|28806255|dbj|BAC59530.1| putative lipoprotein [Vibrio parahaemolyticus RIMD 2210633]
 gi|308088657|gb|EFO38352.1| outer membrane protein [Vibrio parahaemolyticus Peru-466]
 gi|308091164|gb|EFO40859.1| outer membrane protein [Vibrio parahaemolyticus AN-5034]
 gi|308107632|gb|EFO45172.1| outer membrane protein [Vibrio parahaemolyticus AQ4037]
 gi|308115580|gb|EFO53120.1| outer membrane protein [Vibrio parahaemolyticus K5030]
          Length = 222

 Score = 81.6 bits (200), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 45/140 (32%), Positives = 79/140 (56%), Gaps = 3/140 (2%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGD-MITCYIPVHVSFVSEVF-LEKKFLPMLQLIATILN 104
            D+ E E +  L ++G+ V R+G+  +   +   + F S  + L+      L+ +A IL 
Sbjct: 82  FDQQEAELRRALLNSGVQVQRVGENQLLLRMENGIGFSSSSYQLDASIHNTLRGVARILV 141

Query: 105 KFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPID 164
           ++P T + I  +TDS G+   N  +S+ RA+ ++ +L+ + V+  R I+ RG+  + PI 
Sbjct: 142 EYPDTSLVIDGYTDSTGSESYNQTLSERRAESVRQFLVSQKVAPGRAIA-RGYGERNPIC 200

Query: 165 TNDTKVGRQNNQRIEIQIFP 184
           +N T  GR  N+R+EIQI P
Sbjct: 201 SNQTSEGRACNRRVEIQILP 220


>gi|261378300|ref|ZP_05982873.1| OmpA family protein [Neisseria cinerea ATCC 14685]
 gi|269145394|gb|EEZ71812.1| OmpA family protein [Neisseria cinerea ATCC 14685]
          Length = 225

 Score = 81.3 bits (199), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 47/142 (33%), Positives = 72/142 (50%), Gaps = 2/142 (1%)

Query: 44  GSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVS-EVFLEKKFLPMLQLIATI 102
           G  +D  E   +  L  T + V R G+ I   +P +V+F +    L       L   A  
Sbjct: 74  GGYMDYQEQRLRQSLAGTQVQVQRQGNQIKLVMPENVTFATGSAVLSDNAQFALNTAAQT 133

Query: 103 LNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYP 162
           L ++P T + I  HTD+ G+   N  +SQ RA  +  YL  RGV+++R ++V G+    P
Sbjct: 134 LVQYPDTTLTINGHTDNTGSDAVNNPLSQHRAQTVAYYLQSRGVAASR-LAVYGYGSHMP 192

Query: 163 IDTNDTKVGRQNNQRIEIQIFP 184
           + +N T  GR  N+R+EI I P
Sbjct: 193 VASNATAEGRAQNRRVEILINP 214


>gi|330831642|ref|YP_004394594.1| outer membrane lipoprotein [Aeromonas veronii B565]
 gi|328806778|gb|AEB51977.1| Outer membrane lipoprotein [Aeromonas veronii B565]
          Length = 218

 Score = 81.3 bits (199), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 45/139 (32%), Positives = 78/139 (56%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D  E + + +LQ TG+ V+R G+ +   +P +V+F  S   L+      L  +A ++ +
Sbjct: 79  MDVQEAKLREKLQGTGVSVTRNGNELILNMPNNVTFDSSSSQLKAAGANTLSGVAMVVAE 138

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           F  T + +  HTDS G+   N+ +S++RAD + + LI +GV+ +R IS  G     P+ T
Sbjct: 139 FDKTRLNVVGHTDSTGSRDLNMKLSRDRADAVAAQLIGQGVAGSR-ISTTGVGPDQPVAT 197

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T  G+  N+R+ I + P
Sbjct: 198 NSTAAGKAQNRRVTITLTP 216


>gi|167909987|ref|ZP_02497078.1| ompA family protein [Burkholderia pseudomallei 112]
 gi|254199385|ref|ZP_04905751.1| OmpA family protein [Burkholderia mallei FMH]
 gi|254205699|ref|ZP_04912051.1| OmpA family protein [Burkholderia mallei JHU]
 gi|147748981|gb|EDK56055.1| OmpA family protein [Burkholderia mallei FMH]
 gi|147753142|gb|EDK60207.1| OmpA family protein [Burkholderia mallei JHU]
          Length = 207

 Score = 81.3 bits (199), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 44/124 (35%), Positives = 70/124 (56%), Gaps = 3/124 (2%)

Query: 59  QDTGIVVSRIGD-MITCYIPVHVSFVSEVF-LEKKFLPMLQLIATILNKFPSTVIAIQSH 116
           Q TG  V+   D  +   +P  V+F ++ + +   F P+L  +AT LN+ P    ++  +
Sbjct: 76  QQTGTQVTEQPDGSLKLNVPSSVTFATDQYAITPAFTPLLNDLATTLNQNPQITASVVGY 135

Query: 117 TDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQ 176
           TDS G+  +N  +SQ RA  + + L QRGV++NR +S +G     PI  N T+ GR  N+
Sbjct: 136 TDSTGSAAHNQTLSQNRAQSVVNALAQRGVAANR-LSAQGMGASNPIADNATEAGRAQNR 194

Query: 177 RIEI 180
           R+EI
Sbjct: 195 RVEI 198


>gi|53718641|ref|YP_107627.1| OmpA family transmembrane protein [Burkholderia pseudomallei
           K96243]
 gi|53725212|ref|YP_102481.1| ompA family protein [Burkholderia mallei ATCC 23344]
 gi|67639751|ref|ZP_00438587.1| OmpA family protein [Burkholderia mallei GB8 horse 4]
 gi|121600283|ref|YP_993611.1| ompA family protein [Burkholderia mallei SAVP1]
 gi|124385832|ref|YP_001028928.1| ompA family protein [Burkholderia mallei NCTC 10229]
 gi|126440263|ref|YP_001058104.1| ompA family protein [Burkholderia pseudomallei 668]
 gi|126449467|ref|YP_001081159.1| ompA family protein [Burkholderia mallei NCTC 10247]
 gi|126452105|ref|YP_001065339.1| ompA family protein [Burkholderia pseudomallei 1106a]
 gi|134281074|ref|ZP_01767783.1| OmpA family protein [Burkholderia pseudomallei 305]
 gi|167003046|ref|ZP_02268836.1| OmpA family protein [Burkholderia mallei PRL-20]
 gi|167718574|ref|ZP_02401810.1| ompA family protein [Burkholderia pseudomallei DM98]
 gi|167814738|ref|ZP_02446418.1| ompA family protein [Burkholderia pseudomallei 91]
 gi|167901748|ref|ZP_02488953.1| ompA family protein [Burkholderia pseudomallei NCTC 13177]
 gi|217419903|ref|ZP_03451409.1| ompA family protein [Burkholderia pseudomallei 576]
 gi|226194470|ref|ZP_03790068.1| ompA family protein [Burkholderia pseudomallei Pakistan 9]
 gi|237811323|ref|YP_002895774.1| OmpA family protein [Burkholderia pseudomallei MSHR346]
 gi|242316655|ref|ZP_04815671.1| ompA family protein [Burkholderia pseudomallei 1106b]
 gi|254177848|ref|ZP_04884503.1| ompA family protein [Burkholderia mallei ATCC 10399]
 gi|254190801|ref|ZP_04897308.1| ompA family protein [Burkholderia pseudomallei Pasteur 52237]
 gi|254196800|ref|ZP_04903224.1| ompA family protein [Burkholderia pseudomallei S13]
 gi|254261713|ref|ZP_04952767.1| ompA family protein [Burkholderia pseudomallei 1710a]
 gi|254298274|ref|ZP_04965726.1| ompA family protein [Burkholderia pseudomallei 406e]
 gi|254357860|ref|ZP_04974133.1| OmpA family protein [Burkholderia mallei 2002721280]
 gi|52209055|emb|CAH34995.1| putative OmpA family transmembrane protein [Burkholderia
           pseudomallei K96243]
 gi|52428635|gb|AAU49228.1| ompA family protein [Burkholderia mallei ATCC 23344]
 gi|121229093|gb|ABM51611.1| ompA family protein [Burkholderia mallei SAVP1]
 gi|124293852|gb|ABN03121.1| ompA family protein [Burkholderia mallei NCTC 10229]
 gi|126219756|gb|ABN83262.1| ompA family protein [Burkholderia pseudomallei 668]
 gi|126225747|gb|ABN89287.1| ompA family protein [Burkholderia pseudomallei 1106a]
 gi|126242337|gb|ABO05430.1| ompA family protein [Burkholderia mallei NCTC 10247]
 gi|134247380|gb|EBA47465.1| OmpA family protein [Burkholderia pseudomallei 305]
 gi|148026987|gb|EDK85008.1| OmpA family protein [Burkholderia mallei 2002721280]
 gi|157808098|gb|EDO85268.1| ompA family protein [Burkholderia pseudomallei 406e]
 gi|157938476|gb|EDO94146.1| ompA family protein [Burkholderia pseudomallei Pasteur 52237]
 gi|160698887|gb|EDP88857.1| ompA family protein [Burkholderia mallei ATCC 10399]
 gi|169653543|gb|EDS86236.1| ompA family protein [Burkholderia pseudomallei S13]
 gi|217397207|gb|EEC37223.1| ompA family protein [Burkholderia pseudomallei 576]
 gi|225933555|gb|EEH29544.1| ompA family protein [Burkholderia pseudomallei Pakistan 9]
 gi|237503911|gb|ACQ96229.1| OmpA family protein [Burkholderia pseudomallei MSHR346]
 gi|238520349|gb|EEP83810.1| OmpA family protein [Burkholderia mallei GB8 horse 4]
 gi|242139894|gb|EES26296.1| ompA family protein [Burkholderia pseudomallei 1106b]
 gi|243061351|gb|EES43537.1| OmpA family protein [Burkholderia mallei PRL-20]
 gi|254220402|gb|EET09786.1| ompA family protein [Burkholderia pseudomallei 1710a]
          Length = 215

 Score = 81.3 bits (199), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 44/124 (35%), Positives = 70/124 (56%), Gaps = 3/124 (2%)

Query: 59  QDTGIVVSRIGD-MITCYIPVHVSFVSEVF-LEKKFLPMLQLIATILNKFPSTVIAIQSH 116
           Q TG  V+   D  +   +P  V+F ++ + +   F P+L  +AT LN+ P    ++  +
Sbjct: 84  QQTGTQVTEQPDGSLKLNVPSSVTFATDQYAITPAFTPLLNDLATTLNQNPQITASVVGY 143

Query: 117 TDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQ 176
           TDS G+  +N  +SQ RA  + + L QRGV++NR +S +G     PI  N T+ GR  N+
Sbjct: 144 TDSTGSAAHNQTLSQNRAQSVVNALAQRGVAANR-LSAQGMGASNPIADNATEAGRAQNR 202

Query: 177 RIEI 180
           R+EI
Sbjct: 203 RVEI 206


>gi|328473002|gb|EGF43850.1| putative lipoprotein [Vibrio parahaemolyticus 10329]
          Length = 219

 Score = 81.3 bits (199), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 45/140 (32%), Positives = 79/140 (56%), Gaps = 3/140 (2%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGD-MITCYIPVHVSFVSEVF-LEKKFLPMLQLIATILN 104
            D+ E E +  L ++G+ V R+G+  +   +   + F S  + L+      L+ +A IL 
Sbjct: 79  FDQQEAELRRALLNSGVQVQRVGENQLLLRMENGIGFSSSSYQLDASIHNTLRGVARILV 138

Query: 105 KFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPID 164
           ++P T + I  +TDS G+   N  +S+ RA+ ++ +L+ + V+  R I+ RG+  + PI 
Sbjct: 139 EYPDTSLVIDGYTDSTGSESYNQTLSERRAESVRQFLVSQKVAPGRAIA-RGYGERNPIC 197

Query: 165 TNDTKVGRQNNQRIEIQIFP 184
           +N T  GR  N+R+EIQI P
Sbjct: 198 SNQTSEGRACNRRVEIQILP 217


>gi|167893289|ref|ZP_02480691.1| ompA family protein [Burkholderia pseudomallei 7894]
          Length = 171

 Score = 81.3 bits (199), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 44/124 (35%), Positives = 70/124 (56%), Gaps = 3/124 (2%)

Query: 59  QDTGIVVSRIGD-MITCYIPVHVSFVSEVF-LEKKFLPMLQLIATILNKFPSTVIAIQSH 116
           Q TG  V+   D  +   +P  V+F ++ + +   F P+L  +AT LN+ P    ++  +
Sbjct: 40  QQTGTQVTEQPDGSLKLNVPSSVTFATDQYAITPAFTPLLNDLATTLNQNPQITASVVGY 99

Query: 117 TDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQ 176
           TDS G+  +N  +SQ RA  + + L QRGV++NR +S +G     PI  N T+ GR  N+
Sbjct: 100 TDSTGSAAHNQTLSQNRAQSVVNALAQRGVAANR-LSAQGMGASNPIADNATEAGRAQNR 158

Query: 177 RIEI 180
           R+EI
Sbjct: 159 RVEI 162


>gi|167844755|ref|ZP_02470263.1| ompA family protein [Burkholderia pseudomallei B7210]
          Length = 163

 Score = 81.3 bits (199), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 44/124 (35%), Positives = 70/124 (56%), Gaps = 3/124 (2%)

Query: 59  QDTGIVVSRIGD-MITCYIPVHVSFVSEVF-LEKKFLPMLQLIATILNKFPSTVIAIQSH 116
           Q TG  V+   D  +   +P  V+F ++ + +   F P+L  +AT LN+ P    ++  +
Sbjct: 32  QQTGTQVTEQPDGSLKLNVPSSVTFATDQYAITPAFTPLLNDLATTLNQNPQITASVVGY 91

Query: 117 TDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQ 176
           TDS G+  +N  +SQ RA  + + L QRGV++NR +S +G     PI  N T+ GR  N+
Sbjct: 92  TDSTGSAAHNQTLSQNRAQSVVNALAQRGVAANR-LSAQGMGASNPIADNATEAGRAQNR 150

Query: 177 RIEI 180
           R+EI
Sbjct: 151 RVEI 154


>gi|146308664|ref|YP_001189129.1| OmpA/MotB domain-containing protein [Pseudomonas mendocina ymp]
 gi|145576865|gb|ABP86397.1| OmpA/MotB domain protein [Pseudomonas mendocina ymp]
          Length = 218

 Score = 81.3 bits (199), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 46/138 (33%), Positives = 68/138 (49%), Gaps = 2/138 (1%)

Query: 48  DKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVS-EVFLEKKFLPMLQLIATILNKF 106
           D  E + +  LQ TG+ V R GD +   +P +++F S    +   F P L  +  +  +F
Sbjct: 81  DTQEAKLRQTLQGTGVQVQRNGDDLKLIMPGNITFASNSADISSSFYPTLNSLVLVFKEF 140

Query: 107 PSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTN 166
               + I  HTDS G+ + N  +S  RA  + +YL   GV   R IS  G     PI +N
Sbjct: 141 NKNGVNIVGHTDSTGSQELNQSLSSRRAQSVANYLTANGVPGQR-ISAYGAGPSQPIASN 199

Query: 167 DTKVGRQNNQRIEIQIFP 184
            T  GR  N+R+EI + P
Sbjct: 200 ATDAGRAQNRRVEINLRP 217


>gi|93006911|ref|YP_581348.1| OmpA/MotB [Psychrobacter cryohalolentis K5]
 gi|92394589|gb|ABE75864.1| OmpA/MotB [Psychrobacter cryohalolentis K5]
          Length = 217

 Score = 81.3 bits (199), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 43/138 (31%), Positives = 75/138 (54%), Gaps = 3/138 (2%)

Query: 47  LDKAEDEFQMQLQDTGIVV-SRIGDMITCYIPVHVSFV-SEVFLEKKFLPMLQLIATILN 104
           +++   + + Q+  TG+ V       I   +P  ++F   +  L   F P L  +A  +N
Sbjct: 74  MERQARQLEQQMAGTGVTVKPNANGNIDLVMPGSITFSFDDATLNNSFKPTLDKLAATMN 133

Query: 105 KFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPID 164
           ++    I I  HTDS GT   N+ +S++RA  + +YL  RGV+SNR I+V  +    P+ 
Sbjct: 134 EYNQNTITIAGHTDSKGTDAYNMKLSRDRAYAVANYLSARGVASNR-INVVAYGESRPVA 192

Query: 165 TNDTKVGRQNNQRIEIQI 182
            N+++ GRQ N+R+E+ +
Sbjct: 193 DNNSEFGRQQNRRVELTV 210


>gi|71733414|ref|YP_273324.1| ompA family protein [Pseudomonas syringae pv. phaseolicola 1448A]
 gi|289627857|ref|ZP_06460811.1| ompA family protein [Pseudomonas syringae pv. aesculi str.
           NCPPB3681]
 gi|289648335|ref|ZP_06479678.1| ompA family protein [Pseudomonas syringae pv. aesculi str. 2250]
 gi|71553967|gb|AAZ33178.1| ompA family protein [Pseudomonas syringae pv. phaseolicola 1448A]
 gi|330868443|gb|EGH03152.1| ompA family protein [Pseudomonas syringae pv. aesculi str. 0893_23]
 gi|330988549|gb|EGH86652.1| ompA family protein [Pseudomonas syringae pv. lachrymans str.
           M301315]
 gi|331008919|gb|EGH88975.1| ompA family protein [Pseudomonas syringae pv. tabaci ATCC 11528]
          Length = 229

 Score = 81.3 bits (199), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 45/138 (32%), Positives = 75/138 (54%), Gaps = 2/138 (1%)

Query: 48  DKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEV-FLEKKFLPMLQLIATILNKF 106
           DK E   +  + +TG+ V R GD I   +P +++F ++   +   F   L  +A  L +F
Sbjct: 87  DKQEAALRASMANTGVEVQRQGDQIKLIMPGNITFATDSSAIASSFYSPLNNLANSLKQF 146

Query: 107 PSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTN 166
               I I  +TDS G+ ++N+ +SQ+RA  + +YL  +GV  +  +SVRG     PI +N
Sbjct: 147 NQNNIEIVGYTDSTGSRQHNMDLSQQRAQSVATYLTSQGVDQS-HLSVRGAGPDQPIASN 205

Query: 167 DTKVGRQNNQRIEIQIFP 184
               GR  N+R+E+ + P
Sbjct: 206 ADVNGRAQNRRVEVNLKP 223


>gi|330504865|ref|YP_004381734.1| OmpA/MotB domain-containing protein [Pseudomonas mendocina NK-01]
 gi|328919151|gb|AEB59982.1| OmpA/MotB domain-containing protein [Pseudomonas mendocina NK-01]
          Length = 218

 Score = 81.3 bits (199), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 46/136 (33%), Positives = 68/136 (50%), Gaps = 2/136 (1%)

Query: 48  DKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVS-EVFLEKKFLPMLQLIATILNKF 106
           D  E + +  LQ TG+ V R GD +   +P +++F S    +   F P L  +  +  +F
Sbjct: 81  DTQEAKLRQTLQGTGVQVQRNGDDLKLIMPGNITFASNSADISSSFYPTLNSLVLVFKEF 140

Query: 107 PSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTN 166
               + I  HTDS G+ + N  +SQ RA  + +YL   GV   R IS  G     PI +N
Sbjct: 141 NKNGVNIVGHTDSTGSQELNQSLSQRRAQSVANYLTANGVPGQR-ISAYGAGPSQPIASN 199

Query: 167 DTKVGRQNNQRIEIQI 182
            T  GR  N+R+EI +
Sbjct: 200 ATDAGRAQNRRVEINL 215


>gi|302189107|ref|ZP_07265780.1| OmpA/MotB [Pseudomonas syringae pv. syringae 642]
          Length = 229

 Score = 81.3 bits (199), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 45/138 (32%), Positives = 76/138 (55%), Gaps = 2/138 (1%)

Query: 48  DKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEV-FLEKKFLPMLQLIATILNKF 106
           DK E   +  + +TG+ V R GD I   +P +++F ++   +   F   L  +A+ L +F
Sbjct: 87  DKQEAALRESMANTGVEVQRQGDQIKLIMPGNITFATDSSAIASSFYSPLNNLASSLKQF 146

Query: 107 PSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTN 166
               I I  +TDS G+ ++N+ +SQ+RA  + +YL  +GV  +  +SVRG     PI +N
Sbjct: 147 NQNNIEIVGYTDSTGSRQHNMDLSQQRAQSVATYLTSQGVDQS-HLSVRGAGPDQPIASN 205

Query: 167 DTKVGRQNNQRIEIQIFP 184
               GR  N+R+E+ + P
Sbjct: 206 ADVNGRAQNRRVEVNLKP 223


>gi|330961787|gb|EGH62047.1| ompA family protein [Pseudomonas syringae pv. maculicola str.
           ES4326]
          Length = 229

 Score = 81.3 bits (199), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 45/138 (32%), Positives = 75/138 (54%), Gaps = 2/138 (1%)

Query: 48  DKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEV-FLEKKFLPMLQLIATILNKF 106
           DK E   +  + +TG+ V R GD I   +P +++F ++   +   F   L  +A  L +F
Sbjct: 87  DKQEAALRASMANTGVEVQRQGDQIKLIMPGNITFATDSSAIASSFYSPLNNLANSLKQF 146

Query: 107 PSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTN 166
               I I  +TDS G+ ++N+ +SQ+RA  + +YL  +GV  +  +SVRG     PI +N
Sbjct: 147 NQNNIEIVGYTDSTGSRQHNMDLSQQRAQSVATYLTSQGVDQS-HLSVRGAGPDQPIASN 205

Query: 167 DTKVGRQNNQRIEIQIFP 184
               GR  N+R+E+ + P
Sbjct: 206 ADVNGRAQNRRVEVNLKP 223


>gi|153841945|ref|ZP_01993455.1| inner membrane lipoprotein YiaD [Vibrio parahaemolyticus AQ3810]
 gi|149745429|gb|EDM56680.1| inner membrane lipoprotein YiaD [Vibrio parahaemolyticus AQ3810]
          Length = 170

 Score = 81.3 bits (199), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 45/140 (32%), Positives = 79/140 (56%), Gaps = 3/140 (2%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGD-MITCYIPVHVSFVSEVF-LEKKFLPMLQLIATILN 104
            D+ E E +  L ++G+ V R+G+  +   +   + F S  + L+      L+ +A IL 
Sbjct: 30  FDQQEAELRRALLNSGVQVQRVGENQLLLRMENGIGFSSSSYQLDASIHNTLRGVARILV 89

Query: 105 KFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPID 164
           ++P T + I  +TDS G+   N  +S+ RA+ ++ +L+ + V+  R I+ RG+  + PI 
Sbjct: 90  EYPDTSLVIDGYTDSTGSESYNQTLSERRAESVRQFLVSQKVAPGRAIA-RGYGERNPIC 148

Query: 165 TNDTKVGRQNNQRIEIQIFP 184
           +N T  GR  N+R+EIQI P
Sbjct: 149 SNQTSEGRACNRRVEIQILP 168


>gi|330951040|gb|EGH51300.1| OmpA/MotB [Pseudomonas syringae Cit 7]
          Length = 229

 Score = 81.3 bits (199), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 45/138 (32%), Positives = 76/138 (55%), Gaps = 2/138 (1%)

Query: 48  DKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEV-FLEKKFLPMLQLIATILNKF 106
           DK E   +  + +TG+ V R GD I   +P +++F ++   +   F   L  +A+ L +F
Sbjct: 87  DKQEAALRESMANTGVEVQRQGDQIKLIMPGNITFATDSSAIASSFYSPLNNLASSLKQF 146

Query: 107 PSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTN 166
               I I  +TDS G+ ++N+ +SQ+RA  + +YL  +GV  +  +SVRG     PI +N
Sbjct: 147 NQNNIEIVGYTDSTGSRQHNMDLSQQRAQSVATYLTSQGVDQS-HLSVRGAGPDQPIASN 205

Query: 167 DTKVGRQNNQRIEIQIFP 184
               GR  N+R+E+ + P
Sbjct: 206 ADVNGRAQNRRVEVNLKP 223


>gi|325272915|ref|ZP_08139241.1| OmpA/MotB domain protein [Pseudomonas sp. TJI-51]
 gi|324101950|gb|EGB99470.1| OmpA/MotB domain protein [Pseudomonas sp. TJI-51]
          Length = 145

 Score = 81.3 bits (199), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 72/129 (55%), Gaps = 2/129 (1%)

Query: 57  QLQDTGIVVSRIGDMITCYIPVHVSFVSE-VFLEKKFLPMLQLIATILNKFPSTVIAIQS 115
           Q+ +TG+ V R GD I   +P +++F ++   +   F   L  +A+   +F    I +  
Sbjct: 1   QMANTGVEVQRQGDQIKLIMPGNITFATDSANIAPSFYQPLNNLASSFKQFNQNTIEVVG 60

Query: 116 HTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNN 175
            TDS G+ ++N+ +SQ RA  + +YL  +GV S+R +SVRG     PI +N    GR  N
Sbjct: 61  FTDSTGSRQHNMDLSQRRAQAVSTYLTSQGVDSSR-LSVRGMGPDQPIASNADANGRAQN 119

Query: 176 QRIEIQIFP 184
           +R+E+ + P
Sbjct: 120 RRVEVNLKP 128


>gi|238028341|ref|YP_002912572.1| OmpA family protein [Burkholderia glumae BGR1]
 gi|237877535|gb|ACR29868.1| OmpA family protein [Burkholderia glumae BGR1]
          Length = 219

 Score = 80.9 bits (198), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 43/124 (34%), Positives = 70/124 (56%), Gaps = 3/124 (2%)

Query: 59  QDTGIVVSRIGD-MITCYIPVHVSFVSEVF-LEKKFLPMLQLIATILNKFPSTVIAIQSH 116
           Q TG  V+   D  +   +P  V+F ++ + +   F P+L  +AT LN+ P    ++  +
Sbjct: 84  QSTGTQVTEQPDGSLKLNVPSSVTFATDQYAITPAFAPLLNELATSLNQNPQITASVVGY 143

Query: 117 TDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQ 176
           TDS G+  +NL +SQ RA  + + L+QRGV+ +R +S +G     P+  N T  GR  N+
Sbjct: 144 TDSTGSAAHNLTLSQNRAQSVVTALVQRGVAGSR-LSAQGMGASNPVADNATDAGRAQNR 202

Query: 177 RIEI 180
           R+EI
Sbjct: 203 RVEI 206


>gi|120600257|ref|YP_964831.1| OmpA/MotB domain-containing protein [Shewanella sp. W3-18-1]
 gi|146291813|ref|YP_001182237.1| OmpA/MotB domain-containing protein [Shewanella putrefaciens CN-32]
 gi|120560350|gb|ABM26277.1| OmpA/MotB domain protein [Shewanella sp. W3-18-1]
 gi|145563503|gb|ABP74438.1| OmpA/MotB domain protein [Shewanella putrefaciens CN-32]
 gi|319425048|gb|ADV53122.1| OmpA/MotB domain protein [Shewanella putrefaciens 200]
          Length = 228

 Score = 80.9 bits (198), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 46/141 (32%), Positives = 78/141 (55%), Gaps = 2/141 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D  E + + QL  TG+ V+R GD I   +P  V+F V +  L      +L  +A +  +
Sbjct: 89  MDVQETKLRQQLASTGVSVTRNGDNIILNMPNEVTFGVDQTELSDGASRVLNSVALVAKE 148

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +  T + +  +TDS G+   NL +SQ RA  + +YL+ +G++++R  S +G     PI +
Sbjct: 149 YSKTQLNVLGYTDSSGSDAYNLRLSQVRASEVANYLMSKGIAASRVKS-KGMGKASPIAS 207

Query: 166 NDTKVGRQNNQRIEIQIFPRG 186
           N +  GR  N+R+EI + P G
Sbjct: 208 NASAEGRAQNRRVEIVLTPTG 228


>gi|311747916|ref|ZP_07721701.1| OmpA family protein [Algoriphagus sp. PR1]
 gi|126575910|gb|EAZ80220.1| OmpA family protein [Algoriphagus sp. PR1]
          Length = 225

 Score = 80.9 bits (198), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 45/143 (31%), Positives = 76/143 (53%), Gaps = 4/143 (2%)

Query: 43  FGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIAT 101
            G+ +DKA +E Q  L+  G  V R+G+ I       + F V +  L       L  ++ 
Sbjct: 70  IGNEMDKAAEELQRDLE--GATVERVGEGIKITFDSGLMFDVDKATLNSNSRDNLMELSE 127

Query: 102 ILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKY 161
            L K+  T I ++ HTD+ G+   NL +S++RA  ++ YL   G+  +R + +  +    
Sbjct: 128 TLKKYDETNILVEGHTDATGSDDYNLDLSRKRAYSVEDYLTNLGIQKSR-LEITAYGENQ 186

Query: 162 PIDTNDTKVGRQNNQRIEIQIFP 184
           PI TN+T+ GRQ N+R+E+ I+ 
Sbjct: 187 PIATNETEAGRQQNRRVEVAIYA 209


>gi|269968226|ref|ZP_06182255.1| putative lipoprotein [Vibrio alginolyticus 40B]
 gi|269827149|gb|EEZ81454.1| putative lipoprotein [Vibrio alginolyticus 40B]
          Length = 281

 Score = 80.9 bits (198), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 45/139 (32%), Positives = 79/139 (56%), Gaps = 3/139 (2%)

Query: 48  DKAEDEFQMQLQDTGIVVSRIGD-MITCYIPVHVSFVSEVF-LEKKFLPMLQLIATILNK 105
           D+ E E +  L ++G+ V R+G+  +   +   + F S  + L+      L+ +A IL +
Sbjct: 142 DQQEAELRRALLNSGVQVQRVGENQLLLRMENGIGFSSSSYQLDASIHNTLRGVARILVE 201

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +P T + I  +TDS G+   N  +S+ RA+ ++ +L+ + V+  R I+ RG+  + PI +
Sbjct: 202 YPDTSLVIDGYTDSTGSESYNQTLSERRAESVRQFLVSQNVAPGRAIA-RGYGERNPICS 260

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T  GR  N+R+EIQI P
Sbjct: 261 NQTSEGRACNRRVEIQILP 279


>gi|21674175|ref|NP_662240.1| OmpA family protein [Chlorobium tepidum TLS]
 gi|21647337|gb|AAM72582.1| OmpA family protein [Chlorobium tepidum TLS]
          Length = 231

 Score = 80.9 bits (198), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 44/145 (30%), Positives = 81/145 (55%), Gaps = 4/145 (2%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSE-VFLEKKFLPMLQLIATILNK 105
           +DK  DE + ++Q  G  V R+G+ I       + F ++   L       ++ +A ILN+
Sbjct: 81  MDKQADEIRQEVQ--GAKVERVGEGIRVVFDTGLLFSTDSATLNANSRYNIEKLARILNR 138

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +  T + I+ HTD+ GT  +N ++S+ RA+ + + L   GVS  R  ++ G+    P+ T
Sbjct: 139 YNDTNVVIEGHTDNTGTEASNQILSERRAESVATLLRTYGVSGRRLTAI-GYGETRPVAT 197

Query: 166 NDTKVGRQNNQRIEIQIFPRGNIKK 190
           N+T+ GR+ N+R+E+ I+    +K+
Sbjct: 198 NETEAGRRLNRRVEVLIYANDALKR 222


>gi|237806321|ref|ZP_04593025.1| OmpA/MotB [Pseudomonas syringae pv. oryzae str. 1_6]
 gi|331027434|gb|EGI07489.1| OmpA/MotB [Pseudomonas syringae pv. oryzae str. 1_6]
          Length = 194

 Score = 80.9 bits (198), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 45/138 (32%), Positives = 75/138 (54%), Gaps = 2/138 (1%)

Query: 48  DKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEV-FLEKKFLPMLQLIATILNKF 106
           DK E   +  + +TG+ V R GD I   +P +++F ++   +   F   L  +A+ L +F
Sbjct: 52  DKQEAALRESMANTGVEVQRQGDQIKLIMPGNITFATDSSAIASSFYSPLNNLASSLKQF 111

Query: 107 PSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTN 166
               I I  +TDS G+ ++N+ +SQ+RA  + +YL  +GV     +SVRG     PI +N
Sbjct: 112 NQNNIEIVGYTDSTGSRQHNMDLSQQRAQSVATYLTSQGVDQT-HLSVRGAGPDQPIASN 170

Query: 167 DTKVGRQNNQRIEIQIFP 184
               GR  N+R+E+ + P
Sbjct: 171 ADVNGRAQNRRVEVNLKP 188


>gi|237799776|ref|ZP_04588237.1| OmpA/MotB [Pseudomonas syringae pv. oryzae str. 1_6]
 gi|331022631|gb|EGI02688.1| OmpA/MotB [Pseudomonas syringae pv. oryzae str. 1_6]
          Length = 229

 Score = 80.9 bits (198), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 45/138 (32%), Positives = 75/138 (54%), Gaps = 2/138 (1%)

Query: 48  DKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEV-FLEKKFLPMLQLIATILNKF 106
           DK E   +  + +TG+ V R GD I   +P +++F ++   +   F   L  +A+ L +F
Sbjct: 87  DKQEAALRESMANTGVEVQRQGDQIKLIMPGNITFATDSSAIASSFYSPLNNLASSLKQF 146

Query: 107 PSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTN 166
               I I  +TDS G+ ++N+ +SQ+RA  + +YL  +GV     +SVRG     PI +N
Sbjct: 147 NQNNIEIVGYTDSTGSRQHNMDLSQQRAQSVATYLTSQGVDQT-HLSVRGAGPDQPIASN 205

Query: 167 DTKVGRQNNQRIEIQIFP 184
               GR  N+R+E+ + P
Sbjct: 206 ADVNGRAQNRRVEVNLKP 223


>gi|76809785|ref|YP_332623.1| ompA family protein [Burkholderia pseudomallei 1710b]
 gi|76579238|gb|ABA48713.1| ompA family protein [Burkholderia pseudomallei 1710b]
          Length = 316

 Score = 80.9 bits (198), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 73/132 (55%), Gaps = 3/132 (2%)

Query: 51  EDEFQMQLQDTGIVVSRIGD-MITCYIPVHVSFVSEVF-LEKKFLPMLQLIATILNKFPS 108
           +++     Q TG  V+   D  +   +P  V+F ++ + +   F P+L  +AT LN+ P 
Sbjct: 177 KNKLAPSAQQTGTQVTEQPDGSLKLNVPSSVTFATDQYAITPAFTPLLNDLATTLNQNPQ 236

Query: 109 TVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDT 168
              ++  +TDS G+  +N  +SQ RA  + + L QRGV++NR +S +G     PI  N T
Sbjct: 237 ITASVVGYTDSTGSAAHNQTLSQNRAQSVVNALAQRGVAANR-LSAQGMGASNPIADNAT 295

Query: 169 KVGRQNNQRIEI 180
           + GR  N+R+EI
Sbjct: 296 EAGRAQNRRVEI 307


>gi|91201036|emb|CAJ74094.1| hypothetical protein kuste3333 [Candidatus Kuenenia
           stuttgartiensis]
          Length = 395

 Score = 80.9 bits (198), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 55/156 (35%), Positives = 86/156 (55%), Gaps = 12/156 (7%)

Query: 26  KKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSE 85
           KKVFL     TDI  +         ED+      +  IV SR      C++   ++F  +
Sbjct: 247 KKVFL-----TDIPKQDSDGDGVYDEDDECPDTPEGAIVDSR-----GCWVVKGIAFEYK 296

Query: 86  VF-LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQR 144
            + ++++F   L  I  +L K P   I I+ HTD+IG++K N+ +SQ+RA  +K YL+++
Sbjct: 297 KWDIKEEFESNLTNIVDVLEKNPDLQIRIEGHTDNIGSMKYNIDLSQKRALAVKDYLVEK 356

Query: 145 GVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEI 180
           G+  +R IS  GF +K+PI  N T+ GR  N+R EI
Sbjct: 357 GIHESR-ISTTGFGFKHPIAPNVTEEGRALNRRAEI 391


>gi|288575422|ref|ZP_06393704.1| OmpA family protein [Neisseria mucosa ATCC 25996]
 gi|288568103|gb|EFC89663.1| OmpA family protein [Neisseria mucosa ATCC 25996]
          Length = 190

 Score = 80.9 bits (198), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 46/142 (32%), Positives = 73/142 (51%), Gaps = 2/142 (1%)

Query: 44  GSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVS-EVFLEKKFLPMLQLIATI 102
           G  +D  E + +  L++T I V R G+ I   +P +V+F +    L       L   +  
Sbjct: 38  GGYMDYQEKKLRENLKNTNIEVERQGNQIKLVMPENVTFATGSAALSDHARNALATASET 97

Query: 103 LNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYP 162
           L ++P T + I  HTD+ G    N  +S+ RA  +  YL  RGV+ +R  +  G+  ++P
Sbjct: 98  LVQYPDTTLTINGHTDNTGNDAINEPLSRNRALAVADYLQSRGVNGSRLTTA-GYGSRHP 156

Query: 163 IDTNDTKVGRQNNQRIEIQIFP 184
           I +N T  GR  N+R+EI I P
Sbjct: 157 IASNATVEGRAQNRRVEILINP 178


>gi|193212466|ref|YP_001998419.1| OmpA/MotB domain-containing protein [Chlorobaculum parvum NCIB
           8327]
 gi|193085943|gb|ACF11219.1| OmpA/MotB domain protein [Chlorobaculum parvum NCIB 8327]
          Length = 232

 Score = 80.9 bits (198), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 43/145 (29%), Positives = 81/145 (55%), Gaps = 4/145 (2%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +DK  +E + ++ +    V R+G+ I       + F  +   L       ++ +A +LN+
Sbjct: 82  MDKQAEEIRQEVGNAD--VERVGEGIRVVFDTGLLFSTNSSTLNPNSRYNIENLARVLNR 139

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +P T + ++ HTDSIG+   N ++S+ RA+ + S L   GV  NR  +V G+    P+ T
Sbjct: 140 YPDTNVVVEGHTDSIGSEATNQVLSERRAESVVSLLRAYGVYGNRLTAV-GYGETRPVAT 198

Query: 166 NDTKVGRQNNQRIEIQIFPRGNIKK 190
           N+T++GR+ N+R+E+ I+    +K+
Sbjct: 199 NETEMGRRQNRRVEVLIYANNELKR 223


>gi|302381881|ref|YP_003817704.1| OmpA/MotB domain protein [Brevundimonas subvibrioides ATCC 15264]
 gi|302192509|gb|ADL00081.1| OmpA/MotB domain protein [Brevundimonas subvibrioides ATCC 15264]
          Length = 224

 Score = 80.9 bits (198), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 47/139 (33%), Positives = 77/139 (55%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D+ +   + +L  TG+ V+R GD +   +P  V+F V++  +E +F  +L  +A +L +
Sbjct: 84  MDRQQRALEAELSGTGVGVARQGDNLVLRMPSDVTFAVNQSNIEPRFDAVLSDVAGVLQE 143

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +  +V+ I  HTDS G    N  +S+ RA  +   LI RGV   R   V G + + P+ +
Sbjct: 144 YDRSVVDIVGHTDSSGGDAINQPLSERRALSVADALIARGVIRERLF-VAGQSSRVPVAS 202

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T  GR  N+R+EI I P
Sbjct: 203 NATPEGRAQNRRVEILIRP 221


>gi|66044258|ref|YP_234099.1| OmpA/MotB [Pseudomonas syringae pv. syringae B728a]
 gi|63254965|gb|AAY36061.1| OmpA/MotB [Pseudomonas syringae pv. syringae B728a]
 gi|330945118|gb|EGH46848.1| OmpA/MotB [Pseudomonas syringae pv. pisi str. 1704B]
 gi|330969323|gb|EGH69389.1| OmpA/MotB [Pseudomonas syringae pv. aceris str. M302273PT]
          Length = 229

 Score = 80.9 bits (198), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 45/138 (32%), Positives = 75/138 (54%), Gaps = 2/138 (1%)

Query: 48  DKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEV-FLEKKFLPMLQLIATILNKF 106
           DK E   +  + +TG+ V R GD I   +P +++F ++   +   F   L  +A+ L +F
Sbjct: 87  DKQEAALRESMANTGVEVQRQGDQIKLIMPGNITFATDSSAIASSFYSPLNNLASSLKQF 146

Query: 107 PSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTN 166
               I I  +TDS G+ ++N+ +SQ+RA  + +YL  +GV     +SVRG     PI +N
Sbjct: 147 NQNNIEIVGYTDSTGSRQHNMDLSQQRAQSVATYLTSQGVDQ-AHLSVRGAGPDQPIASN 205

Query: 167 DTKVGRQNNQRIEIQIFP 184
               GR  N+R+E+ + P
Sbjct: 206 ADVNGRAQNRRVEVNLKP 223


>gi|254229577|ref|ZP_04922989.1| rickettsia 17 kDa surface antigen family [Vibrio sp. Ex25]
 gi|151937860|gb|EDN56706.1| rickettsia 17 kDa surface antigen family [Vibrio sp. Ex25]
          Length = 269

 Score = 80.9 bits (198), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 45/140 (32%), Positives = 79/140 (56%), Gaps = 3/140 (2%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGD-MITCYIPVHVSFVSEVF-LEKKFLPMLQLIATILN 104
            D+ E E +  L ++G+ V R+G+  +   +   + F S  + L+      L+ +A IL 
Sbjct: 129 FDQQEAELRRALLNSGVQVQRVGENQLLLRMENGIGFSSSSYQLDASIHNTLRGVARILV 188

Query: 105 KFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPID 164
           ++P T + I  +TDS G+   N  +S+ RA+ ++ +L+ + V+  R I+ RG+  + PI 
Sbjct: 189 EYPDTSLVIDGYTDSTGSESYNQTLSERRAESVRQFLVSQNVAPGRAIA-RGYGERNPIC 247

Query: 165 TNDTKVGRQNNQRIEIQIFP 184
           +N T  GR  N+R+EIQI P
Sbjct: 248 SNQTSEGRACNRRVEIQILP 267


>gi|332968653|gb|EGK07706.1| OmpA family protein [Psychrobacter sp. 1501(2011)]
          Length = 217

 Score = 80.5 bits (197), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 44/154 (28%), Positives = 79/154 (51%), Gaps = 3/154 (1%)

Query: 38  IVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDM-ITCYIPVHVSFVSE-VFLEKKFLPM 95
           ++    G+ ++  + + + Q+  TG+ V   G   I   +P +++F  +   +   F   
Sbjct: 65  VLGGAVGTYMENQKRQLEQQMAGTGVEVKHDGQGNIDLIMPGNITFAHDSTNINPSFYNT 124

Query: 96  LQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVR 155
           L  +A+ +N++  T + +  HTDS+G    N  +SQ RA  +  YL+ RGVS  R I   
Sbjct: 125 LDKLASTMNQYNQTTVTVMGHTDSVGNPTYNQGLSQRRAQSVAGYLVNRGVSGAR-IQTL 183

Query: 156 GFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGNIK 189
           G+    PI  N T+ GR  N+R+EI++    N++
Sbjct: 184 GYGQSQPIADNSTEQGRMQNRRVEIKLNAPQNLR 217


>gi|262198395|ref|YP_003269604.1| OmpA/MotB domain protein [Haliangium ochraceum DSM 14365]
 gi|262081742|gb|ACY17711.1| OmpA/MotB domain protein [Haliangium ochraceum DSM 14365]
          Length = 193

 Score = 80.5 bits (197), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 66/121 (54%), Gaps = 3/121 (2%)

Query: 70  DMITCYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTV-IAIQSHTDSIGTLKNNLL 128
           D I     V   F   V LE+    +L  +A I+   P    I ++ HTDS G    NL 
Sbjct: 75  DRIEIMQQVQFEFGKAVLLEES-KSLLDEVAAIMRDNPQIAKIRVEGHTDSKGKANFNLR 133

Query: 129 ISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGNI 188
           +S+ERA  +++YLI +GV+ NR ++ RGF    PID+NDT  GR  N+R+E  I  R + 
Sbjct: 134 LSRERAASVRAYLISQGVAGNRLVA-RGFGMTKPIDSNDTDDGRARNRRVEFNIVSRDDA 192

Query: 189 K 189
           +
Sbjct: 193 E 193


>gi|307825940|ref|ZP_07656155.1| OmpA/MotB domain protein [Methylobacter tundripaludum SV96]
 gi|307733059|gb|EFO03921.1| OmpA/MotB domain protein [Methylobacter tundripaludum SV96]
          Length = 288

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 45/143 (31%), Positives = 75/143 (52%), Gaps = 3/143 (2%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGD-MITCYIPVHVSFV-SEVFLEKKFLPMLQLIATILN 104
           +D  ++E Q  LQ TGI V R  +  +   +P +V+F      L  +    L  +A +LN
Sbjct: 76  MDHQQEEMQQSLQGTGIEVQRTAENTLNLTMPSNVTFAFDSATLTPQAQGALDSVAKVLN 135

Query: 105 KFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPID 164
           ++P + I +  HTD +G+   N ++S+ RA  + SYL Q GV+ +R ++ +G   K P  
Sbjct: 136 QYPDSTINVTGHTDDVGSDSYNQVLSERRAASVSSYLAQHGVTPSR-LTQQGMGEKMPKV 194

Query: 165 TNDTKVGRQNNQRIEIQIFPRGN 187
            N  +  R  N+R+E+ I    N
Sbjct: 195 PNVNEANRGQNRRVELAIVANKN 217


>gi|292492509|ref|YP_003527948.1| OmpA/MotB domain protein [Nitrosococcus halophilus Nc4]
 gi|291581104|gb|ADE15561.1| OmpA/MotB domain protein [Nitrosococcus halophilus Nc4]
          Length = 243

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 53/137 (38%), Positives = 77/137 (56%), Gaps = 8/137 (5%)

Query: 50  AEDEFQMQLQDTGIVVSRIGD-MITCYIPVHVSFVSE-VFLEKKFLPMLQLIATILNKFP 107
           AE+  + QL+     + R+ D  +   IP  VSF  +   L++ FLP L  IA +L K+ 
Sbjct: 94  AEERRRHQLE-----IQRLQDESLKLDIPSEVSFDHDSASLKQAFLPTLDKIADVLKKYN 148

Query: 108 STVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTND 167
            TV+ +  HTDS G+ + NL +S  RA  +  YL Q+GV S R +S+ G     P  +ND
Sbjct: 149 KTVVHVIGHTDSTGSEEYNLDLSVRRAANVAVYLEQKGVPSPR-LSIYGEGESQPRASND 207

Query: 168 TKVGRQNNQRIEIQIFP 184
           T  GRQ N+R+EI + P
Sbjct: 208 TAAGRQLNRRVEIILKP 224


>gi|329117988|ref|ZP_08246701.1| OmpA family protein [Neisseria bacilliformis ATCC BAA-1200]
 gi|327465876|gb|EGF12148.1| OmpA family protein [Neisseria bacilliformis ATCC BAA-1200]
          Length = 226

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 48/142 (33%), Positives = 75/142 (52%), Gaps = 2/142 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVS-EVFLEKKFLPMLQLIATILNK 105
           +D  E + +  L +TG+ V R GD I   +P +V+F +    L       L   A  L +
Sbjct: 76  MDYQEKKLRENLANTGVDVQRSGDQIKLVMPENVTFATGSATLSTNAQNALAAAAQTLTQ 135

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +P T ++I  HTD+ G+   N  +SQ RA  + S+L  RGV+ +R ++  G   + P+ +
Sbjct: 136 YPDTTLSINGHTDNTGSDAINAPLSQRRAQAVASFLQSRGVNGSR-LATYGHGSRQPVAS 194

Query: 166 NDTKVGRQNNQRIEIQIFPRGN 187
           N T  GR  N+R+EI I P  N
Sbjct: 195 NATAEGRAQNRRVEILINPDQN 216


>gi|163749262|ref|ZP_02156511.1| OmpA family protein [Shewanella benthica KT99]
 gi|161330981|gb|EDQ01907.1| OmpA family protein [Shewanella benthica KT99]
          Length = 220

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 50/139 (35%), Positives = 74/139 (53%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D  E E + QLQ TG+ V+R GD I   +P  V+F V EV L      +L  +A +  +
Sbjct: 81  MDVQEAELRKQLQSTGVSVTRSGDNIVLNMPNEVTFGVDEVHLNPGAKKVLNSVALVAKE 140

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +  T + I  +TDS G+   NL +S+ RA  + +YL+ + V   R  S  G     PI +
Sbjct: 141 YDQTQLNILGYTDSSGSESYNLRLSKIRAIEVGNYLVGQNVEYARVKS-EGIGEARPISS 199

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T  GR  N+R+EI + P
Sbjct: 200 NTTAAGRAQNRRVEIILSP 218


>gi|268595437|ref|ZP_06129604.1| ompA family protein [Neisseria gonorrhoeae 35/02]
 gi|268597225|ref|ZP_06131392.1| conserved hypothetical protein [Neisseria gonorrhoeae FA19]
 gi|268599401|ref|ZP_06133568.1| OmpA/MotB domain-containing protein [Neisseria gonorrhoeae MS11]
 gi|268601994|ref|ZP_06136161.1| OmpA/MotB domain-containing protein [Neisseria gonorrhoeae PID18]
 gi|268604326|ref|ZP_06138493.1| OmpA/MotB domain-containing protein [Neisseria gonorrhoeae PID1]
 gi|268682782|ref|ZP_06149644.1| OmpA/MotB domain-containing protein [Neisseria gonorrhoeae PID332]
 gi|268684809|ref|ZP_06151671.1| OmpA/MotB domain-containing protein [Neisseria gonorrhoeae
           SK-92-679]
 gi|268687209|ref|ZP_06154071.1| OmpA/MotB domain-containing protein [Neisseria gonorrhoeae
           SK-93-1035]
 gi|268548826|gb|EEZ44244.1| ompA family protein [Neisseria gonorrhoeae 35/02]
 gi|268551013|gb|EEZ46032.1| conserved hypothetical protein [Neisseria gonorrhoeae FA19]
 gi|268583532|gb|EEZ48208.1| OmpA/MotB domain-containing protein [Neisseria gonorrhoeae MS11]
 gi|268586125|gb|EEZ50801.1| OmpA/MotB domain-containing protein [Neisseria gonorrhoeae PID18]
 gi|268588457|gb|EEZ53133.1| OmpA/MotB domain-containing protein [Neisseria gonorrhoeae PID1]
 gi|268623066|gb|EEZ55466.1| OmpA/MotB domain-containing protein [Neisseria gonorrhoeae PID332]
 gi|268625093|gb|EEZ57493.1| OmpA/MotB domain-containing protein [Neisseria gonorrhoeae
           SK-92-679]
 gi|268627493|gb|EEZ59893.1| OmpA/MotB domain-containing protein [Neisseria gonorrhoeae
           SK-93-1035]
          Length = 216

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 52/180 (28%), Positives = 84/180 (46%), Gaps = 4/180 (2%)

Query: 8   SMFIMTTISGCGL--ASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVV 65
           +M+ +   + CG+  A     K   + +     +    G  +D  E   +  L  T I +
Sbjct: 27  AMYGLGGAAVCGIVGALTHSGKGARNSALACGAIGAGVGGYMDYQEQRLRQNLAGTQIEI 86

Query: 66  SRIGDMITCYIPVHVSFVS-EVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLK 124
            R G+ I   +P  V+F +    L       L   A  L ++P T + I  HTD+ G+  
Sbjct: 87  QRQGNQIRLVMPESVTFATGSAALGGSAQYALNTAAQTLVQYPDTTLTINGHTDNTGSDA 146

Query: 125 NNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
            N  +SQ RA  +  YL  RGV+++R ++V G+    P+ +N T  GR  N+R+EI I P
Sbjct: 147 VNNPLSQHRAQAVAYYLQTRGVAASR-LTVYGYGSHMPVASNATVEGRAQNRRVEILINP 205


>gi|296313347|ref|ZP_06863288.1| OmpA family protein [Neisseria polysaccharea ATCC 43768]
 gi|296840164|gb|EFH24102.1| OmpA family protein [Neisseria polysaccharea ATCC 43768]
          Length = 225

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 46/139 (33%), Positives = 71/139 (51%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVS-EVFLEKKFLPMLQLIATILNK 105
           +D  E   +  L  T + V R G+ I   +P +V+F +    L       L   A  L +
Sbjct: 77  MDYQEQRLRQSLTGTQVQVQRQGNQIKLVMPENVTFATGSAVLSNNAQFALNTAAQTLVQ 136

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +P T + I  HTD+ G+   N  +SQ RA  +  YL  RGV+++R ++V G+    P+ +
Sbjct: 137 YPDTTLTINGHTDNTGSDAVNNPLSQHRAQAVAYYLQSRGVAASR-LAVYGYGSHMPVAS 195

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T  GR  N+R+EI I P
Sbjct: 196 NATAEGRAQNRRVEILINP 214


>gi|308270955|emb|CBX27565.1| hypothetical protein N47_H23870 [uncultured Desulfobacterium sp.]
          Length = 229

 Score = 79.7 bits (195), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 60/89 (67%), Gaps = 1/89 (1%)

Query: 96  LQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVR 155
           L  +A ++N++P T I +  HTDS G+ + N  +S++RA  +K+ L+ RGV+++R IS  
Sbjct: 139 LDRVAKVINQYPDTRIQVGGHTDSTGSAEYNQKLSEQRAQAVKNALVSRGVNASR-ISAI 197

Query: 156 GFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           G+     I +N+T+ GRQ N+R+EI+I P
Sbjct: 198 GYGENKSIASNETEAGRQQNRRVEIRIIP 226


>gi|70732413|ref|YP_262169.1| OmpA family protein [Pseudomonas fluorescens Pf-5]
 gi|68346712|gb|AAY94318.1| OmpA family protein [Pseudomonas fluorescens Pf-5]
          Length = 252

 Score = 79.7 bits (195), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 44/141 (31%), Positives = 76/141 (53%), Gaps = 2/141 (1%)

Query: 43  FGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSE-VFLEKKFLPMLQLIAT 101
           +G   D+ E + +  + +TG+ V R GD I   +P +++F ++   +   F   L  +A 
Sbjct: 83  YGYYADQQEKKLRASMANTGVEVQRQGDQIKLIMPGNITFATDSANIAPSFYQPLNNLAN 142

Query: 102 ILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKY 161
            L +F    I I  +TDS G+ ++N+ +SQ RA  + +YL  +GVS +  +S RG     
Sbjct: 143 SLREFNQNQIEIVGYTDSTGSRQHNMDLSQRRAQSVATYLTSQGVSGSN-LSARGAGPDN 201

Query: 162 PIDTNDTKVGRQNNQRIEIQI 182
           PI +N    GR  N+R+E+ +
Sbjct: 202 PIASNADVNGRAQNRRVEVNL 222


>gi|319764890|ref|YP_004128827.1| ompa/motb domain protein [Alicycliphilus denitrificans BC]
 gi|330827094|ref|YP_004390397.1| OmpA/MotB domain-containing protein [Alicycliphilus denitrificans
           K601]
 gi|317119451|gb|ADV01940.1| OmpA/MotB domain protein [Alicycliphilus denitrificans BC]
 gi|329312466|gb|AEB86881.1| OmpA/MotB domain protein [Alicycliphilus denitrificans K601]
          Length = 214

 Score = 79.7 bits (195), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 49/140 (35%), Positives = 72/140 (51%), Gaps = 3/140 (2%)

Query: 43  FGSSLDKAEDEFQMQLQDTGIVVSRIGD-MITCYIPVHVSFVS-EVFLEKKFLPMLQLIA 100
           +   ++K + E Q   Q TG+ V++  D  +   IP  +SF +    ++  F P+L   A
Sbjct: 69  WSQHMEKQKQEMQAATQGTGVTVTQTADNQLKLDIPSDISFATNRSDIQPSFRPILDRFA 128

Query: 101 TILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYK 160
             L   P+  + I  HTDS G    N  +S +RA   ++YL  RGVS  R I V G   +
Sbjct: 129 EGLRNNPNAEVRIIGHTDSTGNDAINDPLSLDRATSTRNYLTARGVSGAR-IHVDGRGSR 187

Query: 161 YPIDTNDTKVGRQNNQRIEI 180
            PI +NDT  GR  N+R+EI
Sbjct: 188 EPIASNDTAEGRARNRRVEI 207


>gi|194099378|ref|YP_002002478.1| hypothetical protein NGK_1853 [Neisseria gonorrhoeae NCCP11945]
 gi|239999626|ref|ZP_04719550.1| hypothetical protein Ngon3_09112 [Neisseria gonorrhoeae 35/02]
 gi|240014801|ref|ZP_04721714.1| hypothetical protein NgonD_09194 [Neisseria gonorrhoeae DGI18]
 gi|240017250|ref|ZP_04723790.1| hypothetical protein NgonFA_08817 [Neisseria gonorrhoeae FA6140]
 gi|240081113|ref|ZP_04725656.1| hypothetical protein NgonF_07349 [Neisseria gonorrhoeae FA19]
 gi|240113325|ref|ZP_04727815.1| hypothetical protein NgonM_07083 [Neisseria gonorrhoeae MS11]
 gi|240116327|ref|ZP_04730389.1| hypothetical protein NgonPID1_08846 [Neisseria gonorrhoeae PID18]
 gi|240118614|ref|ZP_04732676.1| hypothetical protein NgonPID_09178 [Neisseria gonorrhoeae PID1]
 gi|240121324|ref|ZP_04734286.1| hypothetical protein NgonPI_06069 [Neisseria gonorrhoeae PID24-1]
 gi|240124157|ref|ZP_04737113.1| hypothetical protein NgonP_09504 [Neisseria gonorrhoeae PID332]
 gi|240126226|ref|ZP_04739112.1| hypothetical protein NgonSK_08443 [Neisseria gonorrhoeae SK-92-679]
 gi|240128827|ref|ZP_04741488.1| hypothetical protein NgonS_09423 [Neisseria gonorrhoeae SK-93-1035]
 gi|293398468|ref|ZP_06642646.1| hypothetical protein NGNG_01123 [Neisseria gonorrhoeae F62]
 gi|193934668|gb|ACF30492.1| Conserved hypothetical protein [Neisseria gonorrhoeae NCCP11945]
 gi|291610939|gb|EFF40036.1| hypothetical protein NGNG_01123 [Neisseria gonorrhoeae F62]
 gi|317164880|gb|ADV08421.1| hypothetical protein NGTW08_1460 [Neisseria gonorrhoeae
           TCDC-NG08107]
          Length = 225

 Score = 79.7 bits (195), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 52/180 (28%), Positives = 84/180 (46%), Gaps = 4/180 (2%)

Query: 8   SMFIMTTISGCGL--ASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVV 65
           +M+ +   + CG+  A     K   + +     +    G  +D  E   +  L  T I +
Sbjct: 36  AMYGLGGAAVCGIVGALTHSGKGARNSALACGAIGAGVGGYMDYQEQRLRQNLAGTQIEI 95

Query: 66  SRIGDMITCYIPVHVSFVS-EVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLK 124
            R G+ I   +P  V+F +    L       L   A  L ++P T + I  HTD+ G+  
Sbjct: 96  QRQGNQIRLVMPESVTFATGSAALGGSAQYALNTAAQTLVQYPDTTLTINGHTDNTGSDA 155

Query: 125 NNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
            N  +SQ RA  +  YL  RGV+++R ++V G+    P+ +N T  GR  N+R+EI I P
Sbjct: 156 VNNPLSQHRAQAVAYYLQTRGVAASR-LTVYGYGSHMPVASNATVEGRAQNRRVEILINP 214


>gi|162456349|ref|YP_001618716.1| exported OmpA domain-containing protein [Sorangium cellulosum 'So
           ce 56']
 gi|161166931|emb|CAN98236.1| exported OmpA domain protein [Sorangium cellulosum 'So ce 56']
          Length = 610

 Score = 79.7 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 63/97 (64%), Gaps = 2/97 (2%)

Query: 94  PMLQLIATILNKFPSTV-IAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFI 152
           P+L  +A +L + P  V I IQ HTD+ GT+++N ++SQ RA+ + + L++RG+ S R +
Sbjct: 505 PLLDEVAEVLKEHPEIVLIEIQGHTDNRGTVEHNRILSQNRANSVMAALVRRGIDSTR-L 563

Query: 153 SVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGNIK 189
           + +G+  + PID N T+ GRQ N+R++  I  +   K
Sbjct: 564 TAQGYGREQPIDDNATEAGRQRNRRVQFNIIKKAAYK 600


>gi|59801892|ref|YP_208604.1| hypothetical protein NGO1559 [Neisseria gonorrhoeae FA 1090]
 gi|260439855|ref|ZP_05793671.1| hypothetical protein NgonDG_01984 [Neisseria gonorrhoeae DGI2]
 gi|291043130|ref|ZP_06568853.1| conserved hypothetical protein [Neisseria gonorrhoeae DGI2]
 gi|59718787|gb|AAW90192.1| conserved hypothetical protein [Neisseria gonorrhoeae FA 1090]
 gi|291012736|gb|EFE04719.1| conserved hypothetical protein [Neisseria gonorrhoeae DGI2]
 gi|307075938|emb|CBE70801.1| outer membrane protein A [Neisseria gonorrhoeae]
          Length = 225

 Score = 79.7 bits (195), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 52/180 (28%), Positives = 84/180 (46%), Gaps = 4/180 (2%)

Query: 8   SMFIMTTISGCGL--ASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVV 65
           +M+ +   + CG+  A     K   + +     +    G  +D  E   +  L  T I +
Sbjct: 36  AMYGLGGAAVCGIVGALTHSGKGARNSALACGAIGAGVGGYMDYQEQRLRQNLAGTQIEI 95

Query: 66  SRIGDMITCYIPVHVSFVS-EVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLK 124
            R G+ I   +P  V+F +    L       L   A  L ++P T + I  HTD+ G+  
Sbjct: 96  QRQGNQIRLVMPESVTFATGSAALGGSAQYALNTAAQTLVQYPDTTLTINGHTDNTGSDA 155

Query: 125 NNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
            N  +SQ RA  +  YL  RGV+++R ++V G+    P+ +N T  GR  N+R+EI I P
Sbjct: 156 VNNPLSQHRAQAVAYYLQTRGVAASR-LTVYGYGSHMPVASNATVEGRAQNRRVEILINP 214


>gi|77460924|ref|YP_350431.1| OmpA/MotB [Pseudomonas fluorescens Pf0-1]
 gi|77384927|gb|ABA76440.1| putative OmpA family outer membrane protein [Pseudomonas
           fluorescens Pf0-1]
          Length = 237

 Score = 79.7 bits (195), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 44/141 (31%), Positives = 75/141 (53%), Gaps = 2/141 (1%)

Query: 43  FGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSE-VFLEKKFLPMLQLIAT 101
           +G   D+ E + +  + +TG+ V R GD I   +P +++F ++   +   F   L  +A 
Sbjct: 83  YGYYADQQEKKLRASMANTGVEVQRQGDQIKLIMPGNITFATDSANIASSFYQPLNNLAN 142

Query: 102 ILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKY 161
            L +F    I I  +TDS G+ ++N+ +SQ RA  + +YL  +GVS    +S RG     
Sbjct: 143 SLKEFNQNQIEIVGYTDSTGSRQHNMDLSQRRAQSVATYLTSQGVSGAN-LSARGAGPDN 201

Query: 162 PIDTNDTKVGRQNNQRIEIQI 182
           PI +N    GR  N+R+E+ +
Sbjct: 202 PIASNGDVNGRAQNRRVEVNL 222


>gi|261380477|ref|ZP_05985050.1| OmpA family protein [Neisseria subflava NJ9703]
 gi|284796724|gb|EFC52071.1| OmpA family protein [Neisseria subflava NJ9703]
          Length = 226

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 50/147 (34%), Positives = 75/147 (51%), Gaps = 2/147 (1%)

Query: 39  VNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVS-EVFLEKKFLPMLQ 97
           V    G  +D  E + +  L +T I V R G+ I   +P +V+F +    L       L 
Sbjct: 69  VGAGIGGYMDYQEKKLRQSLANTNIEVERQGNQIKLVMPENVTFATGSAALSGHAQSALS 128

Query: 98  LIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGF 157
             A  L ++P T + I  HTD+ G    N  +S+ RA+ + ++L  RGVSS R +S  G+
Sbjct: 129 AAAQTLVQYPDTTLTINGHTDNTGNDAINEPLSRNRAESVATFLQSRGVSSTR-LSTFGY 187

Query: 158 AYKYPIDTNDTKVGRQNNQRIEIQIFP 184
             + PI +N T  GR  N+R+EI I P
Sbjct: 188 GSRQPIASNATVEGRAQNRRVEILINP 214


>gi|310778794|ref|YP_003967127.1| OmpA/MotB domain protein [Ilyobacter polytropus DSM 2926]
 gi|309748117|gb|ADO82779.1| OmpA/MotB domain protein [Ilyobacter polytropus DSM 2926]
          Length = 208

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 41/126 (32%), Positives = 72/126 (57%), Gaps = 2/126 (1%)

Query: 58  LQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSH 116
            +  G++V R  D +T  +P  V F  ++  +++ F P+L  +   L  +    + I  H
Sbjct: 82  FEKNGVIVKRERDQLTLIMPTDVVFDFNKSEIKEDFKPLLDSLYEALTIYKGLSVKIDGH 141

Query: 117 TDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQ 176
           TD+IG+   NL +SQ+RA+  K YL+ +G+++ R I+  G ++  P  +N T+ GR  N+
Sbjct: 142 TDNIGSYDYNLKLSQKRAESAKEYLVSKGLNAGRIIT-EGHSFSTPAASNATQAGRDKNR 200

Query: 177 RIEIQI 182
           RIE+ I
Sbjct: 201 RIEVVI 206


>gi|37680143|ref|NP_934752.1| outer membrane protein [Vibrio vulnificus YJ016]
 gi|320156108|ref|YP_004188487.1| outer membrane protein [Vibrio vulnificus MO6-24/O]
 gi|326423995|ref|NP_761229.2| outer membrane protein [Vibrio vulnificus CMCP6]
 gi|37198889|dbj|BAC94723.1| outer membrane protein [Vibrio vulnificus YJ016]
 gi|319931420|gb|ADV86284.1| outer membrane protein [Vibrio vulnificus MO6-24/O]
 gi|319999372|gb|AAO10756.2| Outer membrane protein [Vibrio vulnificus CMCP6]
          Length = 223

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 80/143 (55%), Gaps = 3/143 (2%)

Query: 44  GSSLDKAEDEFQMQLQDTGIVVSRIGD-MITCYIPVHVSFVSEVFLEKKFLP-MLQLIAT 101
           G   D+ E   +  L ++G+ V R+G+  +   +   + F S  +     +   L+ +A 
Sbjct: 80  GYYFDQQEKALREALLNSGVQVERVGENQLLLRLENGIGFSSSSYALDSSIHNTLKGVAQ 139

Query: 102 ILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKY 161
           IL ++P T + I   TDS G   +N ++S+ RA+ ++S+LI + V++ R ++ RG   +Y
Sbjct: 140 ILVEYPDTSLVIDGFTDSTGNDASNQILSERRAESVRSFLISQNVAAGRAVA-RGNGERY 198

Query: 162 PIDTNDTKVGRQNNQRIEIQIFP 184
           P+ TN T  GR  N+R+EIQI P
Sbjct: 199 PLCTNSTAEGRACNRRVEIQILP 221


>gi|319638563|ref|ZP_07993325.1| hypothetical protein HMPREF0604_00949 [Neisseria mucosa C102]
 gi|317400312|gb|EFV80971.1| hypothetical protein HMPREF0604_00949 [Neisseria mucosa C102]
          Length = 226

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 50/147 (34%), Positives = 76/147 (51%), Gaps = 2/147 (1%)

Query: 39  VNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVS-EVFLEKKFLPMLQ 97
           V    G  +D  E + +  L +T I V R G+ I   +P +V+F +    L  +    L 
Sbjct: 69  VGAGIGGYMDYQEKKLRQSLANTNIEVERQGNQIKLVMPENVTFATGSAALSGQAQSALS 128

Query: 98  LIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGF 157
             A  L ++P T + I  HTD+ G    N  +S+ RA+ + ++L  RGVSS R +S  G+
Sbjct: 129 AAAQTLVQYPDTTLTINGHTDNTGNDAINEPLSRNRAESVATFLQSRGVSSTR-LSTFGY 187

Query: 158 AYKYPIDTNDTKVGRQNNQRIEIQIFP 184
             + PI +N T  GR  N+R+EI I P
Sbjct: 188 GSRQPIASNATVEGRAQNRRVEILINP 214


>gi|120613225|ref|YP_972903.1| OmpA/MotB domain-containing protein [Acidovorax citrulli AAC00-1]
 gi|120591689|gb|ABM35129.1| OmpA/MotB domain protein [Acidovorax citrulli AAC00-1]
          Length = 296

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 44/138 (31%), Positives = 78/138 (56%), Gaps = 11/138 (7%)

Query: 53  EFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIA 112
           + + Q  + G++V+ +GD++  +        ++  L  +  P L  +A  L +FP   + 
Sbjct: 167 DIEAQQTERGLLVT-LGDVLFAF--------NKAELSAQAGPRLDKLANFLRQFPDRKLI 217

Query: 113 IQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGR 172
           I+ HTDS+G    N  +S+ RA  ++S L+QRGV+ +R I+ RG+   YP+  N +  GR
Sbjct: 218 IEGHTDSVGGDAYNQSLSERRAQAVQSALVQRGVAPDR-ITARGYGKTYPVADNSSPEGR 276

Query: 173 QNNQRIEIQIF-PRGNIK 189
             N+R+EI I   +GN++
Sbjct: 277 AMNRRVEIVIADEKGNLR 294


>gi|326319363|ref|YP_004237035.1| OmpA/MotB domain-containing protein [Acidovorax avenae subsp.
           avenae ATCC 19860]
 gi|323376199|gb|ADX48468.1| OmpA/MotB domain protein [Acidovorax avenae subsp. avenae ATCC
           19860]
          Length = 217

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 49/145 (33%), Positives = 75/145 (51%), Gaps = 3/145 (2%)

Query: 43  FGSSLDKAEDEFQMQLQDTGIVVSRIGD-MITCYIPVHVSFVSEVF-LEKKFLPMLQLIA 100
           +   +++ + E Q   Q TG+VV++  D  +   IP  +SF +    ++  F P+L   A
Sbjct: 70  WSQHMERQKQEMQQVTQGTGVVVTQTQDNQLKLDIPSDISFATNRSDIQPNFAPVLDRFA 129

Query: 101 TILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYK 160
             L   P+  + I  +TDS G    N  +S +RA   ++YL  RGVS  R I V G   +
Sbjct: 130 EGLRNNPNAEVRIVGYTDSTGNDSINNPLSLDRATSTRNYLTSRGVSGAR-IQVEGRGAR 188

Query: 161 YPIDTNDTKVGRQNNQRIEIQIFPR 185
            P+ TNDT  GR  N+R+EI +  R
Sbjct: 189 EPVATNDTAEGRARNRRVEIYVGER 213


>gi|114778645|ref|ZP_01453461.1| OmpA/MotB [Mariprofundus ferrooxydans PV-1]
 gi|114551110|gb|EAU53671.1| OmpA/MotB [Mariprofundus ferrooxydans PV-1]
          Length = 226

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 52/149 (34%), Positives = 79/149 (53%), Gaps = 7/149 (4%)

Query: 47  LDKAEDEFQMQL----QDTGIVVSRI-GDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIA 100
           +DK + EF  QL    Q   I V R+  + +   +   +SF  +   L+  F   L  +A
Sbjct: 79  MDKQQAEFNRQLAAEQQAHQIEVERLQNENLKITMNSEISFDYNSAQLKPAFTDTLNKVA 138

Query: 101 TILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYK 160
            IL ++P + I I  HTD+ G+ + N  +S++RA  +K YL  RGV   R I+  G    
Sbjct: 139 DILKRYPRSTIRITGHTDNRGSTQYNQQLSEQRAQAVKWYLSDRGVDPRRIIA-EGRGEL 197

Query: 161 YPIDTNDTKVGRQNNQRIEIQIFPRGNIK 189
            P  TNDT+ GRQ N+R+E+ I P  +I+
Sbjct: 198 QPRATNDTEAGRQLNRRVEMLIVPDQDIQ 226


>gi|326319300|ref|YP_004236972.1| OmpA/MotB domain-containing protein [Acidovorax avenae subsp.
           avenae ATCC 19860]
 gi|323376136|gb|ADX48405.1| OmpA/MotB domain protein [Acidovorax avenae subsp. avenae ATCC
           19860]
          Length = 296

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 44/138 (31%), Positives = 78/138 (56%), Gaps = 11/138 (7%)

Query: 53  EFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIA 112
           + + Q  + G++V+ +GD++  +        ++  L  +  P L  +A  L +FP   + 
Sbjct: 167 DIEAQQTERGLLVT-LGDVLFAF--------NKAELSAQAGPRLDKLANFLRQFPDRKLI 217

Query: 113 IQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGR 172
           I+ HTDS+G    N  +S+ RA  ++S L+QRGV+ +R I+ RG+   YP+  N +  GR
Sbjct: 218 IEGHTDSVGGDAYNQSLSERRAQAVQSALVQRGVAPDR-ITARGYGKTYPVADNSSPEGR 276

Query: 173 QNNQRIEIQIF-PRGNIK 189
             N+R+EI I   +GN++
Sbjct: 277 AMNRRVEIVIADDKGNLR 294


>gi|150024266|ref|YP_001295092.1| OmpA family outer membrane protein P60 [Flavobacterium
           psychrophilum JIP02/86]
 gi|113927364|emb|CAL07968.2| outer membrane protein A [Flavobacterium psychrophilum JIP02/86]
 gi|149770807|emb|CAL42272.1| Outer membrane protein OmpA family P60 [Flavobacterium
           psychrophilum JIP02/86]
          Length = 465

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 34/95 (35%), Positives = 61/95 (64%), Gaps = 1/95 (1%)

Query: 88  LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVS 147
            +K+ LP+L  +  ILN+FP++  +I+ +TD+ G    N  +S+ RA  +  +LI +G+S
Sbjct: 370 FQKQTLPILDAMVAILNEFPTSKFSIEGNTDNSGKKATNQTLSENRAKAVADFLISKGIS 429

Query: 148 SNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           S+R  S+ G+    PI +N TK G+  N+R+E+++
Sbjct: 430 SDRLTSI-GYGDSMPIASNKTKAGKAQNRRVEVKV 463


>gi|16124456|ref|NP_419020.1| OmpA family protein [Caulobacter crescentus CB15]
 gi|221233140|ref|YP_002515576.1| outer membrane protein [Caulobacter crescentus NA1000]
 gi|13421324|gb|AAK22188.1| OmpA family protein [Caulobacter crescentus CB15]
 gi|220962312|gb|ACL93668.1| outer membrane protein [Caulobacter crescentus NA1000]
          Length = 226

 Score = 79.0 bits (193), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 44/139 (31%), Positives = 70/139 (50%), Gaps = 1/139 (0%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D+ + +F+  L+ +G+++ R GD I   +P  V+F V    ++  F  +L  +A  LN 
Sbjct: 86  MDRQQADFRRSLEGSGVMIRRNGDQIVLVMPSDVTFAVDRSDVQPPFTRVLDDVARTLNA 145

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +P T I +  H DS G    N  +S+ RA  +  YL   G      + V G   + PI  
Sbjct: 146 YPQTTIDVVGHADSSGPDDYNQTLSERRASAVAGYLTGPGGVLVDRVFVAGMGERAPIAD 205

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T  GR  N+R+EI + P
Sbjct: 206 NATADGRAQNRRVEIILRP 224


>gi|83720098|ref|YP_441413.1| ompA family protein [Burkholderia thailandensis E264]
 gi|83653923|gb|ABC37986.1| ompA family protein [Burkholderia thailandensis E264]
          Length = 261

 Score = 79.0 bits (193), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 43/124 (34%), Positives = 69/124 (55%), Gaps = 3/124 (2%)

Query: 59  QDTGIVVSRIGD-MITCYIPVHVSFVSEVF-LEKKFLPMLQLIATILNKFPSTVIAIQSH 116
           Q TG  V+   D  +   +P  V+F ++ + +   F P+L  +AT LN+ P    ++  +
Sbjct: 130 QQTGTQVTEQPDGSLKLNVPSSVTFATDQYAVTPAFTPLLNDLATTLNQNPQITASVVGY 189

Query: 117 TDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQ 176
           TDS G+  +N  +SQ RA  + + L QRGV++ R +S +G     PI  N T+ GR  N+
Sbjct: 190 TDSTGSAAHNQTLSQNRAQSVVNALAQRGVAATR-LSAQGMGASNPIADNATEAGRAQNR 248

Query: 177 RIEI 180
           R+EI
Sbjct: 249 RVEI 252


>gi|294139179|ref|YP_003555157.1| OmpA family protein [Shewanella violacea DSS12]
 gi|6141577|dbj|BAA85891.1| unnamed protein product [Shewanella violacea]
 gi|293325648|dbj|BAJ00379.1| OmpA family protein [Shewanella violacea DSS12]
          Length = 220

 Score = 79.0 bits (193), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 51/139 (36%), Positives = 74/139 (53%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D  E E + QL+ TG+ V+R GD I   +P  V+F V EV L      +L  +A +  +
Sbjct: 81  MDVQEAELRKQLRSTGVSVTRSGDNIVLNMPNEVTFGVDEVHLNPGAKNVLNSVALVAKE 140

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           + +T I I  +TDS G+   NL +S+ RA  +  YLI + V   R  S  G     PI +
Sbjct: 141 YDNTQINILGYTDSSGSESYNLRLSKVRAVEVADYLISQKVEYARVRS-EGIGEARPIAS 199

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T  GR  N+R+EI + P
Sbjct: 200 NSTAQGRTQNRRVEIILSP 218


>gi|299771293|ref|YP_003733319.1| Inner membrane lipoprotein yiaD precursor [Acinetobacter sp. DR1]
 gi|298701381|gb|ADI91946.1| Inner membrane lipoprotein yiaD precursor [Acinetobacter sp. DR1]
          Length = 217

 Score = 79.0 bits (193), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 45/141 (31%), Positives = 77/141 (54%), Gaps = 3/141 (2%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGD-MITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILN 104
           LD+ E + + Q+  TG+ V R  D  +   +P  ++F  ++  ++  F   L  +A  L 
Sbjct: 77  LDQKEKKLRQQMAGTGVDVGRNPDGSVQLIMPGSITFDTNKSNIKPNFYSTLNKVAQTLA 136

Query: 105 KFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPID 164
           +   + I +  +TD+ G    N+ +SQ RA  ++SYL  +GVS++R I  +GF    PI 
Sbjct: 137 EDNKSAILVTGYTDNTGNDSINIPLSQARAQSVRSYLASQGVSASR-IDAQGFGSSNPIA 195

Query: 165 TNDTKVGRQNNQRIEIQIFPR 185
            N T  GR+ N+R+EI I+ +
Sbjct: 196 DNSTATGREQNRRVEISIYAK 216


>gi|124002652|ref|ZP_01687504.1| OmpA/MotB [Microscilla marina ATCC 23134]
 gi|123991880|gb|EAY31267.1| OmpA/MotB [Microscilla marina ATCC 23134]
          Length = 352

 Score = 79.0 bits (193), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 61/89 (68%), Gaps = 1/89 (1%)

Query: 95  MLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISV 154
           +L  +  +L K+P + I ++ HTD++G  ++NL++S+ RA  ++ Y I +G+++NR  S+
Sbjct: 253 ILDEVVRLLKKYPKSNIHLEGHTDNVGKDQSNLILSKNRAASVRQYFINKGINANRITSI 312

Query: 155 RGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
            G   + PIDTN T  GRQNN+R+++ +F
Sbjct: 313 -GHGEQRPIDTNTTAKGRQNNRRVDMVMF 340


>gi|78187197|ref|YP_375240.1| OmpA family protein [Chlorobium luteolum DSM 273]
 gi|78167099|gb|ABB24197.1| OmpA family protein [Chlorobium luteolum DSM 273]
          Length = 229

 Score = 79.0 bits (193), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 45/144 (31%), Positives = 78/144 (54%), Gaps = 4/144 (2%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVS-EVFLEKKFLPMLQLIATILNK 105
           +DK   E    +   G  V R+G+ I       + F +    +       ++ +A ILN+
Sbjct: 79  MDKQAAEIDRDVD--GARVERVGESIRVVFDSGILFTTGSATITSTSRYNIEKLARILNR 136

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +P T + I+ HTDSIG+   N L+S+ RA+ + + L   GVSS+R   V G+    P+ +
Sbjct: 137 YPDTNMVIEGHTDSIGSETQNQLLSERRAESVATLLKTYGVSSSRLSPV-GYGETRPVAS 195

Query: 166 NDTKVGRQNNQRIEIQIFPRGNIK 189
           N+T+ GR+ N+R+E+ I+   ++K
Sbjct: 196 NETETGRRQNRRVEVLIYANDDLK 219


>gi|121603984|ref|YP_981313.1| OmpA/MotB domain-containing protein [Polaromonas naphthalenivorans
           CJ2]
 gi|120592953|gb|ABM36392.1| OmpA/MotB domain protein [Polaromonas naphthalenivorans CJ2]
          Length = 220

 Score = 78.6 bits (192), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 47/124 (37%), Positives = 70/124 (56%), Gaps = 3/124 (2%)

Query: 61  TGIVVSRIGD-MITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTD 118
           TG+ VS+  D  +   IP  VSF V    ++  F P+L   AT LN+ P T ++I  HTD
Sbjct: 92  TGVAVSQTQDNRLKLDIPSDVSFDVGRSAIKSNFAPVLTNFATSLNQNPITTVSIIGHTD 151

Query: 119 SIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRI 178
           S G+   N  +S +RA+  + YL+ RGV++ R I+  G   + PI  N +  GR  N+R+
Sbjct: 152 STGSDSVNNPLSVDRANAARDYLVGRGVAAQR-IATDGRGSREPIADNSSAQGRAKNRRV 210

Query: 179 EIQI 182
           EI +
Sbjct: 211 EIYV 214


>gi|167580182|ref|ZP_02373056.1| ompA family protein [Burkholderia thailandensis TXDOH]
 gi|257139912|ref|ZP_05588174.1| ompA family protein [Burkholderia thailandensis E264]
          Length = 215

 Score = 78.6 bits (192), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 43/124 (34%), Positives = 69/124 (55%), Gaps = 3/124 (2%)

Query: 59  QDTGIVVSRIGD-MITCYIPVHVSFVSEVF-LEKKFLPMLQLIATILNKFPSTVIAIQSH 116
           Q TG  V+   D  +   +P  V+F ++ + +   F P+L  +AT LN+ P    ++  +
Sbjct: 84  QQTGTQVTEQPDGSLKLNVPSSVTFATDQYAVTPAFTPLLNDLATTLNQNPQITASVVGY 143

Query: 117 TDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQ 176
           TDS G+  +N  +SQ RA  + + L QRGV++ R +S +G     PI  N T+ GR  N+
Sbjct: 144 TDSTGSAAHNQTLSQNRAQSVVNALAQRGVAATR-LSAQGMGASNPIADNATEAGRAQNR 202

Query: 177 RIEI 180
           R+EI
Sbjct: 203 RVEI 206


>gi|167618284|ref|ZP_02386915.1| ompA family protein [Burkholderia thailandensis Bt4]
          Length = 171

 Score = 78.6 bits (192), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 43/124 (34%), Positives = 69/124 (55%), Gaps = 3/124 (2%)

Query: 59  QDTGIVVSRIGD-MITCYIPVHVSFVSEVF-LEKKFLPMLQLIATILNKFPSTVIAIQSH 116
           Q TG  V+   D  +   +P  V+F ++ + +   F P+L  +AT LN+ P    ++  +
Sbjct: 40  QQTGTQVTEQPDGSLKLNVPSSVTFATDQYAVTPAFTPLLNDLATTLNQNPQITASVVGY 99

Query: 117 TDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQ 176
           TDS G+  +N  +SQ RA  + + L QRGV++ R +S +G     PI  N T+ GR  N+
Sbjct: 100 TDSTGSAAHNQTLSQNRAQSVVNALAQRGVAATR-LSAQGMGASNPIADNATEAGRAQNR 158

Query: 177 RIEI 180
           R+EI
Sbjct: 159 RVEI 162


>gi|254292855|ref|YP_003058878.1| OmpA/MotB domain protein [Hirschia baltica ATCC 49814]
 gi|254041386|gb|ACT58181.1| OmpA/MotB domain protein [Hirschia baltica ATCC 49814]
          Length = 222

 Score = 78.6 bits (192), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 45/146 (30%), Positives = 83/146 (56%), Gaps = 4/146 (2%)

Query: 44  GSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVS-EVFLEKKFLPMLQLIATI 102
           G  +D+ E + + +L +TG+ V+R+GD I   +P  ++F +    +  +F  +LQ +  +
Sbjct: 79  GRYMDQQEKKLRERLDETGVGVTRVGDTIQLVMPGDITFATGRAEINNQFDYVLQDVGLV 138

Query: 103 LNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFA-YKY 161
           L +F  TV+ I  HTD++G+ + N  +SQ RA+ + + L+Q G+   R + V G+   + 
Sbjct: 139 LQEFDKTVVFIDGHTDTVGSYQKNDELSQARANNVAARLMQEGILGGRLV-VTGYGESRL 197

Query: 162 PIDTNDTKVGRQNNQRIEIQIFPRGN 187
            + T D  V    N+R+EI++ P  N
Sbjct: 198 KVPTGD-GVNEPLNRRVEIRLEPYTN 222


>gi|300902742|ref|ZP_07120699.1| OmpA family protein [Escherichia coli MS 84-1]
 gi|300405215|gb|EFJ88753.1| OmpA family protein [Escherichia coli MS 84-1]
          Length = 211

 Score = 78.6 bits (192), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 74/132 (56%), Gaps = 2/132 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D  E + + +++ TG+ V+R GD I   +P +V+F  S   L+      L  +A +L +
Sbjct: 81  MDVQEAKLRDKMRGTGVSVTRSGDNIILNMPNNVTFDSSSATLKPAGANTLTGVAMVLKE 140

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +P T + +  +TDS G    N+ +SQ+RAD + S LI +GV ++R I  +G     PI +
Sbjct: 141 YPKTAVNVIGYTDSTGGHDLNMRLSQQRADSVASALITQGVDASR-IRTQGLGPANPIAS 199

Query: 166 NDTKVGRQNNQR 177
           N T  G+  N+R
Sbjct: 200 NSTAEGKAQNRR 211


>gi|77919760|ref|YP_357575.1| outer membrane protein [Pelobacter carbinolicus DSM 2380]
 gi|77545843|gb|ABA89405.1| outer membrane protein [Pelobacter carbinolicus DSM 2380]
          Length = 224

 Score = 78.2 bits (191), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 45/144 (31%), Positives = 78/144 (54%), Gaps = 3/144 (2%)

Query: 43  FGSSLDKAEDEFQMQLQDT-GIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIA 100
           + + ++K E   + QL    G  + R  +++       V F V+   ++      LQ +A
Sbjct: 72  YANYMEKQEQAMRQQLAGVEGASIQRDAEVLAVTFKSDVLFDVNSYSVKSGGYDELQRVA 131

Query: 101 TILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYK 160
            +LN +P T I I  HTDS G+ + N+ +S++RA+ +K+ L+  GV+  R ++V G+   
Sbjct: 132 GVLNNYPQTSIQIAGHTDSTGSEQYNMQLSRQRAEAVKNVLVGYGVAPARLMTV-GYGES 190

Query: 161 YPIDTNDTKVGRQNNQRIEIQIFP 184
            PI +N  + GRQ N+R+ I I P
Sbjct: 191 KPIASNANEAGRQINRRVAITITP 214


>gi|213962352|ref|ZP_03390615.1| outer membrane protein OmpA family P60 [Capnocytophaga sputigena
           Capno]
 gi|213955018|gb|EEB66337.1| outer membrane protein OmpA family P60 [Capnocytophaga sputigena
           Capno]
          Length = 360

 Score = 78.2 bits (191), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 59/88 (67%), Gaps = 1/88 (1%)

Query: 95  MLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISV 154
           +L  IA I+N+ P     ++ HTD+ GT ++NL +SQ+RAD IK YL + GVS  R +  
Sbjct: 269 ILDNIAIIMNENPDFNFVVEGHTDNTGTPEHNLKLSQDRADAIKQYLSRHGVSKKR-LEA 327

Query: 155 RGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           +G+    PI++NDT+ G++ N+R+EI +
Sbjct: 328 KGYGQTRPIESNDTERGKEINRRVEINV 355


>gi|86135195|ref|ZP_01053777.1| OmpA family protein [Polaribacter sp. MED152]
 gi|85822058|gb|EAQ43205.1| OmpA family protein [Polaribacter sp. MED152]
          Length = 452

 Score = 78.2 bits (191), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 56/87 (64%), Gaps = 1/87 (1%)

Query: 96  LQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVR 155
           L  I  ++ K+P    +I  HTDS G+   NL +S++RA  ++ YL++ GV + R  ++ 
Sbjct: 364 LDAIVDVMAKYPKATFSIGGHTDSSGSSSLNLRLSEKRAIAVRDYLVKNGVETTRLEAI- 422

Query: 156 GFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           G+   +PIDTN T+ GR NN+R+EI++
Sbjct: 423 GYGEGFPIDTNKTRAGRANNRRVEIKV 449


>gi|330811620|ref|YP_004356082.1| lipoprotein [Pseudomonas brassicacearum subsp. brassicacearum
           NFM421]
 gi|327379728|gb|AEA71078.1| Conserved hypothetical protein, putative lipoprotein [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
          Length = 244

 Score = 78.2 bits (191), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 43/141 (30%), Positives = 75/141 (53%), Gaps = 2/141 (1%)

Query: 43  FGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSE-VFLEKKFLPMLQLIAT 101
           +G   D+ E + +  + +TG+ V R GD I   +P +++F ++   +   F   L  +A 
Sbjct: 83  YGYYADQQEKKLRASMANTGVEVQRQGDQIKLIMPGNITFATDSANIASSFYQPLNNLAN 142

Query: 102 ILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKY 161
            L +F    I I  +TDS G+ ++N+ +SQ RA  + +YL  +GVS    +S RG     
Sbjct: 143 SLKEFNQNQIEIVGYTDSTGSRQHNMDLSQRRAQSVATYLTSQGVSGAN-LSARGAGPDN 201

Query: 162 PIDTNDTKVGRQNNQRIEIQI 182
           P+ +N    GR  N+R+E+ +
Sbjct: 202 PVASNADVNGRAQNRRVEVNL 222


>gi|50084108|ref|YP_045618.1| putative outer membrane protein [Acinetobacter sp. ADP1]
 gi|49530084|emb|CAG67796.1| putative outer membrane protein [Acinetobacter sp. ADP1]
          Length = 217

 Score = 78.2 bits (191), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 45/141 (31%), Positives = 80/141 (56%), Gaps = 3/141 (2%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGD-MITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILN 104
           LD+ E + + Q+  TG+ V+R  D  +   +P +++F  ++  ++  F   L  +A  L 
Sbjct: 77  LDQKEKKLRQQMAGTGVEVNRNPDGSVGLVMPGNITFDTNKSNIKPNFYSTLNKVAQTLA 136

Query: 105 KFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPID 164
           +   + I +  +TD+ G    N+ +SQ RA  + +YL  +GVSS+R I+ +G+    PI 
Sbjct: 137 EDNKSAILVTGYTDNTGNDSINIPLSQARAQSVANYLSGQGVSSSR-INAQGYGSSNPIA 195

Query: 165 TNDTKVGRQNNQRIEIQIFPR 185
           +N T  GR+ N+R+EI I+ R
Sbjct: 196 SNATAQGREQNRRVEISIYER 216


>gi|326334952|ref|ZP_08201152.1| outer membrane protein OprF [Capnocytophaga sp. oral taxon 338 str.
           F0234]
 gi|325692757|gb|EGD34696.1| outer membrane protein OprF [Capnocytophaga sp. oral taxon 338 str.
           F0234]
          Length = 376

 Score = 78.2 bits (191), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 35/90 (38%), Positives = 60/90 (66%), Gaps = 1/90 (1%)

Query: 95  MLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISV 154
           +L  IA I+ +       I+ HTD+ GT ++NL +SQERAD I++YL+ +G++  R +  
Sbjct: 279 ILDNIAKIMQENEDFNFVIEGHTDNTGTPEHNLQLSQERADAIRAYLVNKGINKKR-LEA 337

Query: 155 RGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           +G+    P+++NDT+ GR+ N+R+EI + P
Sbjct: 338 KGYGLSRPLESNDTERGREINRRVEINVIP 367


>gi|292492806|ref|YP_003528245.1| OmpA/MotB domain protein [Nitrosococcus halophilus Nc4]
 gi|291581401|gb|ADE15858.1| OmpA/MotB domain protein [Nitrosococcus halophilus Nc4]
          Length = 286

 Score = 78.2 bits (191), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 53/92 (57%), Gaps = 1/92 (1%)

Query: 99  IATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFA 158
           + T L ++P   + I+ HTDS G+   N  +SQ RAD +  +L+  G+S  R ++ RG+ 
Sbjct: 190 LVTFLKEYPDREVVIEGHTDSTGSAVYNQELSQRRADSVYKFLMNNGISPERIVA-RGYG 248

Query: 159 YKYPIDTNDTKVGRQNNQRIEIQIFPRGNIKK 190
             YP+  NDT  GRQ N+R+EI I   G   K
Sbjct: 249 EAYPVAPNDTAAGRQRNRRVEIVILGAGERAK 280


>gi|254454298|ref|ZP_05067735.1| OmpA family domain protein [Octadecabacter antarcticus 238]
 gi|198268704|gb|EDY92974.1| OmpA family domain protein [Octadecabacter antarcticus 238]
          Length = 219

 Score = 78.2 bits (191), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 47/141 (33%), Positives = 70/141 (49%), Gaps = 3/141 (2%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           LD+ E E + Q+     +V+  G  +   +P  + F      L       L  +A  +N 
Sbjct: 81  LDRQEAELRQQMGSNAQIVN-TGSQLIVTLPQDILFDTGSAALSGGLRSDLNALAASMNN 139

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           FP++ + +  HTDS GT   N  +S  RA  + S LIQ GVS+NR  S+ G     PI +
Sbjct: 140 FPNSTVNVIGHTDSDGTAAFNQDLSARRAQAVSSVLIQSGVSANRIRSI-GRGEDAPIAS 198

Query: 166 NDTKVGRQNNQRIEIQIFPRG 186
           N    G++ N+R+EI I P G
Sbjct: 199 NLNAEGKRQNRRVEITITPNG 219


>gi|295132150|ref|YP_003582826.1| thrombospondin repeat-containing OmpA/MotB family outer
           hypothetical protein [Zunongwangia profunda SM-A87]
 gi|294980165|gb|ADF50630.1| thrombospondin repeat-containing OmpA/MotB family outer membrane
           protein [Zunongwangia profunda SM-A87]
          Length = 470

 Score = 78.2 bits (191), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 56/87 (64%), Gaps = 1/87 (1%)

Query: 96  LQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVR 155
           L  I  I+ ++P+TV  I  HTDS+G+ + NL +S+ERA  ++ +L+  G+ +NR  S  
Sbjct: 374 LNSIIEIMEEYPNTVFHIGGHTDSVGSDEYNLKLSKERAASVRQFLVDGGIPANRLTS-E 432

Query: 156 GFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           G+    PI TN T+ GRQ N+R+EI +
Sbjct: 433 GYGESRPIATNSTEAGRQENRRVEISL 459


>gi|146328667|ref|YP_001209012.1| OmpA family protein [Dichelobacter nodosus VCS1703A]
 gi|146232137|gb|ABQ13115.1| OmpA family protein [Dichelobacter nodosus VCS1703A]
          Length = 225

 Score = 78.2 bits (191), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 48/138 (34%), Positives = 76/138 (55%), Gaps = 3/138 (2%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGD-MITCYIPVHVSFVSEVF-LEKKFLPMLQLIATILN 104
           +D+ + + Q Q+Q TGI V RI    +   IP  V F ++ + +   F   L  +A  +N
Sbjct: 73  MDRQQQQLQQQVQGTGINVQRIDQGTLQLNIPGDVLFATDEYQIRPNFYQTLNSVAQTMN 132

Query: 105 KFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPID 164
           ++P T++ I  HTDS G    N  +S+ RA+    YL+Q+GV+  R +S +G+   YP  
Sbjct: 133 QYPQTIVHIYGHTDSTGRAAYNQGLSERRANSAAQYLMQQGVNMQRILS-KGYGQNYPRA 191

Query: 165 TNDTKVGRQNNQRIEIQI 182
            N T  GR  N+R+E+ I
Sbjct: 192 NNATPDGRAQNRRVEVYI 209


>gi|325267796|ref|ZP_08134446.1| OmpA family protein [Kingella denitrificans ATCC 33394]
 gi|324980677|gb|EGC16339.1| OmpA family protein [Kingella denitrificans ATCC 33394]
          Length = 221

 Score = 78.2 bits (191), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 48/139 (34%), Positives = 75/139 (53%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVS-EVFLEKKFLPMLQLIATILNK 105
           +D  E + + QL +TG+ V R G+ I   +P +++F +    L  +    L   A  L K
Sbjct: 76  MDYQERKLREQLANTGVEVERKGNQIKLTMPENITFATNSAALSAQAQNALATAAETLAK 135

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +  T I +  HTDS G    N  +S  RA+ + S+L Q GV++ R ++V G   + PI  
Sbjct: 136 YNETTITVVGHTDSTGNDAINNPLSYNRANAVSSFLAQHGVATQR-MTVLGQGSRQPIAD 194

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N+T+ GR  N+R+EI I P
Sbjct: 195 NNTEAGRAQNRRVEILINP 213


>gi|300779346|ref|ZP_07089204.1| proteobacterial sortase system OmpA family protein
           [Chryseobacterium gleum ATCC 35910]
 gi|300504856|gb|EFK35996.1| proteobacterial sortase system OmpA family protein
           [Chryseobacterium gleum ATCC 35910]
          Length = 229

 Score = 77.8 bits (190), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 49/144 (34%), Positives = 76/144 (52%), Gaps = 9/144 (6%)

Query: 43  FGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQL---- 98
            G+ +DK   + +  L   G  V R+GD I   + ++ S V+  F       + Q     
Sbjct: 77  IGNKMDKQARDIKETL--PGAQVERVGDGIK--VTMNESIVNFAFDSSNLTSVAQTNLDK 132

Query: 99  IATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFA 158
           +A +L   P T I I  HTDS G+   NL +SQ RAD +K+YL  +G++S+R  + +G  
Sbjct: 133 LAEVLANNPDTNINIYGHTDSKGSDDYNLKLSQRRADAVKAYLTGKGIASSRMFT-KGEG 191

Query: 159 YKYPIDTNDTKVGRQNNQRIEIQI 182
              P+ +NDT+ GR  N+R+E  I
Sbjct: 192 EAMPVASNDTEEGRAKNRRVEFAI 215


>gi|312131420|ref|YP_003998760.1| ompa/motb domain protein [Leadbetterella byssophila DSM 17132]
 gi|311907966|gb|ADQ18407.1| OmpA/MotB domain protein [Leadbetterella byssophila DSM 17132]
          Length = 532

 Score = 77.8 bits (190), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 37/106 (34%), Positives = 65/106 (61%), Gaps = 2/106 (1%)

Query: 78  VHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVI 137
           V   F      ++ FL + +LIA +L K P+  I +Q HTD++G+   N+ +SQ+RAD +
Sbjct: 427 VFFEFAKATLEKESFLELDRLIA-LLVKNPNMAIEVQGHTDNVGSDNANMRLSQQRADAV 485

Query: 138 KSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
           K+Y +++G++++R  S  GF    P+ +N+T  G+  N+R+E  I 
Sbjct: 486 KAYFVEKGIATDRITST-GFGESRPVASNETTEGQAKNRRVEFVIL 530


>gi|221199341|ref|ZP_03572385.1| ompA family protein [Burkholderia multivorans CGD2M]
 gi|221205757|ref|ZP_03578772.1| ompA family protein [Burkholderia multivorans CGD2]
 gi|221211556|ref|ZP_03584535.1| inner membrane lipoprotein YiaD [Burkholderia multivorans CGD1]
 gi|221168917|gb|EEE01385.1| inner membrane lipoprotein YiaD [Burkholderia multivorans CGD1]
 gi|221174595|gb|EEE07027.1| ompA family protein [Burkholderia multivorans CGD2]
 gi|221180626|gb|EEE13029.1| ompA family protein [Burkholderia multivorans CGD2M]
          Length = 214

 Score = 77.8 bits (190), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 38/106 (35%), Positives = 62/106 (58%), Gaps = 2/106 (1%)

Query: 76  IPVHVSFVSEVF-LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERA 134
           +P  V+F +  + +   F P+L  +AT LN+ P    ++  +TDS G+ + N  +SQ RA
Sbjct: 102 VPSSVTFATNQYAITPAFTPLLNDLATTLNQNPQVTASVIGYTDSTGSAQLNQTLSQNRA 161

Query: 135 DVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEI 180
             + + L+QRGV+ NR +S +G     P+  N T+ GR  N+R+EI
Sbjct: 162 QSVVNALVQRGVAGNR-LSAQGMGPSNPVADNSTEAGRAQNRRVEI 206


>gi|91787475|ref|YP_548427.1| OmpA/MotB [Polaromonas sp. JS666]
 gi|91696700|gb|ABE43529.1| OmpA/MotB [Polaromonas sp. JS666]
          Length = 227

 Score = 77.8 bits (190), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 46/124 (37%), Positives = 69/124 (55%), Gaps = 3/124 (2%)

Query: 61  TGIVVSRIGD-MITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTD 118
           TG+ VS+  D  +   IP  VSF V    ++  F P+L   AT LN+   T + I  HTD
Sbjct: 98  TGVAVSQTPDNRLKLDIPSDVSFDVGRAAIKPNFAPILNQFATSLNQNQVTTVTIIGHTD 157

Query: 119 SIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRI 178
           S G+   N  +S +RA+  + YL+ RGV+  R I+  G   + P+  N+T+ GR  N+R+
Sbjct: 158 STGSDAINNPLSVDRANAARDYLVSRGVARTR-IATDGRGSREPVADNNTQQGRDKNRRV 216

Query: 179 EIQI 182
           EI +
Sbjct: 217 EIYV 220


>gi|161524037|ref|YP_001579049.1| OmpA/MotB domain-containing protein [Burkholderia multivorans ATCC
           17616]
 gi|189351202|ref|YP_001946830.1| putative OmpA family transmembrane protein [Burkholderia
           multivorans ATCC 17616]
 gi|160341466|gb|ABX14552.1| OmpA/MotB domain protein [Burkholderia multivorans ATCC 17616]
 gi|189335224|dbj|BAG44294.1| putative OmpA family transmembrane protein [Burkholderia
           multivorans ATCC 17616]
          Length = 214

 Score = 77.8 bits (190), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 38/106 (35%), Positives = 62/106 (58%), Gaps = 2/106 (1%)

Query: 76  IPVHVSFVSEVF-LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERA 134
           +P  V+F +  + +   F P+L  +AT LN+ P    ++  +TDS G+ + N  +SQ RA
Sbjct: 102 VPSSVTFATNQYAITPAFTPLLNDLATTLNQNPQVTASVIGYTDSTGSAQLNQTLSQNRA 161

Query: 135 DVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEI 180
             + + L+QRGV+ NR +S +G     P+  N T+ GR  N+R+EI
Sbjct: 162 QSVVNALVQRGVAGNR-LSAQGMGPSNPVADNSTEAGRAQNRRVEI 206


>gi|153834734|ref|ZP_01987401.1| inner membrane lipoprotein YiaD [Vibrio harveyi HY01]
 gi|148868823|gb|EDL67889.1| inner membrane lipoprotein YiaD [Vibrio harveyi HY01]
          Length = 222

 Score = 77.8 bits (190), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 45/139 (32%), Positives = 78/139 (56%), Gaps = 3/139 (2%)

Query: 48  DKAEDEFQMQLQDTGIVVSRIGD-MITCYIPVHVSFVSEVFLEKKFLP-MLQLIATILNK 105
           D+ E E +  L ++G+ V R+G+  +   +   + F S  +     +   L+ +A IL +
Sbjct: 83  DQQEAELRRALLNSGVQVERVGENQLLLRMENGIGFSSSSYQLDSSIHNTLRGVARILVE 142

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +P T + I  +TDS G+   N  +S+ RA+ ++ YL+ + V+  R I+ RG+  + PI +
Sbjct: 143 YPDTSLVIDGYTDSTGSDSYNQTLSERRAESVRQYLVSQNVAPGRAIA-RGYGERNPICS 201

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T  GR  N+R+EIQI P
Sbjct: 202 NQTSEGRACNRRVEIQILP 220


>gi|228471770|ref|ZP_04056543.1| OmpA family protein [Capnocytophaga gingivalis ATCC 33624]
 gi|228276923|gb|EEK15618.1| OmpA family protein [Capnocytophaga gingivalis ATCC 33624]
          Length = 455

 Score = 77.8 bits (190), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 56/88 (63%), Gaps = 1/88 (1%)

Query: 95  MLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISV 154
           +L  I  +L K+P++   I+ HTDS G    N+++SQ RAD +K YLIQ G+ + R  S 
Sbjct: 367 VLNQIINVLKKYPNSRFRIEGHTDSTGKKAKNMILSQNRADAVKVYLIQGGIDAGRLES- 425

Query: 155 RGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           +GF  + PI +N  K GR+ N+R+EI +
Sbjct: 426 QGFGPEKPIASNKNKKGRELNRRVEINL 453


>gi|209522383|ref|ZP_03270996.1| OmpA/MotB domain protein [Burkholderia sp. H160]
 gi|209497180|gb|EDZ97422.1| OmpA/MotB domain protein [Burkholderia sp. H160]
          Length = 150

 Score = 77.8 bits (190), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 45/139 (32%), Positives = 71/139 (51%), Gaps = 3/139 (2%)

Query: 44  GSSLDKAEDEFQMQLQDTGIVVSRIGD-MITCYIPVHVSF-VSEVFLEKKFLPMLQLIAT 101
           G + D   +      + TG  ++   D  +   IP  V+F  S   ++  F P+L  +A 
Sbjct: 2   GYNWDNIRNRMSGATKGTGTQITEQPDGSLKLNIPSSVTFDTSSYTIKPSFAPVLDQLAQ 61

Query: 102 ILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKY 161
            L + P  V ++  HTDS G+L+ N  +S  RA+ +  YL QRG++  R +S  G     
Sbjct: 62  TLQQNPEVVASVVGHTDSTGSLQYNQTLSVNRAESVTGYLTQRGIAPQR-LSATGMGPNQ 120

Query: 162 PIDTNDTKVGRQNNQRIEI 180
           PI  N+T+ GR  N+R+EI
Sbjct: 121 PIADNNTEAGRAANRRVEI 139


>gi|218778169|ref|YP_002429487.1| OmpA/MotB domain protein [Desulfatibacillum alkenivorans AK-01]
 gi|218759553|gb|ACL02019.1| OmpA/MotB domain protein [Desulfatibacillum alkenivorans AK-01]
          Length = 381

 Score = 77.4 bits (189), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 62/108 (57%), Gaps = 2/108 (1%)

Query: 74  CYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQE 132
           C+    + F  ++  + KK+ P++     +L K+P   + I  HTDS G  K N  +SQ+
Sbjct: 269 CWQLTGLEFKTNKADIAKKYYPIMDKAICVLKKYPDLKVLIGGHTDSRGPDKFNQELSQD 328

Query: 133 RADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEI 180
           RA  +  Y++++GV+  R +SVRGF    PI  ND+K GR  N+R+ +
Sbjct: 329 RAQAVMDYMVKKGVAPER-LSVRGFGAAKPIAANDSKEGRAQNRRVTL 375


>gi|148259686|ref|YP_001233813.1| OmpA/MotB domain-containing protein [Acidiphilium cryptum JF-5]
 gi|146401367|gb|ABQ29894.1| OmpA/MotB domain protein [Acidiphilium cryptum JF-5]
          Length = 227

 Score = 77.4 bits (189), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 44/141 (31%), Positives = 72/141 (51%), Gaps = 4/141 (2%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGD-MITCYIPVHVSFVS-EVFLEKKFLPMLQLIATILN 104
           L+  +   Q   Q TG+ VS+  D  +   +P    F +    L  +  P+L  +   L 
Sbjct: 83  LEAQKQALQRTAQGTGVQVSQTADNRLKLNVPADAGFATGSATLNPRLYPILDQLGQGLQ 142

Query: 105 KFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPID 164
           + P+  + I  +TDS G+   N  +S  RA  +K+YL+ RG+S  R I+ RG   + P+ 
Sbjct: 143 QNPTETVQIIGYTDSTGSNAINYPLSDNRAASVKTYLVSRGISGQR-IATRGMGPQDPVA 201

Query: 165 TNDTKVGRQNNQRIEIQI-FP 184
           +N T  GR  N+R++I + FP
Sbjct: 202 SNATAAGRAANRRVDIYVAFP 222


>gi|326403344|ref|YP_004283425.1| hypothetical protein ACMV_11960 [Acidiphilium multivorum AIU301]
 gi|325050205|dbj|BAJ80543.1| hypothetical protein ACMV_11960 [Acidiphilium multivorum AIU301]
          Length = 215

 Score = 77.4 bits (189), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 44/141 (31%), Positives = 72/141 (51%), Gaps = 4/141 (2%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGD-MITCYIPVHVSFVS-EVFLEKKFLPMLQLIATILN 104
           L+  +   Q   Q TG+ VS+  D  +   +P    F +    L  +  P+L  +   L 
Sbjct: 71  LEAQKQALQRTAQGTGVQVSQTADNRLKLNVPADAGFATGSATLNPRLYPILDQLGQGLQ 130

Query: 105 KFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPID 164
           + P+  + I  +TDS G+   N  +S  RA  +K+YL+ RG+S  R I+ RG   + P+ 
Sbjct: 131 QNPTETVQIIGYTDSTGSNAINYPLSDNRAASVKTYLVSRGISGQR-IATRGMGPQDPVA 189

Query: 165 TNDTKVGRQNNQRIEIQI-FP 184
           +N T  GR  N+R++I + FP
Sbjct: 190 SNATAAGRAANRRVDIYVAFP 210


>gi|325121211|gb|ADY80734.1| OmpA domain protein [Acinetobacter calcoaceticus PHEA-2]
          Length = 217

 Score = 77.4 bits (189), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 44/141 (31%), Positives = 77/141 (54%), Gaps = 3/141 (2%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGD-MITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILN 104
           LD+ E + + Q+  TG+ V R  D  +   +P  ++F  ++  ++  F   L  +A  L 
Sbjct: 77  LDQKEKKLRQQMAGTGVDVGRNPDGSVQLIMPGSITFDTNKSNIKPNFYATLNKVAQTLA 136

Query: 105 KFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPID 164
           +   + I +  +TD+ G    N+ +SQ RA  ++SYL  +GVS++R I  +G+    PI 
Sbjct: 137 EDNKSAILVTGYTDNTGNDSINIPLSQARAQSVRSYLASQGVSASR-IDAQGYGSSNPIA 195

Query: 165 TNDTKVGRQNNQRIEIQIFPR 185
            N T  GR+ N+R+EI I+ +
Sbjct: 196 DNSTASGREQNRRVEISIYAK 216


>gi|120613283|ref|YP_972961.1| OmpA/MotB domain-containing protein [Acidovorax citrulli AAC00-1]
 gi|120591747|gb|ABM35187.1| OmpA/MotB domain protein [Acidovorax citrulli AAC00-1]
          Length = 217

 Score = 77.4 bits (189), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 47/145 (32%), Positives = 75/145 (51%), Gaps = 3/145 (2%)

Query: 43  FGSSLDKAEDEFQMQLQDTGIVVSRIGD-MITCYIPVHVSFVSEVF-LEKKFLPMLQLIA 100
           +   +++ + E Q   Q TG+VV++  D  +   IP  +SF +    ++  F P+L   A
Sbjct: 70  WSQHMERQKQEMQQVTQGTGVVVTQTQDNQLKLDIPSDISFATNRSDIQPNFAPVLDRFA 129

Query: 101 TILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYK 160
             L   P+  + I  +TDS G    N  +S +RA   ++YL  RGV+  R + V G   +
Sbjct: 130 EGLRNNPNAEVRIVGYTDSTGNDAINNPLSLDRATSTRNYLTARGVNGAR-VQVEGRGAR 188

Query: 161 YPIDTNDTKVGRQNNQRIEIQIFPR 185
            P+ TNDT  GR  N+R+EI +  R
Sbjct: 189 EPVATNDTAEGRARNRRVEIYVGER 213


>gi|221069812|ref|ZP_03545917.1| OmpA/MotB domain protein [Comamonas testosteroni KF-1]
 gi|220714835|gb|EED70203.1| OmpA/MotB domain protein [Comamonas testosteroni KF-1]
          Length = 219

 Score = 77.0 bits (188), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 47/145 (32%), Positives = 75/145 (51%), Gaps = 3/145 (2%)

Query: 43  FGSSLDKAEDEFQMQLQDTGIVVSRIGD-MITCYIPVHVSF-VSEVFLEKKFLPMLQLIA 100
           +  +L+K + E +   Q TG+ V++  D  +   IP  +SF      ++  F P+L   A
Sbjct: 73  WSQNLEKQKREMEAATQGTGVGVTQTADNQLKLDIPSDISFDTGRADIKSNFAPILDRFA 132

Query: 101 TILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYK 160
             L   P+  + I  HTDS G+   N  +S +RA+  ++YL  RGV+  R I V+G    
Sbjct: 133 EGLRNNPNAEVRIIGHTDSTGSDAINNPLSLQRAESTRNYLTSRGVNGAR-IQVQGMGSH 191

Query: 161 YPIDTNDTKVGRQNNQRIEIQIFPR 185
            P+ +N T  GR  N+R+EI +  R
Sbjct: 192 QPVASNATNEGRARNRRVEIFVGER 216


>gi|170728573|ref|YP_001762599.1| OmpA/MotB domain-containing protein [Shewanella woodyi ATCC 51908]
 gi|169813920|gb|ACA88504.1| OmpA/MotB domain protein [Shewanella woodyi ATCC 51908]
          Length = 224

 Score = 77.0 bits (188), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 49/139 (35%), Positives = 73/139 (52%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D  E E + QLQ TG+ V+R GD I   +P  V+F V E  L      +L  +A +  +
Sbjct: 85  MDTQEAELRKQLQSTGVSVTRSGDNIILNMPNEVTFGVDETHLSAGAKRVLNSVALVAKE 144

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +  T + +   TDS G+   NL +S+ RA  +  YL+ + V   R  S  G   + PI +
Sbjct: 145 YDKTRLNVLGFTDSSGSESYNLRLSKVRAVEVADYLVSQKVEYVRVKS-DGMGEERPIAS 203

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N TK GR  N+R+EI + P
Sbjct: 204 NATKEGRAENRRVEIILSP 222


>gi|293609016|ref|ZP_06691319.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292829589|gb|EFF87951.1| conserved hypothetical protein [Acinetobacter sp. SH024]
          Length = 217

 Score = 77.0 bits (188), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 44/141 (31%), Positives = 77/141 (54%), Gaps = 3/141 (2%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGD-MITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILN 104
           LD+ E + + Q+  TG+ V R  D  +   +P  ++F  ++  ++  F   L  +A  L 
Sbjct: 77  LDQKEKKLRQQMAGTGVDVGRNPDGSVQLIMPGSITFDTNKSNIKPNFYATLNKVAQTLA 136

Query: 105 KFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPID 164
           +   + I +  +TD+ G    N+ +SQ RA  ++SYL  +GVS++R I  +G+    PI 
Sbjct: 137 EDNKSAILVTGYTDNTGNDSINIPLSQARAQSVRSYLASQGVSASR-IDAQGYGSSNPIA 195

Query: 165 TNDTKVGRQNNQRIEIQIFPR 185
            N T  GR+ N+R+EI I+ +
Sbjct: 196 DNSTASGREQNRRVEISIYAK 216


>gi|134296618|ref|YP_001120353.1| OmpA/MotB domain-containing protein [Burkholderia vietnamiensis G4]
 gi|134139775|gb|ABO55518.1| OmpA/MotB domain protein [Burkholderia vietnamiensis G4]
          Length = 213

 Score = 77.0 bits (188), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 39/106 (36%), Positives = 61/106 (57%), Gaps = 2/106 (1%)

Query: 76  IPVHVSFVSEVF-LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERA 134
           +P  V+F +  + +   F P+L  +AT LN+ P    +I  +TDS G+ + N  +SQ RA
Sbjct: 102 VPSSVTFATNQYAITPAFTPLLNDLATTLNQNPQVTASIVGYTDSTGSAQLNQTLSQNRA 161

Query: 135 DVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEI 180
             + + L+QRGV+  R +S +G     PI  N T+ GR  N+R+EI
Sbjct: 162 QSVVNALVQRGVAGGR-LSAQGMGASNPIADNATEAGRAQNRRVEI 206


>gi|264680876|ref|YP_003280786.1| OmpA/MotB [Comamonas testosteroni CNB-2]
 gi|299531878|ref|ZP_07045278.1| OmpA/MotB [Comamonas testosteroni S44]
 gi|262211392|gb|ACY35490.1| OmpA/MotB [Comamonas testosteroni CNB-2]
 gi|298720053|gb|EFI61010.1| OmpA/MotB [Comamonas testosteroni S44]
          Length = 219

 Score = 77.0 bits (188), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 47/145 (32%), Positives = 75/145 (51%), Gaps = 3/145 (2%)

Query: 43  FGSSLDKAEDEFQMQLQDTGIVVSRIGD-MITCYIPVHVSF-VSEVFLEKKFLPMLQLIA 100
           +  +L+K + E +   Q TG+ V++  D  +   IP  +SF      ++  F P+L   A
Sbjct: 73  WSQNLEKQKREMEAATQGTGVGVTQTADNQLKLDIPSDISFDTGRADIKGNFAPILDRFA 132

Query: 101 TILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYK 160
             L   P+  + I  HTDS G+   N  +S +RA+  ++YL  RGV+  R I V+G    
Sbjct: 133 EGLRNNPNAEVRIIGHTDSTGSDAINNPLSLQRAESTRNYLTSRGVNGAR-IQVQGMGSH 191

Query: 161 YPIDTNDTKVGRQNNQRIEIQIFPR 185
            P+ +N T  GR  N+R+EI +  R
Sbjct: 192 QPVASNATNEGRARNRRVEIFVGER 216


>gi|307824145|ref|ZP_07654372.1| OmpA/MotB domain protein [Methylobacter tundripaludum SV96]
 gi|307734929|gb|EFO05779.1| OmpA/MotB domain protein [Methylobacter tundripaludum SV96]
          Length = 396

 Score = 77.0 bits (188), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 67/111 (60%), Gaps = 2/111 (1%)

Query: 74  CYIPVHVSFVSE-VFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQE 132
           C+I V V F ++   ++ ++   L    T++N+ P   I +Q HT S GT++ N  +S+ 
Sbjct: 286 CWI-VDVKFDNDKSNIKPQYYRELDNAVTVINQNPGVNIEVQGHTSSTGTVEYNQRLSER 344

Query: 133 RADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
           RA  +K+YL  +   + R ++ RG+    PIDTN+T+ GR NN+R+++++ 
Sbjct: 345 RALAVKNYLSSKSAHAGRTLTARGYGLTQPIDTNETEEGRANNRRVQLEVL 395


>gi|91776019|ref|YP_545775.1| OmpA/MotB [Methylobacillus flagellatus KT]
 gi|91710006|gb|ABE49934.1| OmpA/MotB [Methylobacillus flagellatus KT]
          Length = 214

 Score = 77.0 bits (188), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 45/140 (32%), Positives = 78/140 (55%), Gaps = 3/140 (2%)

Query: 43  FGSSLDKAEDEFQMQLQDTGIVVSRIGD-MITCYIPVHVSFVS-EVFLEKKFLPMLQLIA 100
           +   +++ + + +   +DTG+ VS+  D  +   IP  +SF S +  +E  F  +L   A
Sbjct: 67  WSKRMEEQKRQMEEATKDTGVEVSQTEDNQLKLSIPSDISFASGKADIEPNFRVVLDNFA 126

Query: 101 TILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYK 160
           T L   P+T++ I  HTD+ G+   N  +S  RA   + YLI RG++++RF ++ G   +
Sbjct: 127 TTLKNNPNTLVTIIGHTDNTGSDAINNPLSVNRAANTRDYLIARGIAASRF-TIDGRGSR 185

Query: 161 YPIDTNDTKVGRQNNQRIEI 180
            P+ +NDT   R  N+R+EI
Sbjct: 186 EPLVSNDTPANRAKNRRVEI 205


>gi|298485733|ref|ZP_07003812.1| Outer membrane protein [Pseudomonas savastanoi pv. savastanoi NCPPB
           3335]
 gi|298159759|gb|EFI00801.1| Outer membrane protein [Pseudomonas savastanoi pv. savastanoi NCPPB
           3335]
          Length = 229

 Score = 77.0 bits (188), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 44/138 (31%), Positives = 73/138 (52%), Gaps = 2/138 (1%)

Query: 48  DKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEV-FLEKKFLPMLQLIATILNKF 106
           DK E   +  + +TG+ V R GD I   +P +++F ++   +   F   L  +A  L +F
Sbjct: 87  DKQEAALRASMANTGVEVQRQGDQIKLIMPGNITFATDSSAIASSFYSPLNNLANSLKQF 146

Query: 107 PSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTN 166
               I I  +TDS G+ ++N+ +SQ+RA  + +YL  + V     +SVRG     PI +N
Sbjct: 147 NQNNIEIVGYTDSTGSRQHNMDLSQQRAQSVATYLTSQ-VVDQSHLSVRGAGPDQPIASN 205

Query: 167 DTKVGRQNNQRIEIQIFP 184
               GR  N+R+E+ + P
Sbjct: 206 ADVNGRAQNRRVEVNLKP 223


>gi|149917198|ref|ZP_01905698.1| OmpA domain protein [Plesiocystis pacifica SIR-1]
 gi|149822114|gb|EDM81507.1| OmpA domain protein [Plesiocystis pacifica SIR-1]
          Length = 395

 Score = 77.0 bits (188), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 34/86 (39%), Positives = 55/86 (63%), Gaps = 1/86 (1%)

Query: 95  MLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISV 154
           +L  + T+LN  P   I I  HTDS G+ ++N  +S+ R   ++ YL+ +G+  +R I+ 
Sbjct: 299 LLDDVYTVLNTNPDITIEIGGHTDSKGSSRSNQRLSENRVKSVREYLVDKGIDGSR-ITF 357

Query: 155 RGFAYKYPIDTNDTKVGRQNNQRIEI 180
           +G+    P+DTN TK GR+NN+R+EI
Sbjct: 358 KGYGEDVPVDTNRTKEGRENNRRVEI 383


>gi|89070689|ref|ZP_01157958.1| OmpA family protein [Oceanicola granulosus HTCC2516]
 gi|89043710|gb|EAR49914.1| OmpA family protein [Oceanicola granulosus HTCC2516]
          Length = 229

 Score = 77.0 bits (188), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 49/140 (35%), Positives = 72/140 (51%), Gaps = 3/140 (2%)

Query: 46  SLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSE-VFLEKKFLPMLQLIATILN 104
           SLD+ E E +  L +  + +   GD +   +P  + F ++   L       L  +A  LN
Sbjct: 90  SLDRQEAELRRSLGNN-VRIDNTGDSLVVTLPQDILFDTDSATLSGSLQSDLNALARSLN 148

Query: 105 KFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPID 164
            +PST I +  HTD+ G    N  +S+ RA  + S LI  GVS+ R  +V G     PI 
Sbjct: 149 NYPSTTITVIGHTDNTGEASYNQNLSRRRAQAVTSTLISSGVSAGRINTV-GRGEDAPIA 207

Query: 165 TNDTKVGRQNNQRIEIQIFP 184
           TN T+ GR+ N+R+EI I P
Sbjct: 208 TNLTEDGRRQNRRVEIIINP 227


>gi|332970903|gb|EGK09879.1| outer membrane protein OprF [Psychrobacter sp. 1501(2011)]
          Length = 315

 Score = 77.0 bits (188), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 37/81 (45%), Positives = 55/81 (67%), Gaps = 2/81 (2%)

Query: 99  IATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQR-GVSSNRFISVRGF 157
           +A  +NK+P+T   I+ HTDSIG    N+ +SQ+RA+ +K  LI + GV+ NR I+ +GF
Sbjct: 228 VANFMNKYPNTSTIIEGHTDSIGAANYNMKLSQQRAEAVKQELISKYGVNPNRLIT-QGF 286

Query: 158 AYKYPIDTNDTKVGRQNNQRI 178
               P+DTN T+ GR NN+R+
Sbjct: 287 GETRPVDTNTTEKGRYNNRRV 307


>gi|296137072|ref|YP_003644314.1| OmpA/MotB domain protein [Thiomonas intermedia K12]
 gi|294341249|emb|CAZ89650.1| putative OmpA family protein [Thiomonas sp. 3As]
 gi|295797194|gb|ADG31984.1| OmpA/MotB domain protein [Thiomonas intermedia K12]
          Length = 226

 Score = 77.0 bits (188), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 44/144 (30%), Positives = 78/144 (54%), Gaps = 5/144 (3%)

Query: 43  FGSSLDKAEDEFQMQLQ--DTGIVVSRIGD-MITCYIPVHVSFVS-EVFLEKKFLPMLQL 98
           +   L+K + + Q Q Q   TG+ V++  D  +   +P    F +    L  +  P+L+ 
Sbjct: 78  WNQHLEKQKQDLQAQAQASGTGVQVTQTQDNRLKMNVPADAGFATGSAQLNPRMYPILES 137

Query: 99  IATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFA 158
           +AT LN+ PS  + +   TD+ GT   N  +S+ RA  +K++L+ RGV+  R ++ +G  
Sbjct: 138 LATGLNQNPSETVQVFGFTDNTGTDAINYPLSENRALTVKNFLVSRGVAPQR-VTTQGLG 196

Query: 159 YKYPIDTNDTKVGRQNNQRIEIQI 182
            + P+ +N T  GR  N+R+EI +
Sbjct: 197 PQNPVASNATAQGRAANRRVEIYV 220


>gi|156974345|ref|YP_001445252.1| hypothetical protein VIBHAR_02060 [Vibrio harveyi ATCC BAA-1116]
 gi|156525939|gb|ABU71025.1| hypothetical protein VIBHAR_02060 [Vibrio harveyi ATCC BAA-1116]
          Length = 219

 Score = 77.0 bits (188), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 45/139 (32%), Positives = 78/139 (56%), Gaps = 3/139 (2%)

Query: 48  DKAEDEFQMQLQDTGIVVSRIGD-MITCYIPVHVSFVSEVFLEKKFLP-MLQLIATILNK 105
           D+ E E +  L ++G+ V R+G+  +   +   + F S  +     +   L+ +A IL +
Sbjct: 80  DQQEAELRRALLNSGVQVERVGENQLLLRMENGIGFSSSSYQLDSSIHNTLRGVARILVE 139

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +P T + I  +TDS G+   N  +S+ RA+ ++ YL+ + V+  R I+ RG+  + PI +
Sbjct: 140 YPDTSLVIDGYTDSTGSDSYNQTLSERRAESVRQYLVSQKVAPGRAIA-RGYGERNPICS 198

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T  GR  N+R+EIQI P
Sbjct: 199 NQTSDGRACNRRVEIQILP 217


>gi|262280028|ref|ZP_06057813.1| OmpA/MotB domain-containing protein [Acinetobacter calcoaceticus
           RUH2202]
 gi|262260379|gb|EEY79112.1| OmpA/MotB domain-containing protein [Acinetobacter calcoaceticus
           RUH2202]
          Length = 217

 Score = 77.0 bits (188), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 44/141 (31%), Positives = 77/141 (54%), Gaps = 3/141 (2%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGD-MITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILN 104
           LD+ E + + Q+  TG+ V R  D  +   +P  ++F  ++  ++  F   L  +A  L 
Sbjct: 77  LDQKEKKLRQQMAGTGVDVGRNPDGSVQLIMPGSITFDTNKSNIKPNFYSTLDKVAQTLA 136

Query: 105 KFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPID 164
           +   + I +  +TD+ G    N+ +SQ RA  +K+YL  +G+SS+R I  +G+    PI 
Sbjct: 137 EDNKSAILVTGYTDNTGNDSINIPLSQSRAQSVKNYLAGKGLSSSR-IDAQGYGSSNPIA 195

Query: 165 TNDTKVGRQNNQRIEIQIFPR 185
            N T  GR+ N+R+EI I+ +
Sbjct: 196 DNSTASGREQNRRVEISIYAK 216


>gi|262373228|ref|ZP_06066507.1| inner membrane lipoprotein yiaD [Acinetobacter junii SH205]
 gi|262313253|gb|EEY94338.1| inner membrane lipoprotein yiaD [Acinetobacter junii SH205]
          Length = 220

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 44/141 (31%), Positives = 76/141 (53%), Gaps = 3/141 (2%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGD-MITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILN 104
           LD  E + + Q+  TG+ V R  D  +   +P  ++F  ++  ++  F   L  +A  L 
Sbjct: 80  LDNKEKKLRAQMAGTGVEVGRNPDGSVQLIMPGSITFDTNKSNIKPNFYGTLNKVAQTLA 139

Query: 105 KFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPID 164
           +   + I +  +TD+ G    N+ +SQ RA  +K+YL  +GVSS+R I  +G     PI 
Sbjct: 140 EDNKSAILVTGYTDNTGNDSINIPLSQARAQSVKNYLASQGVSSSR-IDAQGLGSSNPIA 198

Query: 165 TNDTKVGRQNNQRIEIQIFPR 185
           +N T  G++ N+R+EI I+ +
Sbjct: 199 SNATAAGKEQNRRVEISIYAK 219


>gi|312795362|ref|YP_004028284.1| OmpA family protein [Burkholderia rhizoxinica HKI 454]
 gi|312167137|emb|CBW74140.1| OmpA family protein [Burkholderia rhizoxinica HKI 454]
          Length = 224

 Score = 76.6 bits (187), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 47/132 (35%), Positives = 68/132 (51%), Gaps = 7/132 (5%)

Query: 61  TGIVVSRIGD-MITCYIPVHVSFVSEVF-LEKKFLPMLQLIATILNKFPSTVIAIQSHTD 118
           TG  VS   D  +   IP  VSF +  + ++  F P+L  +A  L + P  V  +  HTD
Sbjct: 94  TGTQVSEQPDGSLKLNIPSSVSFDTNSYAIKPSFTPVLDQVAQTLTQHPELVAHVVGHTD 153

Query: 119 SIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRI 178
           S G  + N ++SQERA  +  YL   GV++ R ++  G     PI  N T+ GR  N+R+
Sbjct: 154 STGQPRYNQMLSQERAQSVAQYLALHGVAAQR-LAAEGRGQSQPIADNSTEAGRAQNRRV 212

Query: 179 EI----QIFPRG 186
           EI     + PRG
Sbjct: 213 EIYLRATLQPRG 224


>gi|153006608|ref|YP_001380933.1| OmpA/MotB domain-containing protein [Anaeromyxobacter sp. Fw109-5]
 gi|152030181|gb|ABS27949.1| OmpA/MotB domain protein [Anaeromyxobacter sp. Fw109-5]
          Length = 440

 Score = 76.6 bits (187), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 59/105 (56%), Gaps = 2/105 (1%)

Query: 78  VHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVI 137
           VH +      L   F P+L  +  +L  FP+  I+I+ HTDS+G    N+ +SQ+RA+ +
Sbjct: 334 VHFATAKFRVLPDSF-PLLNQVVQVLRDFPNMQISIEGHTDSVGGEALNMRLSQQRAEAV 392

Query: 138 KSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
             YLI +GVS  R  ++ GF    PI +N T  GR  N+R E +I
Sbjct: 393 LDYLISKGVSPERLEAI-GFGPTKPIASNKTASGRARNRRTEFRI 436


>gi|254181403|ref|ZP_04888000.1| ompA family protein [Burkholderia pseudomallei 1655]
 gi|184211941|gb|EDU08984.1| ompA family protein [Burkholderia pseudomallei 1655]
          Length = 215

 Score = 76.6 bits (187), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 43/124 (34%), Positives = 69/124 (55%), Gaps = 3/124 (2%)

Query: 59  QDTGIVVSRIGD-MITCYIPVHVSFVSEVF-LEKKFLPMLQLIATILNKFPSTVIAIQSH 116
           Q TG  V+   D  +   +P  V+F ++ + +   F  +L  +AT LN+ P    ++  +
Sbjct: 84  QQTGTQVTEQPDGSLKLNVPSSVTFATDQYAITPAFTLLLNDLATTLNQNPQITASVVGY 143

Query: 117 TDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQ 176
           TDS G+  +N  +SQ RA  + + L QRGV++NR +S +G     PI  N T+ GR  N+
Sbjct: 144 TDSTGSAAHNQTLSQNRAQSVVNALAQRGVAANR-LSAQGMGASNPIADNATEAGRAQNR 202

Query: 177 RIEI 180
           R+EI
Sbjct: 203 RVEI 206


>gi|149277257|ref|ZP_01883399.1| lipoprotein PG3 [Pedobacter sp. BAL39]
 gi|149232134|gb|EDM37511.1| lipoprotein PG3 [Pedobacter sp. BAL39]
          Length = 226

 Score = 76.6 bits (187), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 47/148 (31%), Positives = 78/148 (52%), Gaps = 4/148 (2%)

Query: 44  GSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATI 102
           G  +DK   E Q  + +  ++  R G+ I       + F   +  L  +    ++ +A  
Sbjct: 75  GKRMDKQAAEIQNAIPNAEVI--REGEGIIVKFDSGILFGFDKADLTAQAKTNVKSLAGS 132

Query: 103 LNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYP 162
           LN++P T I +  HTD+ GT   N+ +S+ RA  +K+Y + +GV S+R I+V G  +  P
Sbjct: 133 LNQYPGTDIKVIGHTDNKGTETYNMGLSERRAAAVKAYAVSQGVPSSRLITV-GKGFSEP 191

Query: 163 IDTNDTKVGRQNNQRIEIQIFPRGNIKK 190
           ID N T+ GR  N+R+E+ I     +KK
Sbjct: 192 IDDNSTEAGRAANRRVEVVIVANDQLKK 219


>gi|110597916|ref|ZP_01386198.1| OmpA/MotB:Rickettsia 17 kDa surface antigen [Chlorobium
           ferrooxidans DSM 13031]
 gi|110340493|gb|EAT58979.1| OmpA/MotB:Rickettsia 17 kDa surface antigen [Chlorobium
           ferrooxidans DSM 13031]
          Length = 229

 Score = 76.3 bits (186), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 45/149 (30%), Positives = 78/149 (52%), Gaps = 4/149 (2%)

Query: 43  FGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFL-PMLQLIAT 101
            G+ +DK   E + ++   G+ V R G+ I   +   + F S            ++ +A 
Sbjct: 75  IGNYMDKQAAEIRNEV--NGVQVEREGEGIRVTMDSGILFTSGSSTLTSTSRANIEKLAR 132

Query: 102 ILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKY 161
           I N++  T + I+ HTD+ G+  +N L+S+ RA+ +   L   GVS  R   V G+    
Sbjct: 133 IFNRYNDTKVVIEGHTDNTGSAASNQLLSERRAESVAKLLSAYGVSDRRLSPV-GYGQSR 191

Query: 162 PIDTNDTKVGRQNNQRIEIQIFPRGNIKK 190
           P+ +NDT+ GRQNN+R+E+ I+    +K+
Sbjct: 192 PVASNDTEYGRQNNRRVEVLIYANEELKQ 220


>gi|206560984|ref|YP_002231749.1| putative OmpA family membrane protein [Burkholderia cenocepacia
           J2315]
 gi|198037026|emb|CAR52947.1| putative OmpA family membrane protein [Burkholderia cenocepacia
           J2315]
          Length = 215

 Score = 76.3 bits (186), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 39/106 (36%), Positives = 61/106 (57%), Gaps = 2/106 (1%)

Query: 76  IPVHVSFVSEVF-LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERA 134
           +P  V+F +  + +   F P+L  +AT LN+ P    +I  +TDS G+ + N  +SQ RA
Sbjct: 102 VPSSVTFATNQYAITPAFTPLLNDLATTLNQNPQVTASIVGYTDSTGSAQLNQTLSQNRA 161

Query: 135 DVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEI 180
             + + L+QRGV+  R +S +G     PI  N T+ GR  N+R+EI
Sbjct: 162 QSVVNALVQRGVNGGR-LSAQGMGASNPIADNATEAGRAQNRRVEI 206


>gi|157373855|ref|YP_001472455.1| OmpA/MotB domain-containing protein [Shewanella sediminis HAW-EB3]
 gi|157316229|gb|ABV35327.1| OmpA/MotB domain protein [Shewanella sediminis HAW-EB3]
          Length = 226

 Score = 76.3 bits (186), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 47/139 (33%), Positives = 72/139 (51%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D  E E + QLQ TG+ V+R GD I   +P  V+F V +  L      +L  +A +  +
Sbjct: 85  MDTQEAELRKQLQSTGVSVTRSGDNIVLNMPNEVTFGVDQTDLSSGAKRVLNSVALVAKE 144

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +  T + +  +TDS G    NL +S+ RA  + +YL+ + +   R  S  G     PI T
Sbjct: 145 YDQTQLNVLGYTDSSGAESYNLRLSKIRAIEVGNYLVAQKIEYGRVKS-EGLGESRPIAT 203

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T  GR  N+R+EI + P
Sbjct: 204 NATAEGRAQNRRVEIVLSP 222


>gi|222869877|gb|EEF07008.1| predicted protein [Populus trichocarpa]
          Length = 219

 Score = 76.3 bits (186), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 46/140 (32%), Positives = 74/140 (52%), Gaps = 3/140 (2%)

Query: 43  FGSSLDKAEDEFQMQLQDTGIVVSRIGD-MITCYIPVHVSF-VSEVFLEKKFLPMLQLIA 100
           +  +++K + E +   Q TG+ VS+  D  +   IP  +SF  +   ++  F P+L   A
Sbjct: 48  WSQNMEKQKREMEQATQGTGVNVSQTADNQLKLDIPSDISFDTNRSDIKGNFAPILDRFA 107

Query: 101 TILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYK 160
             L   P+  + I  HTDS G+   N  +S +RA+  ++YL  RGVS  R I+  G    
Sbjct: 108 EGLRNNPNAEVRIIGHTDSTGSDAINNPLSLDRANSTRNYLTMRGVSGAR-IATEGRGSH 166

Query: 161 YPIDTNDTKVGRQNNQRIEI 180
            P+ +ND+  GR  N+R+EI
Sbjct: 167 QPVASNDSASGRAMNRRVEI 186


>gi|313203319|ref|YP_004041976.1| ompa/motb domain protein [Paludibacter propionicigenes WB4]
 gi|312442635|gb|ADQ78991.1| OmpA/MotB domain protein [Paludibacter propionicigenes WB4]
          Length = 817

 Score = 76.3 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 34/95 (35%), Positives = 60/95 (63%), Gaps = 1/95 (1%)

Query: 88  LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVS 147
           ++ K  P+L  IA ++   P+ +I ++ HTD++G  K N ++SQ+RA+ ++ YLI +G+ 
Sbjct: 716 IKPKSYPILNQIAAVMTANPTYLIEVRGHTDNVGDAKLNQVLSQKRAESVRKYLIGKGID 775

Query: 148 SNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           S R ++  G+    P+ TN T  GR  N+R+E +I
Sbjct: 776 SKR-MTANGYGDTLPVSTNSTPAGRTLNRRVEFEI 809


>gi|224369820|ref|YP_002603984.1| OmpA2 [Desulfobacterium autotrophicum HRM2]
 gi|223692537|gb|ACN15820.1| OmpA2 [Desulfobacterium autotrophicum HRM2]
          Length = 503

 Score = 76.3 bits (186), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 55/85 (64%), Gaps = 1/85 (1%)

Query: 96  LQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVR 155
           L  +A IL K P+  I +Q HTD+IG+   N+ +S +R+  +K+YL+ +GV S R +   
Sbjct: 416 LDNVAMILKKNPALKIDLQGHTDNIGSKNFNMKLSLKRSAAVKTYLVSKGVPSER-LKTE 474

Query: 156 GFAYKYPIDTNDTKVGRQNNQRIEI 180
           GF +  P+DTN TK GR  N+R+E+
Sbjct: 475 GFGFSRPVDTNKTKEGRAKNRRVEL 499


>gi|315225274|ref|ZP_07867091.1| OmpA domain protein [Capnocytophaga ochracea F0287]
 gi|314944957|gb|EFS96989.1| OmpA domain protein [Capnocytophaga ochracea F0287]
          Length = 360

 Score = 76.3 bits (186), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 36/88 (40%), Positives = 59/88 (67%), Gaps = 1/88 (1%)

Query: 95  MLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISV 154
           +L  IA I+N+ P     ++ HTD+ GT ++NL +SQ+RAD IK YL + GVS  R +  
Sbjct: 269 ILDNIAIIMNENPDFNFVVEGHTDNTGTPEHNLKLSQDRADAIKQYLSRHGVSKKR-LDA 327

Query: 155 RGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           +G+    PI++N+T+ G++ N+R+EI +
Sbjct: 328 KGYGQTRPIESNETERGKEINRRVEINV 355


>gi|330817987|ref|YP_004361692.1| OmpA family protein [Burkholderia gladioli BSR3]
 gi|327370380|gb|AEA61736.1| OmpA family protein [Burkholderia gladioli BSR3]
          Length = 216

 Score = 76.3 bits (186), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 68/124 (54%), Gaps = 3/124 (2%)

Query: 59  QDTGIVVSRIGD-MITCYIPVHVSFVSEVF-LEKKFLPMLQLIATILNKFPSTVIAIQSH 116
           Q TG  V+   D  +   +P  V+F ++ + +   F P+L  +A+ LN+ P    ++  +
Sbjct: 84  QKTGTQVTEQPDGSLKLNVPSSVTFATDQYAITPAFAPLLNDLASTLNQNPQITASVVGY 143

Query: 117 TDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQ 176
           TDS G+  +N  +SQ RA  + + L+QRGV+  R +  +G     P+  N T+ GR  N+
Sbjct: 144 TDSTGSAAHNQTLSQNRAQSVVTALVQRGVAGGR-LGAQGMGASNPVADNATEAGRAQNR 202

Query: 177 RIEI 180
           R+EI
Sbjct: 203 RVEI 206


>gi|260552490|ref|ZP_05825866.1| inner membrane lipoprotein yiaD [Acinetobacter sp. RUH2624]
 gi|260405297|gb|EEW98793.1| inner membrane lipoprotein yiaD [Acinetobacter sp. RUH2624]
          Length = 217

 Score = 76.3 bits (186), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 45/141 (31%), Positives = 76/141 (53%), Gaps = 3/141 (2%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGD-MITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILN 104
           LD+ E + + Q+  TG+ V R  D  +   +P  ++F  ++  ++  F   L  +A  L 
Sbjct: 77  LDQKEKKLREQMAGTGVEVGRNPDGSVQLIMPGSITFDTNKSNIKPNFYATLDKVAQTLA 136

Query: 105 KFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPID 164
           +   + I +  +TD+ G    N+ +SQ RA  +K YL  +GVSS+R I  +G+    PI 
Sbjct: 137 EDNKSAILVTGYTDNTGNDSINIPLSQARAQSVKIYLAGKGVSSSR-IDAQGYGSSNPIA 195

Query: 165 TNDTKVGRQNNQRIEIQIFPR 185
            N T  GR+ N+R+EI I+ +
Sbjct: 196 DNSTASGREQNRRVEISIYAK 216


>gi|256819872|ref|YP_003141151.1| OmpA/MotB domain-containing protein [Capnocytophaga ochracea DSM
           7271]
 gi|256581455|gb|ACU92590.1| OmpA/MotB domain protein [Capnocytophaga ochracea DSM 7271]
          Length = 360

 Score = 76.3 bits (186), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 36/88 (40%), Positives = 59/88 (67%), Gaps = 1/88 (1%)

Query: 95  MLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISV 154
           +L  IA I+N+ P     ++ HTD+ GT ++NL +SQ+RAD IK YL + GVS  R +  
Sbjct: 269 ILDNIAIIMNENPDFNFVVEGHTDNTGTPEHNLKLSQDRADAIKQYLSRHGVSKKR-LDA 327

Query: 155 RGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           +G+    PI++N+T+ G++ N+R+EI +
Sbjct: 328 KGYGQTRPIESNETERGKEINRRVEINV 355


>gi|300113742|ref|YP_003760317.1| OmpA/MotB domain-containing protein [Nitrosococcus watsonii C-113]
 gi|299539679|gb|ADJ27996.1| OmpA/MotB domain protein [Nitrosococcus watsonii C-113]
          Length = 286

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 53/92 (57%), Gaps = 1/92 (1%)

Query: 99  IATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFA 158
           + T L ++P   + I+ HTDS G+   N+ +SQ RAD +  +L+  G+S  R I+  G+ 
Sbjct: 190 LVTFLKEYPDRQVVIEGHTDSTGSGVYNMELSQRRADAVYEFLVNNGISPAR-IAAHGYG 248

Query: 159 YKYPIDTNDTKVGRQNNQRIEIQIFPRGNIKK 190
             YP+  N+T  GRQ N+R+EI I   G   K
Sbjct: 249 KAYPVAPNNTAAGRQKNRRVEIVILDAGKKAK 280


>gi|254492090|ref|ZP_05105265.1| hypothetical protein MDMS009_2433 [Methylophaga thiooxidans DMS010]
 gi|224462642|gb|EEF78916.1| hypothetical protein MDMS009_2433 [Methylophaga thiooxydans DMS010]
          Length = 224

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 58/97 (59%), Gaps = 1/97 (1%)

Query: 88  LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVS 147
           L+  F P L  +A +L ++P+T+I +  HTDS+G+   N  +S+ RA  +  Y   RGV+
Sbjct: 116 LKSAFTPTLSKVADVLQRYPNTIIHVVGHTDSVGSESYNQRLSERRAQSVVDYFSSRGVA 175

Query: 148 SNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           + R  ++ G     P  TN+T+ GRQ N+R+EI + P
Sbjct: 176 TGRLYAI-GRGETEPRATNETEAGRQLNRRVEIFVKP 211


>gi|160896293|ref|YP_001561875.1| OmpA/MotB domain-containing protein [Delftia acidovorans SPH-1]
 gi|160361877|gb|ABX33490.1| OmpA/MotB domain protein [Delftia acidovorans SPH-1]
          Length = 244

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 46/140 (32%), Positives = 74/140 (52%), Gaps = 3/140 (2%)

Query: 43  FGSSLDKAEDEFQMQLQDTGIVVSRIGD-MITCYIPVHVSF-VSEVFLEKKFLPMLQLIA 100
           +  +++K + E +   Q TG+ VS+  D  +   IP  +SF  +   ++  F P+L   A
Sbjct: 70  WSQNMEKQKREMEQATQGTGVNVSQTADNQLKLDIPSDISFDTNRSDIKGNFAPILDRFA 129

Query: 101 TILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYK 160
             L   P+  + I  HTDS G+   N  +S +RA+  ++YL  RGVS  R I+  G    
Sbjct: 130 EGLRNNPNAEVRIIGHTDSTGSDAINNPLSLDRANSTRNYLTMRGVSGAR-IATEGRGSH 188

Query: 161 YPIDTNDTKVGRQNNQRIEI 180
            P+ +ND+  GR  N+R+EI
Sbjct: 189 QPVASNDSASGRAMNRRVEI 208


>gi|170703075|ref|ZP_02893898.1| OmpA/MotB domain protein [Burkholderia ambifaria IOP40-10]
 gi|170132016|gb|EDT00521.1| OmpA/MotB domain protein [Burkholderia ambifaria IOP40-10]
          Length = 215

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 38/106 (35%), Positives = 61/106 (57%), Gaps = 2/106 (1%)

Query: 76  IPVHVSFVSEVF-LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERA 134
           +P  V+F +  + +   F P+L  +AT LN+ P    ++  +TDS G+ + N  +SQ RA
Sbjct: 102 VPSSVTFATNQYAITPAFTPLLNDLATTLNQNPQLTASVVGYTDSTGSAQLNQTLSQNRA 161

Query: 135 DVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEI 180
             + + L+QRGV+  R +S +G     PI  N T+ GR  N+R+EI
Sbjct: 162 QSVVNALVQRGVAGGR-LSAQGMGASNPIADNATEAGRAQNRRVEI 206


>gi|167561951|ref|ZP_02354867.1| ompA family protein [Burkholderia oklahomensis EO147]
 gi|167569201|ref|ZP_02362075.1| ompA family protein [Burkholderia oklahomensis C6786]
          Length = 215

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 41/124 (33%), Positives = 70/124 (56%), Gaps = 3/124 (2%)

Query: 59  QDTGIVVSRIGD-MITCYIPVHVSFVSEVF-LEKKFLPMLQLIATILNKFPSTVIAIQSH 116
           Q TG  V+   D  +   +P  V+F ++ + +   F P+L  +A+ LN+ P    ++  +
Sbjct: 84  QQTGTQVTEQPDGSLKLNVPSSVTFATDQYAVTPAFTPLLNDLASTLNQNPQITASVVGY 143

Query: 117 TDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQ 176
           TDS G+  +N  +SQ RA  + + + QRGV+++R +S +G     PI  N T+ GR  N+
Sbjct: 144 TDSTGSAAHNQTLSQNRAQSVVNAMSQRGVAASR-LSAQGMGASNPIADNATEAGRAQNR 202

Query: 177 RIEI 180
           R+EI
Sbjct: 203 RVEI 206


>gi|56698398|ref|YP_168771.1| OmpA domain-containing protein [Ruegeria pomeroyi DSS-3]
 gi|56680135|gb|AAV96801.1| OmpA domain protein [Ruegeria pomeroyi DSS-3]
          Length = 221

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 45/142 (31%), Positives = 74/142 (52%), Gaps = 2/142 (1%)

Query: 45  SSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFL-PMLQLIATIL 103
           +SLDK   E + +L + GI ++  GD +   +P  ++F ++    +  L   LQ +A  L
Sbjct: 80  NSLDKQAAELRQELANDGITITNTGDRLIVSVPNDITFDTDSSTVRPGLRSDLQKVAAHL 139

Query: 104 NKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPI 163
            ++P + + +  HTDS G    N  +S+ RA  +   L   GV+ +R IS  G     PI
Sbjct: 140 VRYPQSSVQVIGHTDSDGEAAYNQGLSERRAGAVADILQAGGVTYDR-ISTLGMGENSPI 198

Query: 164 DTNDTKVGRQNNQRIEIQIFPR 185
            +N T  G+  N+R+EI + PR
Sbjct: 199 ASNLTPEGKARNRRVEIVVIPR 220


>gi|187929665|ref|YP_001900152.1| OmpA/MotB domain-containing protein [Ralstonia pickettii 12J]
 gi|309781567|ref|ZP_07676302.1| inner membrane lipoprotein YiaD [Ralstonia sp. 5_7_47FAA]
 gi|187726555|gb|ACD27720.1| OmpA/MotB domain protein [Ralstonia pickettii 12J]
 gi|308919672|gb|EFP65334.1| inner membrane lipoprotein YiaD [Ralstonia sp. 5_7_47FAA]
          Length = 209

 Score = 75.9 bits (185), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 45/126 (35%), Positives = 64/126 (50%), Gaps = 3/126 (2%)

Query: 61  TGIVVSRIGD-MITCYIPVHVSFVSE-VFLEKKFLPMLQLIATILNKFPSTVIAIQSHTD 118
           TG  +S   D  +   IP  VSF ++   ++  F   L  +A  L + P     +  HTD
Sbjct: 82  TGTQISEQPDGSLKLNIPSQVSFDTDSAVIKPSFRGPLDSVAQTLTQHPELAANVVGHTD 141

Query: 119 SIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRI 178
           S G    NL +SQ+RA  + SYL  RGV+ NR +S  G     P+  N T+ GR  N+R+
Sbjct: 142 STGNPNYNLTLSQKRAQSVASYLTDRGVARNR-LSAEGRGQNQPVADNATEAGRAQNRRV 200

Query: 179 EIQIFP 184
           EI + P
Sbjct: 201 EIYLKP 206


>gi|169634041|ref|YP_001707777.1| putative outer membrane protein [Acinetobacter baumannii SDF]
 gi|169152833|emb|CAP01862.1| putative outer membrane protein [Acinetobacter baumannii]
          Length = 217

 Score = 75.9 bits (185), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 44/141 (31%), Positives = 76/141 (53%), Gaps = 3/141 (2%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGD-MITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILN 104
           LD+ E + + Q+  TG+ V R  D  +   +P  ++F  ++  ++  F   L  +A  L 
Sbjct: 77  LDQKEKKLREQMAGTGVEVGRNPDGSVQLIMPGSITFDTNKSNIKPNFYATLDKVAQTLA 136

Query: 105 KFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPID 164
           +   + I +  +TD+ G    N+ +SQ RA  +K+YL  +GV S+R I  +G+    PI 
Sbjct: 137 EDNKSAILVTGYTDNTGNDSINIPLSQARAQSVKNYLAGKGVPSSR-IDAQGYGSSNPIA 195

Query: 165 TNDTKVGRQNNQRIEIQIFPR 185
            N T  GR+ N+R+EI I+ +
Sbjct: 196 DNSTASGREQNRRVEISIYAK 216


>gi|126640934|ref|YP_001083918.1| putative outer membrane protein [Acinetobacter baumannii ATCC
           17978]
 gi|169796935|ref|YP_001714728.1| putative outer membrane protein [Acinetobacter baumannii AYE]
 gi|184157155|ref|YP_001845494.1| outer membrane protein, related peptidoglycan-associated
           (lipo)protein [Acinetobacter baumannii ACICU]
 gi|213156662|ref|YP_002318323.1| OmpA/MotB domain protein [Acinetobacter baumannii AB0057]
 gi|215484397|ref|YP_002326628.1| Inner membrane lipoprotein yiaD precursor [Acinetobacter baumannii
           AB307-0294]
 gi|239503181|ref|ZP_04662491.1| Inner membrane lipoprotein yiaD precursor [Acinetobacter baumannii
           AB900]
 gi|260555775|ref|ZP_05827995.1| type VI secretion system OmpA/MotB [Acinetobacter baumannii ATCC
           19606]
 gi|301347224|ref|ZP_07227965.1| Inner membrane lipoprotein yiaD precursor [Acinetobacter baumannii
           AB056]
 gi|301512729|ref|ZP_07237966.1| Inner membrane lipoprotein yiaD precursor [Acinetobacter baumannii
           AB058]
 gi|301597873|ref|ZP_07242881.1| Inner membrane lipoprotein yiaD precursor [Acinetobacter baumannii
           AB059]
 gi|332853740|ref|ZP_08434952.1| OmpA family protein [Acinetobacter baumannii 6013150]
 gi|332871140|ref|ZP_08439738.1| OmpA family protein [Acinetobacter baumannii 6013113]
 gi|332874156|ref|ZP_08442080.1| OmpA family protein [Acinetobacter baumannii 6014059]
 gi|126386818|gb|ABO11316.1| putative outer membrane protein [Acinetobacter baumannii ATCC
           17978]
 gi|169149862|emb|CAM87753.1| putative outer membrane protein [Acinetobacter baumannii AYE]
 gi|183208749|gb|ACC56147.1| Outer membrane protein, related peptidoglycan-associated
           (lipo)protein [Acinetobacter baumannii ACICU]
 gi|213055822|gb|ACJ40724.1| OmpA/MotB domain protein [Acinetobacter baumannii AB0057]
 gi|213988304|gb|ACJ58603.1| Inner membrane lipoprotein yiaD precursor [Acinetobacter baumannii
           AB307-0294]
 gi|260410686|gb|EEX03984.1| type VI secretion system OmpA/MotB [Acinetobacter baumannii ATCC
           19606]
 gi|322507052|gb|ADX02506.1| Putative outer membrane protein [Acinetobacter baumannii 1656-2]
 gi|323516919|gb|ADX91300.1| Outer membrane protein, related peptidoglycan-associated
           (lipo)protein [Acinetobacter baumannii TCDC-AB0715]
 gi|332728426|gb|EGJ59801.1| OmpA family protein [Acinetobacter baumannii 6013150]
 gi|332731726|gb|EGJ63007.1| OmpA family protein [Acinetobacter baumannii 6013113]
 gi|332737631|gb|EGJ68534.1| OmpA family protein [Acinetobacter baumannii 6014059]
          Length = 217

 Score = 75.9 bits (185), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 44/141 (31%), Positives = 76/141 (53%), Gaps = 3/141 (2%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGD-MITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILN 104
           LD+ E + + Q+  TG+ V R  D  +   +P  ++F  ++  ++  F   L  +A  L 
Sbjct: 77  LDQKEKKLREQMAGTGVEVGRNPDGSVQLIMPGSITFDTNKSNIKPNFYATLDKVAQTLA 136

Query: 105 KFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPID 164
           +   + I +  +TD+ G    N+ +SQ RA  +K+YL  +GV S+R I  +G+    PI 
Sbjct: 137 EDNKSAILVTGYTDNTGNDSINIPLSQARAQSVKNYLAGKGVPSSR-IDAQGYGSSNPIA 195

Query: 165 TNDTKVGRQNNQRIEIQIFPR 185
            N T  GR+ N+R+EI I+ +
Sbjct: 196 DNSTASGREQNRRVEISIYAK 216


>gi|262369124|ref|ZP_06062453.1| conserved hypothetical protein [Acinetobacter johnsonii SH046]
 gi|262316802|gb|EEY97840.1| conserved hypothetical protein [Acinetobacter johnsonii SH046]
          Length = 216

 Score = 75.9 bits (185), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 47/148 (31%), Positives = 79/148 (53%), Gaps = 3/148 (2%)

Query: 38  IVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGD-MITCYIPVHVSF-VSEVFLEKKFLPM 95
           +V    G  LD  E + + Q+  TG+ V+R  D  +   +P +++F  ++  ++  F   
Sbjct: 67  VVGGATGVYLDNKEKKLRQQMAGTGVEVNRNPDGSVGLIMPGNITFDTNKSNIKPNFYST 126

Query: 96  LQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVR 155
           L  +A  L +   + I +  +TDS G    N+ +SQ RA  + SYL  +GVS+ R I+ +
Sbjct: 127 LNKVAQTLTEDNKSGILVTGYTDSTGNDSINIPLSQARAQSVASYLASQGVSTTR-INAQ 185

Query: 156 GFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
           G     PI +N T  GR+ N+R+EI I+
Sbjct: 186 GQGSANPIASNATAEGREQNRRVEISIY 213


>gi|229588474|ref|YP_002870593.1| hypothetical protein PFLU0931 [Pseudomonas fluorescens SBW25]
 gi|229360340|emb|CAY47197.1| conserved hypothetical protein [Pseudomonas fluorescens SBW25]
          Length = 257

 Score = 75.5 bits (184), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 43/138 (31%), Positives = 72/138 (52%), Gaps = 2/138 (1%)

Query: 48  DKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEV-FLEKKFLPMLQLIATILNKF 106
           D+ E + +  + +TG+ V R GD I   +P +++F +    +   F   L  +A  L +F
Sbjct: 90  DQQEKKLRESMANTGVEVQRQGDQIKLIMPGNITFATNSDAISSSFYQPLNNLANSLKQF 149

Query: 107 PSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTN 166
               I I  +TDS G+ + N+ +SQ RA  + +YL  +GV+    +S RG     PI +N
Sbjct: 150 NQNTIQIVGYTDSTGSRQLNMDLSQRRAQSVANYLTSQGVNGAN-LSARGAGPDNPIASN 208

Query: 167 DTKVGRQNNQRIEIQIFP 184
               GR  N+R+E+ + P
Sbjct: 209 ADVNGRAQNRRVEVNLGP 226


>gi|330899613|gb|EGH31032.1| OmpA/MotB [Pseudomonas syringae pv. japonica str. M301072PT]
          Length = 133

 Score = 75.5 bits (184), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 42/128 (32%), Positives = 71/128 (55%), Gaps = 2/128 (1%)

Query: 58  LQDTGIVVSRIGDMITCYIPVHVSFVSEV-FLEKKFLPMLQLIATILNKFPSTVIAIQSH 116
           + +TG+ V R GD I   +P +++F ++   +   F   L  +A+ L +F    I I  +
Sbjct: 1   MANTGVEVQRQGDQIKLIMPGNITFATDSSAIASSFYSPLNNLASSLKQFNQNNIEIVGY 60

Query: 117 TDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQ 176
           TDS G+ ++N+ +SQ+RA  + +YL  +GV     +SVRG     PI +N    GR  N+
Sbjct: 61  TDSTGSRQHNMDLSQQRAQSVATYLTSQGVDQ-AHLSVRGAGPDQPIASNADVNGRAQNR 119

Query: 177 RIEIQIFP 184
           R+E+ + P
Sbjct: 120 RVEVNLKP 127


>gi|224367491|ref|YP_002601654.1| OmpA1 [Desulfobacterium autotrophicum HRM2]
 gi|223690207|gb|ACN13490.1| OmpA1 [Desulfobacterium autotrophicum HRM2]
          Length = 374

 Score = 75.5 bits (184), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 52/85 (61%), Gaps = 1/85 (1%)

Query: 96  LQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVR 155
           L  +  +L   P+  + IQ HTDSIGT K N  +S  RA  +K+YLI +G+  NR +S  
Sbjct: 286 LDKVVDVLKSRPALFVKIQGHTDSIGTRKYNDALSLRRAKAVKTYLINKGIDKNR-LSCE 344

Query: 156 GFAYKYPIDTNDTKVGRQNNQRIEI 180
           GFA+  P+ +N T  GR  N+R+E+
Sbjct: 345 GFAFSKPVASNKTAEGRAMNRRVEL 369


>gi|107023374|ref|YP_621701.1| OmpA/MotB [Burkholderia cenocepacia AU 1054]
 gi|116690456|ref|YP_836079.1| OmpA/MotB domain-containing protein [Burkholderia cenocepacia
           HI2424]
 gi|170733777|ref|YP_001765724.1| OmpA/MotB domain-containing protein [Burkholderia cenocepacia
           MC0-3]
 gi|254247501|ref|ZP_04940822.1| Outer membrane porin F [Burkholderia cenocepacia PC184]
 gi|105893563|gb|ABF76728.1| OmpA/MotB [Burkholderia cenocepacia AU 1054]
 gi|116648545|gb|ABK09186.1| OmpA/MotB domain protein [Burkholderia cenocepacia HI2424]
 gi|124872277|gb|EAY63993.1| Outer membrane porin F [Burkholderia cenocepacia PC184]
 gi|169817019|gb|ACA91602.1| OmpA/MotB domain protein [Burkholderia cenocepacia MC0-3]
          Length = 215

 Score = 75.5 bits (184), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 39/106 (36%), Positives = 61/106 (57%), Gaps = 2/106 (1%)

Query: 76  IPVHVSFVSEVF-LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERA 134
           +P  V+F +  + +   F P+L  +AT LN+ P    +I  +TDS G+ + N  +SQ RA
Sbjct: 102 VPSSVTFATNQYAITPAFTPLLNDLATTLNQNPQVTASIVGYTDSTGSQQLNQTLSQNRA 161

Query: 135 DVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEI 180
             + + L+QRGV+  R +S +G     PI  N T+ GR  N+R+EI
Sbjct: 162 QSVVNALVQRGVNGGR-LSAQGMGPSNPIADNATEAGRAQNRRVEI 206


>gi|312959042|ref|ZP_07773561.1| OmpA/MotB [Pseudomonas fluorescens WH6]
 gi|311286812|gb|EFQ65374.1| OmpA/MotB [Pseudomonas fluorescens WH6]
          Length = 256

 Score = 75.5 bits (184), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 43/138 (31%), Positives = 72/138 (52%), Gaps = 2/138 (1%)

Query: 48  DKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEV-FLEKKFLPMLQLIATILNKF 106
           D+ E + +  + +TG+ V R GD I   +P +++F +    +   F   L  +A  L +F
Sbjct: 89  DQQEKKLRESMANTGVEVQRQGDQIKLIMPGNITFATNSDAISSSFYQPLNNLANSLKQF 148

Query: 107 PSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTN 166
               I I  +TDS G+ + N+ +SQ RA  + +YL  +GV+    +S RG     PI +N
Sbjct: 149 NQNTIQIVGYTDSTGSRQLNMDLSQRRAQSVANYLTSQGVNGAN-LSARGAGPDNPIASN 207

Query: 167 DTKVGRQNNQRIEIQIFP 184
               GR  N+R+E+ + P
Sbjct: 208 ADVNGRAQNRRVEVNLGP 225


>gi|332293158|ref|YP_004431767.1| OmpA/MotB domain protein [Krokinobacter diaphorus 4H-3-7-5]
 gi|332171244|gb|AEE20499.1| OmpA/MotB domain protein [Krokinobacter diaphorus 4H-3-7-5]
          Length = 236

 Score = 75.1 bits (183), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 42/147 (28%), Positives = 78/147 (53%), Gaps = 6/147 (4%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVH--VSFVSEVF-LEKKFLPMLQLIATIL 103
           +DK   + + +L   G  V RI D I      +  V F +  + +      +L  ++ I+
Sbjct: 83  MDKQAQQIEQEL--PGATVERIDDGIVVTFDENSGVYFDTAKYNVNTASQTLLNKLSNIM 140

Query: 104 NKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPI 163
            ++  T + +  HTDS+G+  NN+ +SQ RA+ + +Y++  G+S+ RF +V  +    P 
Sbjct: 141 KEYNQTNVVVAGHTDSVGSDTNNMTLSQNRANAVTNYMVGTGLSAGRFTTVW-YGETQPA 199

Query: 164 DTNDTKVGRQNNQRIEIQIFPRGNIKK 190
            +NDT  GR  N+R+++ I P   +K+
Sbjct: 200 ASNDTAEGRAQNRRVQLAIVPNEEMKQ 226


>gi|295675817|ref|YP_003604341.1| OmpA/MotB domain protein [Burkholderia sp. CCGE1002]
 gi|295435660|gb|ADG14830.1| OmpA/MotB domain protein [Burkholderia sp. CCGE1002]
          Length = 217

 Score = 75.1 bits (183), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 44/139 (31%), Positives = 70/139 (50%), Gaps = 3/139 (2%)

Query: 44  GSSLDKAEDEFQMQLQDTGIVVSRIGD-MITCYIPVHVSF-VSEVFLEKKFLPMLQLIAT 101
           G + D   +      + TG  ++   D  +   IP  V+F  S   ++  F P+L  +A 
Sbjct: 69  GYNWDNIRNRMSGATKGTGTQITEQPDGSLKLNIPSSVTFDTSSYAIKPTFAPVLDQLAQ 128

Query: 102 ILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKY 161
            L + P  V ++  HTD+ G+L+ N  +S  RA  +  YL QRG++  R +S  G     
Sbjct: 129 TLQQNPEVVASVVGHTDNTGSLQYNQTLSVNRAQSVTGYLTQRGIAPQR-LSATGMGPNQ 187

Query: 162 PIDTNDTKVGRQNNQRIEI 180
           PI  N+T+ GR  N+R+EI
Sbjct: 188 PIADNNTEAGRAANRRVEI 206


>gi|298207224|ref|YP_003715403.1| Thrombospondin type 3 repeat:OmpA/MotB [Croceibacter atlanticus
           HTCC2559]
 gi|83849860|gb|EAP87728.1| Thrombospondin type 3 repeat:OmpA/MotB [Croceibacter atlanticus
           HTCC2559]
          Length = 478

 Score = 75.1 bits (183), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 57/87 (65%), Gaps = 1/87 (1%)

Query: 96  LQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVR 155
           LQ IA I++++P+    I+ HTDS G+   N  +S+ERA  +++YL  +GV++N+  S  
Sbjct: 388 LQNIADIMSEYPTAKFHIEGHTDSQGSEAYNEKLSRERAASVRTYLTTKGVAANKLTS-E 446

Query: 156 GFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           G+    PI TN T  GRQ N+R+EI++
Sbjct: 447 GYGELRPIATNKTAAGRQQNRRVEIKL 473


>gi|167625617|ref|YP_001675911.1| OmpA/MotB domain-containing protein [Shewanella halifaxensis
           HAW-EB4]
 gi|167355639|gb|ABZ78252.1| OmpA/MotB domain protein [Shewanella halifaxensis HAW-EB4]
          Length = 224

 Score = 75.1 bits (183), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 47/142 (33%), Positives = 73/142 (51%), Gaps = 2/142 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D  E E +  LQ +G+ V+R GD I   +P  V+F V +  L ++   +L  +  +  +
Sbjct: 83  MDVQEAELRKLLQSSGVSVTRSGDNIILNMPNDVTFGVDQTDLSQRAQQVLNSVVLVALE 142

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +  T + +  +TDS G    NL +SQ RA  + +YL    V + R  S  G     PI +
Sbjct: 143 YDETKLNVMGYTDSSGAESYNLRLSQVRASEVANYLTNHKVPAQRVAS-HGMGESKPIAS 201

Query: 166 NDTKVGRQNNQRIEIQIFPRGN 187
           N TK GR  N+R+EI + P  N
Sbjct: 202 NQTKQGRAENRRVEIILSPMPN 223


>gi|241663775|ref|YP_002982135.1| OmpA/MotB domain-containing protein [Ralstonia pickettii 12D]
 gi|240865802|gb|ACS63463.1| OmpA/MotB domain protein [Ralstonia pickettii 12D]
          Length = 209

 Score = 75.1 bits (183), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 44/126 (34%), Positives = 64/126 (50%), Gaps = 3/126 (2%)

Query: 61  TGIVVSRIGD-MITCYIPVHVSFVSE-VFLEKKFLPMLQLIATILNKFPSTVIAIQSHTD 118
           TG  +S   D  +   IP  VSF ++   ++  F   L  +A  L + P     +  HTD
Sbjct: 82  TGTQISEQPDGSLKLNIPSQVSFDTDSAVIKPSFRGPLDSVAQTLTQHPELAANVVGHTD 141

Query: 119 SIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRI 178
           S G    N+ +SQ+RA  + SYL  RGV+ NR +S  G     P+  N T+ GR  N+R+
Sbjct: 142 STGNPNYNMTLSQKRAQSVASYLTDRGVARNR-LSAEGRGQNQPVADNATEAGRAQNRRV 200

Query: 179 EIQIFP 184
           EI + P
Sbjct: 201 EIYLKP 206


>gi|308274998|emb|CBX31597.1| hypothetical protein N47_E51090 [uncultured Desulfobacterium sp.]
          Length = 315

 Score = 75.1 bits (183), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 45/133 (33%), Positives = 73/133 (54%), Gaps = 11/133 (8%)

Query: 49  KAE-DEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFP 107
           KAE D+ Q +  D GIV++ +GD++           ++  L+   +  +  +A  L K  
Sbjct: 183 KAEIDKLQAKQTDRGIVLT-LGDVLFAN--------NKANLQPGAMRTIDQLAEFLKKHA 233

Query: 108 STVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTND 167
             ++ I+ HTDS G+   NL +SQ RAD ++  L+ RG+   R  ++ G    YP+ +ND
Sbjct: 234 ERMVVIEGHTDSRGSDTYNLGLSQRRADAVRDALVARGIDQARIQTI-GKGEVYPVASND 292

Query: 168 TKVGRQNNQRIEI 180
           T  GRQ N+R+EI
Sbjct: 293 TSAGRQQNRRVEI 305


>gi|126724952|ref|ZP_01740795.1| OmpA family protein [Rhodobacterales bacterium HTCC2150]
 gi|126706116|gb|EBA05206.1| OmpA family protein [Rhodobacterales bacterium HTCC2150]
          Length = 218

 Score = 75.1 bits (183), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 45/142 (31%), Positives = 70/142 (49%), Gaps = 2/142 (1%)

Query: 46  SLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILN 104
           SLD+   + +  L +  + +   GD +   +P  + F V   F+       L  +A  LN
Sbjct: 78  SLDRQAADLEKSLDNDDVSIVNEGDRLVVTLPQDILFDVDSDFVSSSLRGDLYKVANNLN 137

Query: 105 KFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPID 164
            +P++ I I  HTD+ G+  +N  +S  RA  +   LI  GV++ R +S  G     P+ 
Sbjct: 138 SYPNSTIQIIGHTDNSGSAAHNQDLSARRAGSVSGILIDGGVAAGRVVSF-GRGEDQPVA 196

Query: 165 TNDTKVGRQNNQRIEIQIFPRG 186
           TN T  GR  N+R+EI I P G
Sbjct: 197 TNLTAEGRAENRRVEIIILPTG 218


>gi|258593360|emb|CBE69699.1| OmpA/MotB precursor [NC10 bacterium 'Dutch sediment']
          Length = 249

 Score = 75.1 bits (183), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 57/94 (60%), Gaps = 1/94 (1%)

Query: 88  LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVS 147
           L  + L +L  +A IL+K P   + I  HTDS+GT   N  +SQ RA+ +++YL   GV+
Sbjct: 154 LTTESLTILDGVAEILSKHPDLKVTIAGHTDSVGTADYNKKLSQRRAESVRNYLASHGVN 213

Query: 148 SNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQ 181
           + +  +V GF  + PI +ND   GR  N+R+E+Q
Sbjct: 214 AAKLTAV-GFGEEQPIASNDEAEGRTKNRRVELQ 246


>gi|149920362|ref|ZP_01908832.1| OmpA domain protein [Plesiocystis pacifica SIR-1]
 gi|149818804|gb|EDM78246.1| OmpA domain protein [Plesiocystis pacifica SIR-1]
          Length = 225

 Score = 75.1 bits (183), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 62/96 (64%), Gaps = 4/96 (4%)

Query: 88  LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLL---ISQERADVIKSYLIQR 144
           L +  LP+L+ +A +L  +P   + IQ+H D++   ++  +    +Q +A+ +  +LIQ+
Sbjct: 111 LARDSLPLLESVAAVLVAYPELELEIQAHEDTVTADQHRYMSARPTQRQAEAVADFLIQK 170

Query: 145 GVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEI 180
           GV++ R I  RG+    PIDTN+TK GR++N+R+++
Sbjct: 171 GVAAER-IQARGYGEDRPIDTNETKEGRRHNRRVDL 205


>gi|78067236|ref|YP_370005.1| OmpA/MotB family protein [Burkholderia sp. 383]
 gi|77967981|gb|ABB09361.1| OmpA/MotB family protein [Burkholderia sp. 383]
          Length = 214

 Score = 75.1 bits (183), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 39/106 (36%), Positives = 60/106 (56%), Gaps = 2/106 (1%)

Query: 76  IPVHVSFVSEVF-LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERA 134
           +P  V+F +  + +   F P+L  +AT LN+ P    +I  +TDS G+ + N  +SQ RA
Sbjct: 102 VPSSVTFATNQYAITPAFQPLLNDLATTLNQNPQVTASIVGYTDSTGSAQLNQTLSQNRA 161

Query: 135 DVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEI 180
             + + L QRGV+  R +S +G     PI  N T+ GR  N+R+EI
Sbjct: 162 QSVVNALAQRGVNGGR-LSAQGMGASNPIADNATEAGRAQNRRVEI 206


>gi|150025962|ref|YP_001296788.1| OmpA family outer membrane protein [Flavobacterium psychrophilum
           JIP02/86]
 gi|149772503|emb|CAL43986.1| Probable outer membrane protein, OmpA family [Flavobacterium
           psychrophilum JIP02/86]
          Length = 710

 Score = 75.1 bits (183), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 37/100 (37%), Positives = 62/100 (62%), Gaps = 1/100 (1%)

Query: 83  VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLI 142
           VS+   +++  P+LQ I  IL ++P    +I+ HTDS G    N  +S+ RA  + +YL+
Sbjct: 610 VSKSSFQQRTFPVLQSILAILKEYPVAKFSIEGHTDSDGKDTANQTLSETRAAAVMAYLV 669

Query: 143 QRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           + G+ ++R  S +GF    PI TN TKVG+  N+R+E+++
Sbjct: 670 KNGIDASRLAS-KGFGESKPIATNKTKVGKILNRRVEVKL 708


>gi|14331084|emb|CAC40971.1| hypothetical protein [Vibrio pommerensis]
          Length = 378

 Score = 74.7 bits (182), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 35/93 (37%), Positives = 53/93 (56%)

Query: 88  LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVS 147
           L    +  LQ +   L ++P TV+ I  HTDS G+   N  +S++RA  + +YLI +GV 
Sbjct: 270 LSPSLMLQLQPLLARLKQYPETVVEISGHTDSKGSDTLNQRLSEQRAQSVANYLISKGVD 329

Query: 148 SNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEI 180
             R   V G+    P+ +NDT+ GR  N+R+EI
Sbjct: 330 PERITRVVGYGESLPVASNDTESGRAQNRRVEI 362


>gi|319790576|ref|YP_004152209.1| OmpA/MotB domain protein [Thermovibrio ammonificans HB-1]
 gi|317115078|gb|ADU97568.1| OmpA/MotB domain protein [Thermovibrio ammonificans HB-1]
          Length = 251

 Score = 74.7 bits (182), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 39/91 (42%), Positives = 55/91 (60%), Gaps = 1/91 (1%)

Query: 96  LQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVR 155
           LQ IA  L + P T + +  +TD+ G+LK NL +S+ERA+ +K  L++ GV   R + V 
Sbjct: 154 LQRIAQTLKENPKTTVVVVGYTDNTGSLKYNLKLSKERAEAVKKVLVEAGVRPERIL-VF 212

Query: 156 GFAYKYPIDTNDTKVGRQNNQRIEIQIFPRG 186
           G   K PI  NDT   R  N+R+EI I+P G
Sbjct: 213 GCGPKNPIAPNDTPQHRALNRRVEILIYPEG 243


>gi|17547099|ref|NP_520501.1| hypothetical protein RSc2380 [Ralstonia solanacearum GMI1000]
 gi|17429400|emb|CAD16087.1| probable bacterial outer membrane transmembrane protein [Ralstonia
           solanacearum GMI1000]
          Length = 209

 Score = 74.7 bits (182), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 44/126 (34%), Positives = 64/126 (50%), Gaps = 3/126 (2%)

Query: 61  TGIVVSRIGD-MITCYIPVHVSFVSE-VFLEKKFLPMLQLIATILNKFPSTVIAIQSHTD 118
           TG  +S   D  +   IP  VSF ++   ++  F   L  +A  L++ P     +  HTD
Sbjct: 82  TGTQISEQPDGSLKLNIPSQVSFDTDSAVIKPSFRGPLDSVAETLSQHPELAANVVGHTD 141

Query: 119 SIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRI 178
           S G    N+ +SQ RA  + SYL  RGV+ NR +S  G     P+  N T+ GR  N+R+
Sbjct: 142 STGNPNYNMSLSQRRAQSVASYLTDRGVARNR-MSAEGRGQTQPVGDNATEAGRAQNRRV 200

Query: 179 EIQIFP 184
           EI + P
Sbjct: 201 EIYLKP 206


>gi|83746716|ref|ZP_00943765.1| Hypothetical Protein RRSL_03628 [Ralstonia solanacearum UW551]
 gi|207721381|ref|YP_002251822.1| bacterial outer membrane protein [Ralstonia solanacearum MolK2]
 gi|207742640|ref|YP_002259032.1| bacterial outer membrane protein [Ralstonia solanacearum IPO1609]
 gi|83726669|gb|EAP73798.1| Hypothetical Protein RRSL_03628 [Ralstonia solanacearum UW551]
 gi|206586540|emb|CAQ17127.1| bacterial outer membrane protein [Ralstonia solanacearum MolK2]
 gi|206594034|emb|CAQ60961.1| bacterial outer membrane protein [Ralstonia solanacearum IPO1609]
          Length = 209

 Score = 74.7 bits (182), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 64/126 (50%), Gaps = 3/126 (2%)

Query: 61  TGIVVSRIGD-MITCYIPVHVSFVSE-VFLEKKFLPMLQLIATILNKFPSTVIAIQSHTD 118
           TG  +S   D  +   IP  VSF ++   ++  F   L  +A  L + P    ++  HTD
Sbjct: 82  TGTQISEQPDGSLKLNIPSQVSFDTDSAMIKPSFRGPLDSVAETLTQHPELAASVVGHTD 141

Query: 119 SIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRI 178
           S G    N+ +SQ RA  + SYL  RGV+ NR ++  G     P+  N T+ GR  N+R+
Sbjct: 142 STGNPNYNMSLSQRRAQSVTSYLTDRGVARNR-LTAEGRGQTQPVGDNATEAGRAQNRRV 200

Query: 179 EIQIFP 184
           EI + P
Sbjct: 201 EIYLKP 206


>gi|103488577|ref|YP_618138.1| OmpA/MotB [Sphingopyxis alaskensis RB2256]
 gi|98978654|gb|ABF54805.1| OmpA/MotB [Sphingopyxis alaskensis RB2256]
          Length = 230

 Score = 74.7 bits (182), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 42/139 (30%), Positives = 71/139 (51%), Gaps = 1/139 (0%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D+ E + + +   TGI V R GD +   +P  V+F ++   ++ +F   L  +A  L +
Sbjct: 82  MDQQEKKLRERTAGTGIDVERQGDQLVLNMPGDVTFDLNSAMVKSQFRSALDNVAATLAE 141

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +PST I +  HTDS G+   N  +S+ RA  +  YL  RG+   R  ++     +     
Sbjct: 142 YPSTYIDVYGHTDSTGSETYNQGLSERRAASVADYLAGRGIQRARMATLGYGESQLKCAP 201

Query: 166 NDTKVGRQNNQRIEIQIFP 184
             T+   Q N+R+EI+I P
Sbjct: 202 ERTEADYQCNRRVEIRIAP 220


>gi|110638331|ref|YP_678540.1| outer membrane protein [Cytophaga hutchinsonii ATCC 33406]
 gi|110281012|gb|ABG59198.1| possible outer membrane protein [Cytophaga hutchinsonii ATCC 33406]
          Length = 424

 Score = 74.7 bits (182), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 45/130 (34%), Positives = 75/130 (57%), Gaps = 7/130 (5%)

Query: 55  QMQLQDTGIVVSRIGDMITCYIPVHVSFVS--EVFLEKKFLPMLQLIATILNKFPSTVIA 112
           +++ +D  +   + GD I      HV FV   + FL + +  + +L+AT +N+ P   I 
Sbjct: 297 EIKPKDESVFDVKKGDKIVL---KHVLFVQSKDDFLPESYAELDRLVAT-MNQHPQITIE 352

Query: 113 IQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGR 172
           +  HTD+ G    NL +S+ERA  +K YL+ RG+ + R I+V+G+    PI  NDT+  R
Sbjct: 353 VSGHTDNQGNRDLNLKLSEERAIKVKDYLVSRGIEAKR-INVKGYGPDKPISANDTEEHR 411

Query: 173 QNNQRIEIQI 182
           + N+R+E +I
Sbjct: 412 RLNRRVEFEI 421


>gi|108759406|ref|YP_634375.1| OmpA domain-containing protein [Myxococcus xanthus DK 1622]
 gi|108463286|gb|ABF88471.1| OmpA domain protein [Myxococcus xanthus DK 1622]
          Length = 538

 Score = 74.7 bits (182), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 58/102 (56%), Gaps = 2/102 (1%)

Query: 79  HVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVI 137
           HV F V +  L       L  IA  L   P   + I+ HTD+ G  + N  +SQ+RAD +
Sbjct: 430 HVQFPVGQSTLSDSERRNLDAIADYLKANPGVSLRIEGHTDNTGPEELNRTLSQDRADAV 489

Query: 138 KSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIE 179
           + YLIQ+G+ S+R ++ +G+    PI +NDT  GR  N+R+E
Sbjct: 490 RQYLIQQGIESSR-LTAKGYGPAQPIASNDTPEGRSANRRVE 530


>gi|255534904|ref|YP_003095275.1| OmpA/MotB domain protein [Flavobacteriaceae bacterium 3519-10]
 gi|255341100|gb|ACU07213.1| OmpA/MotB domain protein [Flavobacteriaceae bacterium 3519-10]
          Length = 230

 Score = 74.3 bits (181), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 51/143 (35%), Positives = 74/143 (51%), Gaps = 7/143 (4%)

Query: 43  FGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIP---VHVSFVSEVFLEKKFLPMLQLI 99
            G ++DK   E +  L   G  V R+G+ I   +    V+  F S   L       L  +
Sbjct: 78  IGRNMDKQAKEIKETLP--GAEVERVGEGIRVTMKENMVNFGFDSS-ELTSAAKTNLDKL 134

Query: 100 ATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAY 159
           A +L     T I I  HTDS GT   NL +S+ RA  ++SYLI +GV+S+R +++ G   
Sbjct: 135 AQVLKNNMDTNINIYGHTDSKGTDAYNLSLSERRAAAVRSYLISQGVASSRMLTM-GVGE 193

Query: 160 KYPIDTNDTKVGRQNNQRIEIQI 182
           K P+ +NDT  GR  N+R+E  I
Sbjct: 194 KEPVASNDTDAGRAENRRVEFAI 216


>gi|222053440|ref|YP_002535802.1| OmpA/MotB domain protein [Geobacter sp. FRC-32]
 gi|221562729|gb|ACM18701.1| OmpA/MotB domain protein [Geobacter sp. FRC-32]
          Length = 455

 Score = 74.3 bits (181), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 35/111 (31%), Positives = 72/111 (64%), Gaps = 3/111 (2%)

Query: 70  DMITCYIPVHVSFVS-EVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLL 128
           D+ T  + +++ FV+ +  ++ K+   ++ +A  + K+P+    I+ HTD++G+   N+ 
Sbjct: 334 DLETLSMSINIQFVTGKNDIQPKYAGEIKKVADYMQKYPTVKGVIEGHTDNVGSAAANMK 393

Query: 129 ISQERADVIKSYLIQR-GVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRI 178
           +SQ RA+ ++SYLI++ G++++R ++ +G+    PI  N T+ GRQ N+RI
Sbjct: 394 LSQRRAEAVRSYLIKKHGIAADR-LTAKGYGMTRPIADNGTEAGRQQNRRI 443


>gi|77164341|ref|YP_342866.1| OmpA/MotB [Nitrosococcus oceani ATCC 19707]
 gi|254434085|ref|ZP_05047593.1| Rickettsia 17 kDa surface antigen family [Nitrosococcus oceani
           AFC27]
 gi|76882655|gb|ABA57336.1| OmpA/MotB [Nitrosococcus oceani ATCC 19707]
 gi|207090418|gb|EDZ67689.1| Rickettsia 17 kDa surface antigen family [Nitrosococcus oceani
           AFC27]
          Length = 248

 Score = 74.3 bits (181), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 62/110 (56%), Gaps = 2/110 (1%)

Query: 76  IPVHVSFVSEV-FLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERA 134
           IP  +SF  +   L+  FLP L  IA +L K+  TV+ +  HTDS G+ K NL +S  RA
Sbjct: 115 IPSEISFDHDSDVLKPAFLPTLDKIAEVLKKYNKTVVHVIGHTDSTGSEKYNLDLSLRRA 174

Query: 135 DVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
             +  Y  ++GV S R +S+ G     P  +N T  GRQ N+R+EI + P
Sbjct: 175 GNVAVYFERKGVPSQR-LSIYGRGESEPRASNATAAGRQLNRRVEIILKP 223


>gi|300114861|ref|YP_003761436.1| OmpA/MotB domain-containing protein [Nitrosococcus watsonii C-113]
 gi|299540798|gb|ADJ29115.1| OmpA/MotB domain protein [Nitrosococcus watsonii C-113]
          Length = 249

 Score = 74.3 bits (181), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 74/137 (54%), Gaps = 8/137 (5%)

Query: 50  AEDEFQMQLQDTGIVVSRIGD-MITCYIPVHVSFVSEV-FLEKKFLPMLQLIATILNKFP 107
           AE+  + QL+     + R+ D  +   IP  VSF  +   L+  FLP L  IA +L K+ 
Sbjct: 99  AEERRRHQLE-----IQRLQDESLKLDIPSEVSFDHDSDALKPAFLPTLDKIADVLKKYN 153

Query: 108 STVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTND 167
            TV+ +  HTDS G  K NL +S  RA  +  YL ++G+ S R +S+ G     P  +N 
Sbjct: 154 KTVVHVIGHTDSTGAEKYNLDLSLRRAGNVALYLERQGIPSQR-LSIYGRGENEPRASNA 212

Query: 168 TKVGRQNNQRIEIQIFP 184
           T  GRQ N+R+EI + P
Sbjct: 213 TASGRQLNRRVEIILKP 229


>gi|256419485|ref|YP_003120138.1| OmpA/MotB domain protein [Chitinophaga pinensis DSM 2588]
 gi|256034393|gb|ACU57937.1| OmpA/MotB domain protein [Chitinophaga pinensis DSM 2588]
          Length = 225

 Score = 74.3 bits (181), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 46/155 (29%), Positives = 83/155 (53%), Gaps = 20/155 (12%)

Query: 44  GSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVF-------LEKKFLPML 96
           G  +DK   E + ++ +    V R+G+ I      +V+F S V        L  +    +
Sbjct: 73  GKKMDKQAQEIKTEVPNA--TVERVGEGI------NVTFASGVLFGFDKSDLTGQAQQNI 124

Query: 97  QLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRG 156
           + +ATILNK+P T + ++ HTD+ GT   N+ +S+ RA+ + +YL  +GV+++R   V+ 
Sbjct: 125 KDLATILNKYPDTYVRVEGHTDTTGTDSYNMGLSERRANAVATYLKSQGVAASR---VQT 181

Query: 157 FAY--KYPIDTNDTKVGRQNNQRIEIQIFPRGNIK 189
           F Y  + P+  N++   +  N+R+E  IF    +K
Sbjct: 182 FWYGARQPVVPNNSDANKAKNRRVEFSIFANEKMK 216


>gi|226940371|ref|YP_002795445.1| Outer membrane protein A [Laribacter hongkongensis HLHK9]
 gi|226715298|gb|ACO74436.1| Outer membrane protein A [Laribacter hongkongensis HLHK9]
          Length = 226

 Score = 74.3 bits (181), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 47/144 (32%), Positives = 76/144 (52%), Gaps = 7/144 (4%)

Query: 47  LDKAEDEFQMQL----QDTGI-VVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIA 100
           +D+   +FQ QL    +D  I VV R  + I   +    +F  +   L+  F+P +  I+
Sbjct: 80  MDRQARDFQRQLATQIRDGQIFVVKRADNSILVTMTSQTAFDTNSASLKPGFMPTINTIS 139

Query: 101 TILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYK 160
            I+N++  T + I  HTDS G  + N+ +SQ RA  +++ L+ R V   R +S  G    
Sbjct: 140 RIVNQYGKTTLDITGHTDSTGNDRINVPLSQNRAAAVQNALLSRNVHPQR-LSAYGMGAS 198

Query: 161 YPIDTNDTKVGRQNNQRIEIQIFP 184
            P  +N ++ GRQ N+R+EI I P
Sbjct: 199 QPRASNASEAGRQLNRRVEILIEP 222


>gi|163786812|ref|ZP_02181260.1| OmpA domain protein [Flavobacteriales bacterium ALC-1]
 gi|159878672|gb|EDP72728.1| OmpA domain protein [Flavobacteriales bacterium ALC-1]
          Length = 465

 Score = 74.3 bits (181), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 55/88 (62%), Gaps = 1/88 (1%)

Query: 95  MLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISV 154
           +LQ +  I  ++P    +I+ HTDS+G+   N  +S  RA+ ++ YLI  G+S++R ++ 
Sbjct: 377 VLQAMVAIFKEYPKADFSIEGHTDSVGSKSTNQALSDRRANAVRDYLIANGISADR-LTA 435

Query: 155 RGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
            G+    PI  N T+ GR+ N+R+E+++
Sbjct: 436 AGYGEDNPIANNKTRAGRKENRRVEVKL 463


>gi|167585789|ref|ZP_02378177.1| ompA family protein [Burkholderia ubonensis Bu]
          Length = 166

 Score = 74.3 bits (181), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 38/106 (35%), Positives = 59/106 (55%), Gaps = 2/106 (1%)

Query: 76  IPVHVSFVSEVF-LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERA 134
           +P  V+F +  + +   F P+L  +AT LN+ P    ++  +TDS G+   N  +SQ RA
Sbjct: 55  VPSSVTFATNQYAITPAFTPLLNDLATTLNQNPQVTASVVGYTDSTGSAGLNQTLSQNRA 114

Query: 135 DVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEI 180
             + + L QRGV+  R +S +G     PI  N T+ GR  N+R+EI
Sbjct: 115 QSVVNALTQRGVAGGR-LSAQGMGASNPIADNATEAGRAQNRRVEI 159


>gi|284040434|ref|YP_003390364.1| OmpA/MotB domain protein [Spirosoma linguale DSM 74]
 gi|283819727|gb|ADB41565.1| OmpA/MotB domain protein [Spirosoma linguale DSM 74]
          Length = 537

 Score = 73.9 bits (180), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 54/89 (60%), Gaps = 1/89 (1%)

Query: 94  PMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFIS 153
           P L  + T LN  P   I ++ HTD+ G+ + N  +SQ+RAD ++ Y I +G+  +R I+
Sbjct: 447 PELDRLVTTLNDAPKMTIEVRGHTDNTGSNEINAKLSQDRADAVREYFISKGIEPDR-IA 505

Query: 154 VRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
            +GF    P  +N+T+ GRQ N+R+E  I
Sbjct: 506 SKGFGEAKPTASNNTEEGRQQNRRVEFVI 534


>gi|213963523|ref|ZP_03391776.1| inner membrane lipoprotein YiaD [Capnocytophaga sputigena Capno]
 gi|213953803|gb|EEB65132.1| inner membrane lipoprotein YiaD [Capnocytophaga sputigena Capno]
          Length = 229

 Score = 73.9 bits (180), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 44/150 (29%), Positives = 77/150 (51%), Gaps = 7/150 (4%)

Query: 44  GSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV----SEVFLEKKFLPMLQLI 99
           G  +DK   + + ++   G  V R+ D I      +   V    ++  + +K    L  +
Sbjct: 74  GHQMDKQAKKIEEEI--PGADVKRVDDGIVVTFDENNGGVYFDTNKYNINEKSKQTLDKL 131

Query: 100 ATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAY 159
           A IL ++P T + +  HTDS+G  + NL +SQ RA  + +Y   +G++ +RF + + +  
Sbjct: 132 AAILKEYPDTNVLVAGHTDSVGKDEYNLGLSQRRAQAVTNYFKSKGLAGSRF-TTKWYGE 190

Query: 160 KYPIDTNDTKVGRQNNQRIEIQIFPRGNIK 189
           K PI +NDT  GR  N+R+ + I P   +K
Sbjct: 191 KNPIASNDTAEGRAKNRRVNVVIVPNEKMK 220


>gi|308449675|ref|XP_003088039.1| hypothetical protein CRE_17774 [Caenorhabditis remanei]
 gi|308250191|gb|EFO94143.1| hypothetical protein CRE_17774 [Caenorhabditis remanei]
          Length = 216

 Score = 73.9 bits (180), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 44/139 (31%), Positives = 76/139 (54%), Gaps = 4/139 (2%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGD-MITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILN 104
           LD  E + + Q+Q TG+ V+R  D  +   +P  ++F  ++  ++  F   L  +A  L 
Sbjct: 77  LDNKEKKLRQQMQGTGVEVNRNPDGSVALIMPGSITFDTNKSTIKPNFYGTLNKVAQTLM 136

Query: 105 KFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPID 164
           +   +VI +  +TD+ G    N+ +SQ RA  + +YL  +GV+S   I  +G+  + PI 
Sbjct: 137 EDNKSVILVTGYTDNTGNDSINIPLSQNRAYSVANYLKGKGVASR--IDTQGYGSQNPIA 194

Query: 165 TNDTKVGRQNNQRIEIQIF 183
            N T  GR+ N+R+EI I+
Sbjct: 195 DNSTAAGREQNRRVEISIY 213


>gi|255037862|ref|YP_003088483.1| OmpA/MotB domain-containing protein [Dyadobacter fermentans DSM
           18053]
 gi|254950618|gb|ACT95318.1| OmpA/MotB domain protein [Dyadobacter fermentans DSM 18053]
          Length = 525

 Score = 73.9 bits (180), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 59/96 (61%), Gaps = 1/96 (1%)

Query: 88  LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVS 147
           L ++  P L  IA  + +  +  I +  HTD+ G+ + N+ +SQERAD ++ YLI +G+ 
Sbjct: 429 LREESFPELNRIAISMTENKTLAIELGGHTDNTGSAEFNVNLSQERADTVREYLIGKGIE 488

Query: 148 SNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
            +R I+ +G+    P+ TNDT  G+Q N+R+E +I 
Sbjct: 489 PDR-IASKGYGETKPVATNDTPEGQQQNRRVEFKIL 523


>gi|152995997|ref|YP_001340832.1| OmpA/MotB domain-containing protein [Marinomonas sp. MWYL1]
 gi|150836921|gb|ABR70897.1| OmpA/MotB domain protein [Marinomonas sp. MWYL1]
          Length = 311

 Score = 73.9 bits (180), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 45/131 (34%), Positives = 76/131 (58%), Gaps = 5/131 (3%)

Query: 53  EFQMQLQDTGIVVSRIGDMITCYIPVHVSFVS-EVFLEKKFLPMLQLIATILNKFPSTVI 111
           EFQ QL   G++ ++  +         +SF + +  L+   L  L  +   LNK+    I
Sbjct: 153 EFQRQL---GMLNAKATNRGMIMTLGDLSFATGKAKLQPSVLIDLDKLVVFLNKYADRSI 209

Query: 112 AIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVG 171
            I+ +TDS+G+   NL +SQ RA  ++ YL+ +G++S R ++V       P+DTND+K+G
Sbjct: 210 VIEGNTDSVGSEALNLRLSQHRASAVRDYLVGKGINSAR-LTVVANGEGNPLDTNDSKLG 268

Query: 172 RQNNQRIEIQI 182
           RQ+N+R++I I
Sbjct: 269 RQHNRRVDIVI 279


>gi|310817527|ref|YP_003949885.1| OmpA domain-containing protein [Stigmatella aurantiaca DW4/3-1]
 gi|309390599|gb|ADO68058.1| OmpA domain protein [Stigmatella aurantiaca DW4/3-1]
          Length = 1779

 Score = 73.9 bits (180), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 51/152 (33%), Positives = 85/152 (55%), Gaps = 15/152 (9%)

Query: 34   NDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRI-GDMITCYIPVHVSFVSEVFLEKKF 92
            N+ +++N R        EDE      D G V  R+ G  I     V+ +   ++ L++ F
Sbjct: 1634 NEPEVINGR--------EDE--DGCPDQGEVNVRVEGKKILILQKVYFATNKDIILDRSF 1683

Query: 93   LPMLQLIATILNKFPS-TVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQR-GVSSNR 150
              +L+ +A +L   P  T I ++ HTDS G+   NL +S  RA  +++YLI++ G++++R
Sbjct: 1684 -SLLKQVAAVLRANPQLTKIRVEGHTDSQGSDAFNLDLSDRRAKSVRTYLIEKEGIAADR 1742

Query: 151  FISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
              +V G+    P+DTNDT  GR+NN+R+E  I
Sbjct: 1743 LEAV-GYGETKPVDTNDTVAGRENNRRVEFII 1773


>gi|115379068|ref|ZP_01466194.1| hypothetical protein STIAU_2752 [Stigmatella aurantiaca DW4/3-1]
 gi|115363928|gb|EAU63037.1| hypothetical protein STIAU_2752 [Stigmatella aurantiaca DW4/3-1]
          Length = 831

 Score = 73.9 bits (180), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 51/152 (33%), Positives = 85/152 (55%), Gaps = 15/152 (9%)

Query: 34  NDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRI-GDMITCYIPVHVSFVSEVFLEKKF 92
           N+ +++N R        EDE      D G V  R+ G  I     V+ +   ++ L++ F
Sbjct: 686 NEPEVINGR--------EDE--DGCPDQGEVNVRVEGKKILILQKVYFATNKDIILDRSF 735

Query: 93  LPMLQLIATILNKFPS-TVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQR-GVSSNR 150
             +L+ +A +L   P  T I ++ HTDS G+   NL +S  RA  +++YLI++ G++++R
Sbjct: 736 -SLLKQVAAVLRANPQLTKIRVEGHTDSQGSDAFNLDLSDRRAKSVRTYLIEKEGIAADR 794

Query: 151 FISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
             +V G+    P+DTNDT  GR+NN+R+E  I
Sbjct: 795 LEAV-GYGETKPVDTNDTVAGRENNRRVEFII 825


>gi|84685261|ref|ZP_01013160.1| OmpA family protein [Maritimibacter alkaliphilus HTCC2654]
 gi|84666993|gb|EAQ13464.1| OmpA family protein [Rhodobacterales bacterium HTCC2654]
          Length = 225

 Score = 73.9 bits (180), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 43/144 (29%), Positives = 72/144 (50%), Gaps = 2/144 (1%)

Query: 44  GSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSE-VFLEKKFLPMLQLIATI 102
           G+ LDK   + +  L ++ I V   G  +   +P  + F ++   +     P L+ +A  
Sbjct: 83  GNQLDKQAGDLRSSLSNSSIQVINTGSYLKVVMPQGILFPTDSADVSPALYPDLRALAEN 142

Query: 103 LNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYP 162
           L ++P++ + +  HTD+ G    NL +SQ RA  +   +   GV + R  +V G     P
Sbjct: 143 LREYPNSSVQVVGHTDNTGQASYNLTLSQRRAQAVLGVIQSNGVGAARLQAV-GKGDSEP 201

Query: 163 IDTNDTKVGRQNNQRIEIQIFPRG 186
           + TN T  GR  N+R+E+ I PRG
Sbjct: 202 VATNLTPEGRAQNRRVEVLIIPRG 225


>gi|119897129|ref|YP_932342.1| outer membrane protein [Azoarcus sp. BH72]
 gi|119669542|emb|CAL93455.1| conserved hypothetical outer membrane protein [Azoarcus sp. BH72]
          Length = 224

 Score = 73.9 bits (180), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 45/130 (34%), Positives = 69/130 (53%), Gaps = 3/130 (2%)

Query: 53  EFQMQLQDTGIVVSRIGD-MITCYIPVHVSFVSEVF-LEKKFLPMLQLIATILNKFPSTV 110
           E +     TG+ VS+  D  +   IP  VSF +  + ++ +  P+L   A  LN+   T 
Sbjct: 87  EMERATAGTGVSVSQTADNRLKLDIPSDVSFDTGRYDIKPEMRPVLDRFANTLNQHTVTT 146

Query: 111 IAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKV 170
           ++I  HTDS G+   N  +S  RA   + YL+ RGV+ +R I++ G   + PI  N T  
Sbjct: 147 VSIIGHTDSTGSDAVNNPLSVNRAAATRDYLVARGVAGSR-IAIDGRGAREPIADNGTVA 205

Query: 171 GRQNNQRIEI 180
           GR  N+R+EI
Sbjct: 206 GRAQNRRVEI 215


>gi|294678012|ref|YP_003578627.1| OmpA family protein [Rhodobacter capsulatus SB 1003]
 gi|294476832|gb|ADE86220.1| OmpA family protein [Rhodobacter capsulatus SB 1003]
          Length = 224

 Score = 73.9 bits (180), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 44/148 (29%), Positives = 72/148 (48%), Gaps = 2/148 (1%)

Query: 38  IVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPML 96
           ++    G+ LDK   E +  L   G+ V R G+ +   +P  V F V    +       L
Sbjct: 76  LIGGAIGNQLDKQAQELRRDLDTNGVSVVRQGNQLIVTMPQDVLFAVDSAAVRPDLQRDL 135

Query: 97  QLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRG 156
             ++  LN++P T + +  HTDS G    N  +SQ+RA+ +   LI  GV S R ++  G
Sbjct: 136 YTLSGSLNRYPDTTVDVVGHTDSDGDAAYNQRLSQDRANAVARILIGAGVPSYRVVAY-G 194

Query: 157 FAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
              + P+ +N +  G+  N+R+E  I P
Sbjct: 195 RGEEQPVASNLSAAGKAQNRRVEFIIRP 222


>gi|284035694|ref|YP_003385624.1| OmpA/MotB domain protein [Spirosoma linguale DSM 74]
 gi|283814987|gb|ADB36825.1| OmpA/MotB domain protein [Spirosoma linguale DSM 74]
          Length = 236

 Score = 73.9 bits (180), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 41/143 (28%), Positives = 76/143 (53%), Gaps = 4/143 (2%)

Query: 43  FGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIAT 101
            G  +DK  +E + Q+ +    V R+G+ I   +   + F V    L+ +    L   A 
Sbjct: 82  IGRRMDKQAEEIKRQMPNA--QVERVGEGIKVSLGSDILFDVDSYALKPETKQQLIEFAK 139

Query: 102 ILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKY 161
            LNK+  T + I+ H D+ G+  +NL +S++RA  + S+L  +GV ++R   + G+    
Sbjct: 140 SLNKYEDTDVRIEGHADATGSDSHNLELSKQRAKAVGSFLESQGVKTSRVDEI-GYGEAQ 198

Query: 162 PIDTNDTKVGRQNNQRIEIQIFP 184
           P+  N T+ GR+ N+R+++ +F 
Sbjct: 199 PVADNSTEAGRRKNRRVDVAVFA 221


>gi|260428759|ref|ZP_05782736.1| inner membrane lipoprotein YiaD [Citreicella sp. SE45]
 gi|260419382|gb|EEX12635.1| inner membrane lipoprotein YiaD [Citreicella sp. SE45]
          Length = 221

 Score = 73.9 bits (180), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 71/143 (49%), Gaps = 3/143 (2%)

Query: 43  FGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIAT 101
            G+ LDK E E + QL +  + ++  GD +   +P  + F      L       ++ +  
Sbjct: 79  IGNQLDKQEAELRQQLGNN-VSINNTGDRLVVTMPQDILFPFDSAALRSDLQADIRTVGR 137

Query: 102 ILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKY 161
            L ++P+T + +  HTDS G    N  +S  RA  + S LI  GV S+R  S+ G     
Sbjct: 138 SLLQYPNTTVQVLGHTDSDGDAAYNQKLSLRRAQAVSSVLIAEGVPSSRIQSI-GRGEDQ 196

Query: 162 PIDTNDTKVGRQNNQRIEIQIFP 184
           PI +N T  G+Q N+R+EI I P
Sbjct: 197 PIASNLTAEGKQQNRRVEIVILP 219


>gi|86130189|ref|ZP_01048789.1| OmpA family protein [Dokdonia donghaensis MED134]
 gi|85818864|gb|EAQ40023.1| OmpA family protein [Dokdonia donghaensis MED134]
          Length = 236

 Score = 73.6 bits (179), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 59/96 (61%), Gaps = 1/96 (1%)

Query: 95  MLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISV 154
           ML  ++ I+ ++  T + +  HTDS+G+  +NL +SQ RA+ + +Y+I  G+S+ RF +V
Sbjct: 132 MLNKLSNIMKEYNQTNVIVAGHTDSVGSDASNLTLSQNRANAVTNYMIGTGLSAGRFTTV 191

Query: 155 RGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGNIKK 190
             +    P  +NDT  GR  N+R+++ I P   +K+
Sbjct: 192 W-YGEAQPAASNDTAEGRAQNRRVQLAIVPNEQMKE 226


>gi|255319913|ref|ZP_05361114.1| inner membrane lipoprotein YiaD [Acinetobacter radioresistens SK82]
 gi|262379192|ref|ZP_06072348.1| type VI secretion system OmpA/MotB [Acinetobacter radioresistens
           SH164]
 gi|255303046|gb|EET82262.1| inner membrane lipoprotein YiaD [Acinetobacter radioresistens SK82]
 gi|262298649|gb|EEY86562.1| type VI secretion system OmpA/MotB [Acinetobacter radioresistens
           SH164]
          Length = 209

 Score = 73.6 bits (179), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 44/142 (30%), Positives = 75/142 (52%), Gaps = 3/142 (2%)

Query: 44  GSSLDKAEDEFQMQLQDTGIVVSRIGD-MITCYIPVHVSF-VSEVFLEKKFLPMLQLIAT 101
           G  LD  E + + Q+  TG+ V+R  D  +   +P +++F  ++  ++  F   L  +A 
Sbjct: 66  GVYLDNKEKKLRQQMAGTGVEVNRNPDGSVGLIMPGNITFDTNKSTIKPNFYTTLNKVAQ 125

Query: 102 ILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKY 161
            L +   + I +  +TDS G    N+ +SQ RA  + +YL  +GV   R I+ +G     
Sbjct: 126 TLTEDNKSAILVTGYTDSTGNDSINIPLSQARAQAVANYLAGQGVPRTR-INAQGLGASN 184

Query: 162 PIDTNDTKVGRQNNQRIEIQIF 183
           PI +N T  GR+ N+R+EI I+
Sbjct: 185 PIASNATAEGREQNRRVEISIY 206


>gi|78221730|ref|YP_383477.1| surface antigen protein [Geobacter metallireducens GS-15]
 gi|78192985|gb|ABB30752.1| OmpA/MotB:Rickettsia 17 kDa surface antigen [Geobacter
           metallireducens GS-15]
          Length = 218

 Score = 73.6 bits (179), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 52/87 (59%), Gaps = 1/87 (1%)

Query: 99  IATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFA 158
           +A +L ++P+T I I  HTDS G+   N  +S+ RA  +K+ L  RGV+  R  ++ GF 
Sbjct: 131 VAQVLTQYPATTITIAGHTDSTGSDALNQTLSERRATAVKNALAARGVAPARMNAI-GFG 189

Query: 159 YKYPIDTNDTKVGRQNNQRIEIQIFPR 185
              PI  N T+ GR  N+R+EI I P+
Sbjct: 190 KSKPIADNSTEAGRSMNRRVEITIVPQ 216


>gi|254510549|ref|ZP_05122616.1| OmpA domain protein [Rhodobacteraceae bacterium KLH11]
 gi|221534260|gb|EEE37248.1| OmpA domain protein [Rhodobacteraceae bacterium KLH11]
          Length = 223

 Score = 73.6 bits (179), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 41/142 (28%), Positives = 71/142 (50%), Gaps = 2/142 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPM-LQLIATILNK 105
           LD+   E + QL + GI+++  GD +   +P  ++F ++       L   L  +   L +
Sbjct: 82  LDRQAAELRQQLANDGIIITNAGDRLIVTVPNDITFATDSSTVNPALRADLVRVGQNLVR 141

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +P++ + +  HTDS G    N  +S+ RA  +   L   GV+  R  ++ G     P  +
Sbjct: 142 YPNSSVQVIGHTDSTGEASYNQGLSERRARSVADILQANGVNGARLSTI-GLGENRPAAS 200

Query: 166 NDTKVGRQNNQRIEIQIFPRGN 187
           N T  GR  N+R++I+I P GN
Sbjct: 201 NLTPEGRARNRRVDIEIIPNGN 222


>gi|300770385|ref|ZP_07080264.1| lipoprotein PG3 [Sphingobacterium spiritivorum ATCC 33861]
 gi|300762861|gb|EFK59678.1| lipoprotein PG3 [Sphingobacterium spiritivorum ATCC 33861]
          Length = 230

 Score = 73.6 bits (179), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 58/94 (61%), Gaps = 2/94 (2%)

Query: 97  QLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRG 156
           +L+AT LNK P T I +  HTD+IG+L  N  +S+ RA  +K+Y + +G++  R I+  G
Sbjct: 132 KLVAT-LNKEPDTKILVIGHTDNIGSLAANQKVSEARAAAVKTYAVSQGLNGGR-INTEG 189

Query: 157 FAYKYPIDTNDTKVGRQNNQRIEIQIFPRGNIKK 190
             Y  P+ +NDT  GR  N+R+EI I     +K+
Sbjct: 190 KNYSEPLASNDTDAGRAENRRVEIVIVAGDKMKQ 223


>gi|82701882|ref|YP_411448.1| OmpA/MotB [Nitrosospira multiformis ATCC 25196]
 gi|82409947|gb|ABB74056.1| OmpA/MotB [Nitrosospira multiformis ATCC 25196]
          Length = 225

 Score = 73.6 bits (179), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 47/142 (33%), Positives = 69/142 (48%), Gaps = 3/142 (2%)

Query: 43  FGSSLDKAEDEFQMQLQDTGIVVSRIGD-MITCYIPVHVSF-VSEVFLEKKFLPMLQLIA 100
           +   +++ + E +     TG+ V +  D  +   IP  +SF      +   F P+L   A
Sbjct: 75  WSRRMEEQKREMEQATAGTGVEVVKTSDNRLRLDIPSDISFDTGRADIRPNFRPVLDSFA 134

Query: 101 TILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYK 160
           T LN  P T + I  HTDS G+   N  +S  RA   + YL  RGVS NR + + G   +
Sbjct: 135 TSLNNNPITEVTIIGHTDSSGSDAVNNPLSLNRAASTRDYLASRGVSPNR-VRIEGRGSR 193

Query: 161 YPIDTNDTKVGRQNNQRIEIQI 182
            PI  NDT   R  N+R+EI +
Sbjct: 194 EPIVANDTPQNRARNRRVEIYV 215


>gi|86139806|ref|ZP_01058372.1| OmpA domain protein [Roseobacter sp. MED193]
 gi|85823435|gb|EAQ43644.1| OmpA domain protein [Roseobacter sp. MED193]
          Length = 218

 Score = 73.6 bits (179), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 50/180 (27%), Positives = 84/180 (46%), Gaps = 6/180 (3%)

Query: 10  FIMTTISGCGLA----SREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVV 65
            I   I G GLA    S  K    +  +    ++    GS LDK E E +  L + GI +
Sbjct: 38  LIAGAIVGAGLAGLSNSSNKGAAVVAGAAAGALLGGVIGSQLDKQEAELRESLSNNGITI 97

Query: 66  SRIGDMITCYIPVHVSFVSE-VFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLK 124
              GD +   +P  ++F S+   +       L+ +A  + ++P++ + +  HTDS G   
Sbjct: 98  VNTGDRLIVSLPNDLTFASDSAAISPAVESDLRQVAQSIVRYPNSSVQVIGHTDSDGDAS 157

Query: 125 NNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
            N  +S++RA+ +   +   GV  NR  +  G     P+ +N T  G+  N+R+EI I P
Sbjct: 158 YNQTLSEQRANTVADQVQAGGVPYNRLQTF-GRGESQPVASNLTAEGKAQNRRVEIVIVP 216


>gi|124006808|ref|ZP_01691638.1| OmpA domain protein [Microscilla marina ATCC 23134]
 gi|123987489|gb|EAY27198.1| OmpA domain protein [Microscilla marina ATCC 23134]
          Length = 570

 Score = 73.6 bits (179), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 56/88 (63%), Gaps = 1/88 (1%)

Query: 93  LPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFI 152
           +P L+ I  I+ K+P     I+ H+D++G   NNL +SQ+RA+ ++ Y +  G++++R I
Sbjct: 480 IPDLKAILAIMKKYPKNKFNIEGHSDNVGNAANNLRLSQQRANSVRQYFVNNGIAASRLI 539

Query: 153 SVRGFAYKYPIDTNDTKVGRQNNQRIEI 180
           + +G+    P  +N T  GR+ N+RIE+
Sbjct: 540 A-KGYGQTRPEVSNATAAGRKKNRRIEV 566


>gi|95928801|ref|ZP_01311547.1| OmpA/MotB [Desulfuromonas acetoxidans DSM 684]
 gi|95135146|gb|EAT16799.1| OmpA/MotB [Desulfuromonas acetoxidans DSM 684]
          Length = 415

 Score = 73.6 bits (179), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 48/84 (57%)

Query: 100 ATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAY 159
           A  +NK+P   I I  HTDS G+   N  +SQ RAD +K+YLIQ        ++ +GF  
Sbjct: 330 AAFINKYPGEKILISGHTDSDGSEAYNQQLSQRRADAVKAYLIQNYAIDGTNLTAKGFGE 389

Query: 160 KYPIDTNDTKVGRQNNQRIEIQIF 183
             PI  N T  G+Q N+R+E+ +F
Sbjct: 390 SQPIADNTTAAGKQKNRRVELSLF 413


>gi|150377808|ref|YP_001314403.1| OmpA/MotB domain-containing protein [Sinorhizobium medicae WSM419]
 gi|150032355|gb|ABR64470.1| OmpA/MotB domain protein [Sinorhizobium medicae WSM419]
          Length = 420

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 36/96 (37%), Positives = 57/96 (59%), Gaps = 1/96 (1%)

Query: 88  LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVS 147
           L+    P+L  IAT L  FP   + I  HTD+ G+ ++N  +S ERAD IK+ L++RG+ 
Sbjct: 90  LQPSAKPLLDDIATALKNFPDWGLRIVGHTDASGSAESNERLSLERADTIKAALVERGID 149

Query: 148 SNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
           + + ++  G     PI +N+T  GR  N+R+E+  F
Sbjct: 150 AGKLLAA-GAGQNRPIASNETDEGRALNRRVELMRF 184


>gi|305665914|ref|YP_003862201.1| Thrombospondin type 3 repeat:OmpA/MotB [Maribacter sp. HTCC2170]
 gi|88710689|gb|EAR02921.1| Thrombospondin type 3 repeat:OmpA/MotB [Maribacter sp. HTCC2170]
          Length = 446

 Score = 73.2 bits (178), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 33/88 (37%), Positives = 60/88 (68%), Gaps = 2/88 (2%)

Query: 95  MLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISV 154
           M+ +I  IL+++P+    ++ HTDS+G+ K N  +S+ RA+ ++ +LI +G+ S+R +S 
Sbjct: 359 MVDII-QILSEYPTAKFTVEGHTDSVGSAKLNQTLSESRANSVRDFLIDKGIGSSR-LSA 416

Query: 155 RGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
            G+    PI TN+T+ GR+ N+R+EI +
Sbjct: 417 IGYGEDKPIATNNTRSGRKQNRRVEINL 444


>gi|71898965|ref|ZP_00681131.1| OmpA/MotB [Xylella fastidiosa Ann-1]
 gi|71731211|gb|EAO33276.1| OmpA/MotB [Xylella fastidiosa Ann-1]
          Length = 375

 Score = 73.2 bits (178), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 59/115 (51%), Gaps = 6/115 (5%)

Query: 74  CYIPVHVSF--VSEVFLEKKFLP----MLQLIATILNKFPSTVIAIQSHTDSIGTLKNNL 127
           C +PV +    V+  F + K  P    +L+    IL ++P   + +  HTDS G    N 
Sbjct: 259 CPVPVSIDLKGVNFDFDKSKLRPDAVAVLKEATEILRRYPDLHVEVAGHTDSTGPAAYNK 318

Query: 128 LISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
            +S+ RA V+  YL   G+ ++R I   G+   +PIDTN T  GR  N+R E+ +
Sbjct: 319 KLSERRAKVVYDYLRNNGIDASRLIGPVGYGETHPIDTNKTPAGRAKNRRTELNV 373


>gi|182682319|ref|YP_001830479.1| OmpA/MotB domain-containing protein [Xylella fastidiosa M23]
 gi|182632429|gb|ACB93205.1| OmpA/MotB domain protein [Xylella fastidiosa M23]
 gi|307578598|gb|ADN62567.1| OmpA/MotB domain-containing protein [Xylella fastidiosa subsp.
           fastidiosa GB514]
          Length = 375

 Score = 73.2 bits (178), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 59/115 (51%), Gaps = 6/115 (5%)

Query: 74  CYIPVHVSF--VSEVFLEKKFLP----MLQLIATILNKFPSTVIAIQSHTDSIGTLKNNL 127
           C +PV +    V+  F + K  P    +L+    IL ++P   + +  HTDS G    N 
Sbjct: 259 CPVPVSIDLKGVNFDFDKSKLRPDAVAVLKEATEILRRYPDLHVEVAGHTDSTGPAAYNK 318

Query: 128 LISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
            +S+ RA V+  YL   G+ ++R I   G+   +PIDTN T  GR  N+R E+ +
Sbjct: 319 KLSERRAKVVYDYLRNNGIDASRLIGPVGYGETHPIDTNKTPAGRAKNRRTELNV 373


>gi|28199584|ref|NP_779898.1| outer membrane protein [Xylella fastidiosa Temecula1]
 gi|28057699|gb|AAO29547.1| outer membrane protein [Xylella fastidiosa Temecula1]
          Length = 389

 Score = 73.2 bits (178), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 59/115 (51%), Gaps = 6/115 (5%)

Query: 74  CYIPVHVSF--VSEVFLEKKFLP----MLQLIATILNKFPSTVIAIQSHTDSIGTLKNNL 127
           C +PV +    V+  F + K  P    +L+    IL ++P   + +  HTDS G    N 
Sbjct: 273 CPVPVSIDLKGVNFDFDKSKLRPDAVAVLKEATEILRRYPDLHVEVAGHTDSTGPAAYNK 332

Query: 128 LISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
            +S+ RA V+  YL   G+ ++R I   G+   +PIDTN T  GR  N+R E+ +
Sbjct: 333 KLSERRAKVVYDYLRNNGIDASRLIGPVGYGETHPIDTNKTPAGRAKNRRTELNV 387


>gi|71276570|ref|ZP_00652844.1| OmpA/MotB [Xylella fastidiosa Dixon]
 gi|71901217|ref|ZP_00683319.1| OmpA/MotB [Xylella fastidiosa Ann-1]
 gi|170730957|ref|YP_001776390.1| outer membrane protein [Xylella fastidiosa M12]
 gi|71162641|gb|EAO12369.1| OmpA/MotB [Xylella fastidiosa Dixon]
 gi|71729028|gb|EAO31157.1| OmpA/MotB [Xylella fastidiosa Ann-1]
 gi|167965750|gb|ACA12760.1| outer membrane protein [Xylella fastidiosa M12]
          Length = 375

 Score = 73.2 bits (178), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 59/115 (51%), Gaps = 6/115 (5%)

Query: 74  CYIPVHVSF--VSEVFLEKKFLP----MLQLIATILNKFPSTVIAIQSHTDSIGTLKNNL 127
           C +PV +    V+  F + K  P    +L+    IL ++P   + +  HTDS G    N 
Sbjct: 259 CPVPVSIDLKGVNFDFDKSKLRPDAVAVLKEATEILRRYPDLHVEVAGHTDSTGPAAYNK 318

Query: 128 LISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
            +S+ RA V+  YL   G+ ++R I   G+   +PIDTN T  GR  N+R E+ +
Sbjct: 319 KLSERRAKVVYDYLRNNGIDASRLIGPVGYGETHPIDTNKTPAGRAKNRRTELNV 373


>gi|163855060|ref|YP_001629358.1| putative lipoprotein [Bordetella petrii DSM 12804]
 gi|163258788|emb|CAP41087.1| putative lipoprotein [Bordetella petrii]
          Length = 215

 Score = 73.2 bits (178), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 38/109 (34%), Positives = 62/109 (56%), Gaps = 2/109 (1%)

Query: 76  IPVHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERA 134
           IP +VSF   +  L+   LP+L  +A  LN+ P     +  HTDS G+  +N  +S+ RA
Sbjct: 104 IPSNVSFDTDKAVLKPALLPVLDSVARALNQHPELRAKVVGHTDSTGSAAHNQTLSENRA 163

Query: 135 DVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
             +  YL ++GV+  R +++ G A + PI  N T  GR  N+R+E+ ++
Sbjct: 164 RSVTDYLGKQGVAPAR-MTIEGRAARDPIGDNATAEGRAANRRVEVYLY 211


>gi|167835831|ref|ZP_02462714.1| ompA family protein [Burkholderia thailandensis MSMB43]
          Length = 215

 Score = 73.2 bits (178), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 42/124 (33%), Positives = 67/124 (54%), Gaps = 3/124 (2%)

Query: 59  QDTGIVVSRIGD-MITCYIPVHVSFVSEVF-LEKKFLPMLQLIATILNKFPSTVIAIQSH 116
           Q TG  V+   D  +   +P  V+F +  + +   F P+L  +AT LN+ P    ++  +
Sbjct: 84  QQTGTQVTEQPDGSLKLNVPSSVTFATNQYAVTPAFTPLLNDLATTLNQNPQITASVVGY 143

Query: 117 TDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQ 176
           TDS G+   N  +SQ RA  + + L QR V+++R +S +G     PI  N T+ GR  N+
Sbjct: 144 TDSTGSAAYNQTLSQNRAQSVVNALSQRSVAASR-LSAQGMGASNPIADNATEAGRAQNR 202

Query: 177 RIEI 180
           R+EI
Sbjct: 203 RVEI 206


>gi|255530097|ref|YP_003090469.1| OmpA/MotB domain-containing protein [Pedobacter heparinus DSM 2366]
 gi|255343081|gb|ACU02407.1| OmpA/MotB domain protein [Pedobacter heparinus DSM 2366]
          Length = 263

 Score = 73.2 bits (178), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 35/95 (36%), Positives = 59/95 (62%), Gaps = 1/95 (1%)

Query: 96  LQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVR 155
           ++ +A  LN++P T I +  HTD+ GT   N+ +S+ RA  +K+Y + +GV S+R I++ 
Sbjct: 163 IKSLAGSLNQYPGTDIKVIGHTDNKGTEAYNMGLSERRAAAVKAYAVSQGVPSSRLITI- 221

Query: 156 GFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGNIKK 190
           G  +  PI+ N T+ GR  N+R+E+ I     +KK
Sbjct: 222 GKGFSEPIEDNSTEAGRAANRRVEVVIVANDQLKK 256


>gi|77165507|ref|YP_344032.1| OmpA/MotB [Nitrosococcus oceani ATCC 19707]
 gi|76883821|gb|ABA58502.1| OmpA/MotB [Nitrosococcus oceani ATCC 19707]
          Length = 286

 Score = 73.2 bits (178), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 53/88 (60%), Gaps = 1/88 (1%)

Query: 99  IATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFA 158
           + T L ++P   + ++ HTDS G+   N+ +SQ RAD +  +L+  G++ +R ++  G+ 
Sbjct: 190 LVTFLKEYPDREVVVEGHTDSTGSAVYNMELSQRRADSVYLFLVNNGIAPDRIVA-HGYG 248

Query: 159 YKYPIDTNDTKVGRQNNQRIEIQIFPRG 186
             YP+  N+T  GRQ N+R+EI I   G
Sbjct: 249 QGYPVAPNNTTAGRQKNRRVEIVILGAG 276


>gi|15836945|ref|NP_297633.1| outer membrane protein [Xylella fastidiosa 9a5c]
 gi|9105169|gb|AAF83153.1|AE003886_12 outer membrane protein [Xylella fastidiosa 9a5c]
          Length = 389

 Score = 73.2 bits (178), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 59/115 (51%), Gaps = 6/115 (5%)

Query: 74  CYIPVHVSF--VSEVFLEKKFLP----MLQLIATILNKFPSTVIAIQSHTDSIGTLKNNL 127
           C +PV +    V+  F + K  P    +L+    IL ++P   + +  HTDS G    N 
Sbjct: 273 CPVPVSIDLKGVNFDFDKSKLRPDAVAVLKEATEILRRYPDLHVEVAGHTDSTGPAAYNK 332

Query: 128 LISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
            +S+ RA V+  YL   G+ ++R I   G+   +PIDTN T  GR  N+R E+ +
Sbjct: 333 KLSERRAKVVYDYLRNNGIDASRLIGPVGYGETHPIDTNKTPAGRAKNRRTELNV 387


>gi|319796493|ref|YP_004158133.1| ompa/motb domain protein [Variovorax paradoxus EPS]
 gi|315598956|gb|ADU40022.1| OmpA/MotB domain protein [Variovorax paradoxus EPS]
          Length = 219

 Score = 73.2 bits (178), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 43/142 (30%), Positives = 73/142 (51%), Gaps = 3/142 (2%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRI-GDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILN 104
           ++  + + +   Q TG+ V++   + +   IP  VSF V    ++  F P+L   A+ L 
Sbjct: 76  MENQKRQMEAATQGTGVAVTQTQNNELKLAIPSDVSFDVGRANIKPNFAPVLDQFASGLR 135

Query: 105 KFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPID 164
             P+  + I  HTDS G+   N  +S +RA   + YL+ RGV++  F  + G     P+ 
Sbjct: 136 NNPNAEVRIIGHTDSTGSDAINNPLSVDRAASTRDYLVARGVNAAAF-RIEGRGSHEPVA 194

Query: 165 TNDTKVGRQNNQRIEIQIFPRG 186
            N++  GR  N+R+EI +  RG
Sbjct: 195 DNNSDAGRAQNRRVEIYVGERG 216


>gi|227538856|ref|ZP_03968905.1| OmpA/MotB domain protein [Sphingobacterium spiritivorum ATCC 33300]
 gi|227241365|gb|EEI91380.1| OmpA/MotB domain protein [Sphingobacterium spiritivorum ATCC 33300]
          Length = 230

 Score = 73.2 bits (178), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 58/94 (61%), Gaps = 2/94 (2%)

Query: 97  QLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRG 156
           +L+AT LNK P T I +  HTD++G+L  N  +S+ RA  +K+Y + +G++  R I+  G
Sbjct: 132 KLVAT-LNKEPDTKILVIGHTDNVGSLAANQKVSEARAAAVKTYAVSQGLNGGR-INTEG 189

Query: 157 FAYKYPIDTNDTKVGRQNNQRIEIQIFPRGNIKK 190
             Y  P+ +NDT  GR  N+R+EI I     +K+
Sbjct: 190 KNYSEPLASNDTDAGRAENRRVEIVIVAGDKMKQ 223


>gi|149913202|ref|ZP_01901736.1| OmpA family domain protein [Roseobacter sp. AzwK-3b]
 gi|149813608|gb|EDM73434.1| OmpA family domain protein [Roseobacter sp. AzwK-3b]
          Length = 222

 Score = 73.2 bits (178), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 41/143 (28%), Positives = 70/143 (48%), Gaps = 2/143 (1%)

Query: 43  FGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIAT 101
           +G+ LD+ E + + QL D  + ++  GD +   +P  + F V    +       L  +A+
Sbjct: 78  YGNMLDRQEAQLRQQLDDDRVQITNTGDRLIVTLPQDILFDVDSASVRSGLRDDLMTVAS 137

Query: 102 ILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKY 161
            L  +P + + +  HTD+ G    N  +S+ RA+ +   L+  GV+ +R I   G     
Sbjct: 138 SLRDYPDSTVQVVGHTDNTGDAGYNQQLSERRANAVADVLMDGGVAFSR-IQTFGRGENQ 196

Query: 162 PIDTNDTKVGRQNNQRIEIQIFP 184
           P+  N T  GR  N+R+EI I P
Sbjct: 197 PVADNLTDAGRAQNRRVEIVILP 219


>gi|300690749|ref|YP_003751744.1| outer membrane lipoprotein [Ralstonia solanacearum PSI07]
 gi|299077809|emb|CBJ50447.1| putative outer membrane lipoprotein [Ralstonia solanacearum PSI07]
          Length = 209

 Score = 73.2 bits (178), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 63/126 (50%), Gaps = 3/126 (2%)

Query: 61  TGIVVSRIGD-MITCYIPVHVSFVSE-VFLEKKFLPMLQLIATILNKFPSTVIAIQSHTD 118
           TG  +S   D  +   IP  VSF ++   ++  F   L  +A  L + P     +  HTD
Sbjct: 82  TGTQISEQPDGSLKLNIPSQVSFDTDSAVIKPSFRGPLDSVAETLTQHPELAANVVGHTD 141

Query: 119 SIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRI 178
           S G    N+ +SQ RA  + SYL  RGV+ NR ++  G     P+  N T+ GR  N+R+
Sbjct: 142 STGNPNYNMSLSQRRAQSVTSYLTDRGVARNR-LTAEGRGQTQPVGDNATEAGRSQNRRV 200

Query: 179 EIQIFP 184
           EI + P
Sbjct: 201 EIYLKP 206


>gi|254433641|ref|ZP_05047149.1| OmpA family protein [Nitrosococcus oceani AFC27]
 gi|207089974|gb|EDZ67245.1| OmpA family protein [Nitrosococcus oceani AFC27]
          Length = 293

 Score = 73.2 bits (178), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 53/88 (60%), Gaps = 1/88 (1%)

Query: 99  IATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFA 158
           + T L ++P   + ++ HTDS G+   N+ +SQ RAD +  +L+  G++ +R ++  G+ 
Sbjct: 197 LVTFLKEYPDREVVVEGHTDSTGSAVYNMELSQRRADSVYLFLVNNGIAPDRIVA-HGYG 255

Query: 159 YKYPIDTNDTKVGRQNNQRIEIQIFPRG 186
             YP+  N+T  GRQ N+R+EI I   G
Sbjct: 256 QGYPVAPNNTTAGRQKNRRVEIVILGAG 283


>gi|262197216|ref|YP_003268425.1| OmpA/MotB domain protein [Haliangium ochraceum DSM 14365]
 gi|262080563|gb|ACY16532.1| OmpA/MotB domain protein [Haliangium ochraceum DSM 14365]
          Length = 374

 Score = 72.8 bits (177), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 56/91 (61%), Gaps = 1/91 (1%)

Query: 95  MLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISV 154
           +L  +AT+L   P   + I+ HTDS G+ + N+ +SQ RA+ ++S+LI +GV  +R +  
Sbjct: 285 LLNEVATVLTDNPEIEVRIEGHTDSRGSAEFNMELSQSRAESVRSFLIDKGVDGDR-LEA 343

Query: 155 RGFAYKYPIDTNDTKVGRQNNQRIEIQIFPR 185
           +G+    PI  N+T+ G+  N+R+E  I  R
Sbjct: 344 KGYGESAPIANNNTRAGQAQNRRVEFVIVSR 374


>gi|172061391|ref|YP_001809043.1| OmpA/MotB domain-containing protein [Burkholderia ambifaria MC40-6]
 gi|171993908|gb|ACB64827.1| OmpA/MotB domain protein [Burkholderia ambifaria MC40-6]
          Length = 215

 Score = 72.8 bits (177), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 38/106 (35%), Positives = 60/106 (56%), Gaps = 2/106 (1%)

Query: 76  IPVHVSFVSEVF-LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERA 134
           +P  V+F +  + +   F P+L  +AT LN+ P    ++  +TDS G+ + N  +SQ RA
Sbjct: 102 VPSSVTFATNQYAITPAFTPLLNDLATTLNQNPQLTGSVIGYTDSTGSAQLNQTLSQNRA 161

Query: 135 DVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEI 180
             + + L QRGV+  R +S +G     PI  N T+ GR  N+R+EI
Sbjct: 162 QSVVNALAQRGVAGGR-LSAQGMGPSNPIADNATEAGRAQNRRVEI 206


>gi|115375674|ref|ZP_01462929.1| OmpA domain protein [Stigmatella aurantiaca DW4/3-1]
 gi|310821151|ref|YP_003953509.1| OmpA-like Outer membrane domain-containing protein [Stigmatella
           aurantiaca DW4/3-1]
 gi|115367322|gb|EAU66302.1| OmpA domain protein [Stigmatella aurantiaca DW4/3-1]
 gi|309394223|gb|ADO71682.1| OmpA-like Outer membrane domain protein [Stigmatella aurantiaca
           DW4/3-1]
          Length = 380

 Score = 72.8 bits (177), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 34/95 (35%), Positives = 55/95 (57%), Gaps = 1/95 (1%)

Query: 88  LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVS 147
           LE+   P+L      L   P   + I+ H+DS G   NN  +S++RA  +  YL+  G++
Sbjct: 276 LEEASFPVLDEAVQALKDNPDFRVQIEGHSDSSGADDNNQTLSEKRAKTVLDYLVAHGIA 335

Query: 148 SNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
             R +S +GF+   P+DTN+T  GR+NN+R+E  +
Sbjct: 336 KERLVS-KGFSSSVPLDTNNTVAGRENNRRVEFVV 369


>gi|197124092|ref|YP_002136043.1| OmpA/MotB domain protein [Anaeromyxobacter sp. K]
 gi|196173941|gb|ACG74914.1| OmpA/MotB domain protein [Anaeromyxobacter sp. K]
          Length = 386

 Score = 72.8 bits (177), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 32/92 (34%), Positives = 52/92 (56%), Gaps = 1/92 (1%)

Query: 95  MLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISV 154
           +L  +A  L   P   +A++ HTD  G    +  +SQ RA+ +++ L  RG+ + R +  
Sbjct: 296 LLDELAQALRDHPRLRVAVEVHTDGAGEAAASKRLSQARAEAVRAALAGRGIEAER-VEA 354

Query: 155 RGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRG 186
           +GF  ++PI +N T  GR  N+R EI+I P G
Sbjct: 355 KGFGAEHPIASNKTARGRAQNRRTEIRILPGG 386


>gi|327405440|ref|YP_004346278.1| OmpA/MotB domain-containing protein [Fluviicola taffensis DSM
           16823]
 gi|327320948|gb|AEA45440.1| OmpA/MotB domain protein [Fluviicola taffensis DSM 16823]
          Length = 367

 Score = 72.8 bits (177), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 77/125 (61%), Gaps = 8/125 (6%)

Query: 60  DTGIVVSRIGDMITCYIPVHVSFVS--EVFLEKKFLPMLQLIATILNKFPSTVIAIQSHT 117
           DT I ++ +GD+   Y+  ++ F S   + L  ++ P L+     + K+P+  + +  HT
Sbjct: 247 DTSINLT-VGDV---YVLHNLQFESGKSILLPNEY-PELENFIRHVEKYPNQTLLVTGHT 301

Query: 118 DSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQR 177
           D++G   +N ++S ERA+ IK YL+ +G++ N+ + + G   + P+D+N+T+ GR+ N+R
Sbjct: 302 DNVGNKGDNKMLSLERANAIKQYLVAKGINKNKIV-IEGKGDEIPLDSNETEEGRKKNRR 360

Query: 178 IEIQI 182
           +EI I
Sbjct: 361 VEISI 365


>gi|298208747|ref|YP_003716926.1| OmpA family protein [Croceibacter atlanticus HTCC2559]
 gi|83848674|gb|EAP86543.1| OmpA family protein [Croceibacter atlanticus HTCC2559]
          Length = 233

 Score = 72.8 bits (177), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 41/144 (28%), Positives = 76/144 (52%), Gaps = 6/144 (4%)

Query: 44  GSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF---VSEVFLEKKFLPMLQLIA 100
           G+ +DK   + + ++   G  V RI D I      +       ++  +  K    L  ++
Sbjct: 77  GNKMDKQAQKIEQEI--PGAQVERIDDGIVVTFDENSGVYFDTNKSNINAKSQETLDKLS 134

Query: 101 TILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYK 160
            +L ++P+T + +  HTDS G+ + N+ +S++RA+ + +Y   +G+SS RF + + F   
Sbjct: 135 NVLVEYPNTDVLVVGHTDSTGSAEYNMSLSRDRANSVTNYFTSKGLSSGRF-TTKWFGET 193

Query: 161 YPIDTNDTKVGRQNNQRIEIQIFP 184
            P  TNDT  GR  N+R+++ I P
Sbjct: 194 KPAYTNDTAEGRAKNRRVQLAILP 217


>gi|110638825|ref|YP_679034.1| outer membrane protein [Cytophaga hutchinsonii ATCC 33406]
 gi|110281506|gb|ABG59692.1| possible outer membrane protein [Cytophaga hutchinsonii ATCC 33406]
          Length = 320

 Score = 72.4 bits (176), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 60/100 (60%), Gaps = 2/100 (2%)

Query: 84  SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQ 143
           S+V +   F   L  +A +L   P   + I+ HTD++G  + NL +S+ RA  +K+YL+ 
Sbjct: 222 SDVIVSSSFQ-SLDDLAKVLRNNPLYNLYIEGHTDNVGDDEANLDLSKRRAISVKNYLVS 280

Query: 144 RGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
           +GV + R ++  GF    P+DTNDT  GR+ N+R+E+ I 
Sbjct: 281 KGVGAAR-LTTDGFGEARPVDTNDTPEGRKKNRRVEMHIL 319


>gi|237738475|ref|ZP_04568956.1| outer membrane porin F [Fusobacterium mortiferum ATCC 9817]
 gi|229420355|gb|EEO35402.1| outer membrane porin F [Fusobacterium mortiferum ATCC 9817]
          Length = 185

 Score = 72.4 bits (176), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 50/179 (27%), Positives = 96/179 (53%), Gaps = 5/179 (2%)

Query: 2   IKELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDT 61
           +K++ + + ++  I+GC     + K++ + +S +T  + +   ++    ED   +   + 
Sbjct: 1   MKKIFMVLSLVGVIAGCTSTQGQFKEITIKES-ETQYILEDVTTTEKPLED--IIVFNEE 57

Query: 62  GIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSI 120
           G+V+ + G+ +   +PV + F      +++     L  +   L +     + I  HTD I
Sbjct: 58  GVVIRKDGNNLVLSMPVEILFDFDSSKVKEGVKESLNTLGKALAENKDIKLKIDGHTDYI 117

Query: 121 GTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIE 179
           GT + NL +S +RA+ IK+YLI RGVS+N  IS+ G+  + P+  N T+ GR  N+R+E
Sbjct: 118 GTEQYNLNLSLKRANSIKNYLIGRGVSANN-ISIEGYGKQNPVANNSTEAGRAKNRRVE 175


>gi|218783104|ref|YP_002434422.1| OmpA/MotB domain protein [Desulfatibacillum alkenivorans AK-01]
 gi|218764488|gb|ACL06954.1| OmpA/MotB domain protein [Desulfatibacillum alkenivorans AK-01]
          Length = 217

 Score = 72.4 bits (176), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 57/89 (64%), Gaps = 1/89 (1%)

Query: 96  LQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVR 155
           L+ IA ++ K+P T I ++ HTDS G  + N  +S+ RA+V+K+ LI  GV ++R  ++ 
Sbjct: 128 LRDIAQVMVKYPDTQIMVKGHTDSTGGEEYNQQLSERRANVVKNILISYGVPAHRITAI- 186

Query: 156 GFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           G     PI +NDT  GR  N+R+EI++ P
Sbjct: 187 GLGEVMPIASNDTPDGRAMNRRVEIEVRP 215


>gi|115352534|ref|YP_774373.1| OmpA/MotB domain-containing protein [Burkholderia ambifaria AMMD]
 gi|115282522|gb|ABI88039.1| OmpA/MotB domain protein [Burkholderia ambifaria AMMD]
          Length = 232

 Score = 72.4 bits (176), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 38/106 (35%), Positives = 60/106 (56%), Gaps = 2/106 (1%)

Query: 76  IPVHVSFVSEVF-LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERA 134
           +P  V+F +  + +   F P+L  +AT LN+ P    ++  +TDS G+ + N  +SQ RA
Sbjct: 119 VPSSVTFATNQYAITPAFTPLLNDLATTLNQNPQLTGSVIGYTDSTGSAQLNQTLSQNRA 178

Query: 135 DVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEI 180
             + + L QRGV+  R +S +G     PI  N T+ GR  N+R+EI
Sbjct: 179 QSVVNALAQRGVAGGR-LSAQGMGPSNPIADNATEAGRAQNRRVEI 223


>gi|325105621|ref|YP_004275275.1| OmpA/MotB domain protein [Pedobacter saltans DSM 12145]
 gi|324974469|gb|ADY53453.1| OmpA/MotB domain protein [Pedobacter saltans DSM 12145]
          Length = 230

 Score = 72.4 bits (176), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 40/84 (47%), Positives = 51/84 (60%), Gaps = 1/84 (1%)

Query: 99  IATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFA 158
           +A  LNK+P T I +  HTD+IGT   N  +S ERA+ + SY I +GVSS R  S  G  
Sbjct: 133 LAASLNKYPDTDILVVGHTDAIGTDAVNNKLSLERANSVVSYAISKGVSSGRLKS-SGKG 191

Query: 159 YKYPIDTNDTKVGRQNNQRIEIQI 182
              PI +NDT  GR  N+R+EI I
Sbjct: 192 KTEPIASNDTDAGRAQNRRVEIVI 215


>gi|120437695|ref|YP_863381.1| thrombospondin repeat-containing OmpA/MotB family outer membrane
           protein [Gramella forsetii KT0803]
 gi|117579845|emb|CAL68314.1| OmpA/MotB family outer membrane protein containing thrombospondin 3
           repeats [Gramella forsetii KT0803]
          Length = 472

 Score = 72.4 bits (176), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 34/88 (38%), Positives = 55/88 (62%), Gaps = 1/88 (1%)

Query: 95  MLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISV 154
            LQ I  I++++ +T+  I+ HTDS G+   N+ +S+ERA  + ++L Q G+ + R  S 
Sbjct: 372 ALQSIHDIMHEYSTTIFHIEGHTDSSGSDSYNMKLSKERAASVATWLEQNGIPAKRLTS- 430

Query: 155 RGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
            G+    PI TN T  GRQ+N+R+EI +
Sbjct: 431 EGYGETQPIATNSTAKGRQDNRRVEISL 458


>gi|237744058|ref|ZP_04574539.1| outer membrane porin F [Fusobacterium sp. 7_1]
 gi|256028141|ref|ZP_05441975.1| Outer membrane porin F [Fusobacterium sp. D11]
 gi|260494357|ref|ZP_05814488.1| type VI secretion system OmpA/MotB [Fusobacterium sp. 3_1_33]
 gi|289766078|ref|ZP_06525456.1| outer membrane porin F [Fusobacterium sp. D11]
 gi|229431287|gb|EEO41499.1| outer membrane porin F [Fusobacterium sp. 7_1]
 gi|260198503|gb|EEW96019.1| type VI secretion system OmpA/MotB [Fusobacterium sp. 3_1_33]
 gi|289717633|gb|EFD81645.1| outer membrane porin F [Fusobacterium sp. D11]
          Length = 182

 Score = 72.4 bits (176), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 47/131 (35%), Positives = 70/131 (53%), Gaps = 5/131 (3%)

Query: 58  LQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEK-KFLPMLQLIATILNKFPSTVIAIQSH 116
             + G+ + R G+ +   +P  + F  + ++ K K  P L  +A  L +     I I  +
Sbjct: 55  FNEEGVTIRREGNNLILSMPELILFDFDKYIVKDKIKPSLSTLAKALGENKDIHIKIDGY 114

Query: 117 TDSIGTLKNNLLISQERADVIKSYLIQRG-VSSNRFISVRGFAYKYPIDTNDTKVGRQNN 175
           TD IGT   NL +S +RA+ IK +LI RG + SN  IS+ G+  + P DTN T  GR  N
Sbjct: 115 TDFIGTEAYNLELSVKRANAIKDFLISRGAIGSN--ISIEGYGEQNPADTNQTAAGRSRN 172

Query: 176 QRIEIQIFPRG 186
           +R+E  I  RG
Sbjct: 173 RRVEF-IISRG 182


>gi|299066021|emb|CBJ37202.1| putative outer membrane lipoprotein [Ralstonia solanacearum CMR15]
          Length = 209

 Score = 72.4 bits (176), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 63/126 (50%), Gaps = 3/126 (2%)

Query: 61  TGIVVSRIGD-MITCYIPVHVSFVSE-VFLEKKFLPMLQLIATILNKFPSTVIAIQSHTD 118
           TG  +S   D  +   IP  VSF ++   ++  F   L  +A  L++ P     +  HTD
Sbjct: 82  TGTQISEQPDGSLKLNIPSQVSFDTDSAVIKPSFRGPLDSVAETLSQHPELAANVVGHTD 141

Query: 119 SIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRI 178
           S G    N+ +SQ RA  + SYL  RGV+  R +S  G     P+  N T+ GR  N+R+
Sbjct: 142 STGNPNYNMSLSQRRAQSVASYLTDRGVARTR-LSAEGRGQTQPVGDNATEAGRAQNRRV 200

Query: 179 EIQIFP 184
           EI + P
Sbjct: 201 EIYLKP 206


>gi|262375710|ref|ZP_06068942.1| type VI secretion system OmpA/MotB [Acinetobacter lwoffii SH145]
 gi|262309313|gb|EEY90444.1| type VI secretion system OmpA/MotB [Acinetobacter lwoffii SH145]
          Length = 217

 Score = 72.4 bits (176), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 43/139 (30%), Positives = 73/139 (52%), Gaps = 3/139 (2%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGD-MITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILN 104
           LD  E + +     TG+ V+R  D  I   +P  ++F  ++  ++  F   L  +A +L 
Sbjct: 77  LDNKEKKLRQATAGTGVDVNRNADGSINLVMPGSITFDTNKSNIKPNFYGTLNKVAQVLT 136

Query: 105 KFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPID 164
           +   + I +  +TDS G    NL +SQ RA+ + +YL  +GVS  R I+ +G     PI 
Sbjct: 137 EDNQSGILVTGYTDSTGNDSINLPLSQARANSVATYLAGQGVSRTR-INAQGLGSANPIA 195

Query: 165 TNDTKVGRQNNQRIEIQIF 183
            N T  G++ N+R+EI ++
Sbjct: 196 DNTTAAGKEQNRRVEIAVY 214


>gi|108759341|ref|YP_630319.1| OmpA domain-containing protein [Myxococcus xanthus DK 1622]
 gi|108463221|gb|ABF88406.1| OmpA domain protein [Myxococcus xanthus DK 1622]
          Length = 639

 Score = 72.0 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 34/96 (35%), Positives = 61/96 (63%), Gaps = 2/96 (2%)

Query: 88  LEKKFLPMLQLIATILNKFPST-VIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGV 146
           ++K+  P+L  +AT+L K P+   + I+ HTD+ G+   N+ +S  RA  +  YL+ +G+
Sbjct: 508 IQKQSYPLLDEVATVLRKNPTLGPVLIEGHTDNRGSRALNMGLSDRRAKSVLEYLVAKGI 567

Query: 147 SSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           +  R +S +GF +  PI TNDT +GR  N+R++ ++
Sbjct: 568 ARKR-LSSKGFGFDNPIATNDTALGRAKNRRVDFRL 602


>gi|78778212|ref|YP_394527.1| OmpA/MotB [Sulfurimonas denitrificans DSM 1251]
 gi|78498752|gb|ABB45292.1| OmpA/MotB [Sulfurimonas denitrificans DSM 1251]
          Length = 348

 Score = 72.0 bits (175), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 36/117 (30%), Positives = 68/117 (58%), Gaps = 2/117 (1%)

Query: 70  DMITCYIPVHVSFVSEVF-LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLL 128
           D  +  + +H++F +  + ++   +P ++  A  L   P+    I  HTDS+G+ K+N  
Sbjct: 233 DGCSVLVDLHINFDTASYKVDNASMPKVKEFAEFLKDMPNYNAKIVGHTDSVGSDKDNQK 292

Query: 129 ISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPR 185
           +S+ RA+ +K+ +++ G+ + R I+  G   K PI TNDTK G+  N+RIE ++  +
Sbjct: 293 LSENRANSVKTLIVKEGIDTKR-ITTEGKGEKSPIATNDTKEGKAQNRRIEAELIKK 348


>gi|171320878|ref|ZP_02909877.1| OmpA/MotB domain protein [Burkholderia ambifaria MEX-5]
 gi|171093863|gb|EDT38995.1| OmpA/MotB domain protein [Burkholderia ambifaria MEX-5]
          Length = 214

 Score = 72.0 bits (175), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 38/106 (35%), Positives = 59/106 (55%), Gaps = 2/106 (1%)

Query: 76  IPVHVSFVSEVF-LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERA 134
           +P  V+F +  + +   F P+L  +AT LN+ P    ++  +TDS G+ + N  +SQ RA
Sbjct: 102 VPSSVTFATNQYAITPAFTPLLNDLATTLNQNPQLTGSVVGYTDSTGSAQLNQTLSQNRA 161

Query: 135 DVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEI 180
             + + L QRGV+  R +S +G     PI  N T  GR  N+R+EI
Sbjct: 162 QSVVNALGQRGVAGGR-LSAQGMGASNPIADNATDAGRAQNRRVEI 206


>gi|126732859|ref|ZP_01748650.1| OmpA family protein [Sagittula stellata E-37]
 gi|126706635|gb|EBA05709.1| OmpA family protein [Sagittula stellata E-37]
          Length = 227

 Score = 72.0 bits (175), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 47/139 (33%), Positives = 72/139 (51%), Gaps = 3/139 (2%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSE-VFLEKKFLPMLQLIATILNK 105
           LDK E E + QL  + + +   GD +   +P  + F ++   L    L  +Q +A  + +
Sbjct: 88  LDKQEAELRQQL-GSQVDIRNTGDRLIVTMPQDILFATDSATLSGGLLGDIQDVAQSVLR 146

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +P+T   I  HTDS G    NL +SQ RA  + +  + + V S+R I V G     PI +
Sbjct: 147 YPNTTTQIIGHTDSDGDAAYNLSLSQRRAQAVANVFLAQNVPSSR-IQVIGRGEDQPIAS 205

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T  G+Q N+R+EI I P
Sbjct: 206 NLTPQGKQQNRRVEIVILP 224


>gi|300703368|ref|YP_003744970.1| outer membrane lipoprotein [Ralstonia solanacearum CFBP2957]
 gi|299071031|emb|CBJ42340.1| putative outer membrane lipoprotein [Ralstonia solanacearum
           CFBP2957]
          Length = 209

 Score = 72.0 bits (175), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 63/126 (50%), Gaps = 3/126 (2%)

Query: 61  TGIVVSRIGD-MITCYIPVHVSFVSE-VFLEKKFLPMLQLIATILNKFPSTVIAIQSHTD 118
           TG  +S   D  +   IP  VSF ++   ++  F   L  +A  L + P    ++  HTD
Sbjct: 82  TGTQISEQPDGSLKLNIPSQVSFDTDSAMIKPSFRGPLDSVAETLTQHPELAASVVGHTD 141

Query: 119 SIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRI 178
           S G    N+ +SQ RA  + SYL  RGV+  R ++  G     P+  N T+ GR  N+R+
Sbjct: 142 STGNPNYNMSLSQRRAQSVTSYLTDRGVARTR-LTAEGRGQTQPVGDNATEAGRAQNRRV 200

Query: 179 EIQIFP 184
           EI + P
Sbjct: 201 EIYLKP 206


>gi|305666954|ref|YP_003863241.1| OmpA family protein [Maribacter sp. HTCC2170]
 gi|88709183|gb|EAR01417.1| OmpA family protein [Maribacter sp. HTCC2170]
          Length = 217

 Score = 72.0 bits (175), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 38/132 (28%), Positives = 70/132 (53%), Gaps = 4/132 (3%)

Query: 62  GIVVSRIGDMITCYIPVHVSF---VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTD 118
           G  V+R+G+ I              S+  ++      L  +A I  ++P++ + I+ HTD
Sbjct: 79  GAEVTRVGEGINVTFNEEAGVYFDTSKSNVKGTSATTLDKLAGIFKEYPNSDVLIEGHTD 138

Query: 119 SIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRI 178
           S G    N+ +SQ+RA+ + +YLI +G+ +NRF S + +    P   N+T  G+  N+R+
Sbjct: 139 SAGPDDYNMKLSQQRAESVTNYLISKGIEANRF-STKWYGENQPKADNETTEGKAKNRRV 197

Query: 179 EIQIFPRGNIKK 190
           E+ I    ++K+
Sbjct: 198 ELAIIASKDLKE 209


>gi|239818112|ref|YP_002947022.1| OmpA/MotB domain protein [Variovorax paradoxus S110]
 gi|239804689|gb|ACS21756.1| OmpA/MotB domain protein [Variovorax paradoxus S110]
          Length = 219

 Score = 72.0 bits (175), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 45/145 (31%), Positives = 74/145 (51%), Gaps = 6/145 (4%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRI-GDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILN 104
           ++  + + +   Q TG+ V++   + +   IP  VSF V    ++  F P+L   A+ L 
Sbjct: 76  MENQKRQMEAATQGTGVAVTQTPNNELKLQIPSDVSFDVGRSNIKSNFAPVLDQFASGLR 135

Query: 105 KFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPID 164
             P+  + I  HTD+ G+   N  +S +RA   + YL+ RGVS+  F  + G     PI 
Sbjct: 136 NNPNAEVRIIGHTDNTGSDAINNPLSVDRAASTRDYLVARGVSAAAF-RIEGRGSHEPIA 194

Query: 165 TNDTKVGRQNNQRIEIQI---FPRG 186
            N++  GR  N+R+EI +    PRG
Sbjct: 195 NNNSDAGRAQNRRVEIYVGERAPRG 219


>gi|329902399|ref|ZP_08273103.1| Outer membrane lipoprotein omp16 precursor [Oxalobacteraceae
           bacterium IMCC9480]
 gi|327548814|gb|EGF33448.1| Outer membrane lipoprotein omp16 precursor [Oxalobacteraceae
           bacterium IMCC9480]
          Length = 224

 Score = 72.0 bits (175), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 44/145 (30%), Positives = 74/145 (51%), Gaps = 3/145 (2%)

Query: 43  FGSSLDKAEDEFQMQLQDTGIVVSRIGD-MITCYIPVHVSF-VSEVFLEKKFLPMLQLIA 100
           + + ++  +   +   + TG+ V++  D  +   IP  +SF  +   ++  F P+L    
Sbjct: 79  WSTRMENQKQAMEQATRGTGVQVTQTADNRLKLAIPSDISFDTNRSDIKPDFRPVLDRFG 138

Query: 101 TILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYK 160
             LN   STV+ I  HTD+ G+   N  +S +RA   + YLI RGV+  RF ++ G    
Sbjct: 139 NSLNDNASTVVTIIGHTDNTGSAAINDPLSVDRAGRTRDYLISRGVAPYRF-TIEGRGEN 197

Query: 161 YPIDTNDTKVGRQNNQRIEIQIFPR 185
            PI +N+   GR  N+R+EI +  R
Sbjct: 198 DPIASNNDSTGRARNRRVEIFVAER 222


>gi|194334296|ref|YP_002016156.1| OmpA/MotB domain-containing protein [Prosthecochloris aestuarii DSM
           271]
 gi|194312114|gb|ACF46509.1| OmpA/MotB domain protein [Prosthecochloris aestuarii DSM 271]
          Length = 229

 Score = 72.0 bits (175), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 35/95 (36%), Positives = 61/95 (64%), Gaps = 1/95 (1%)

Query: 96  LQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVR 155
           +Q +A+ILNK+  T + I+ HTDS+GT  +N  +S+ RA+ + S L   GV  +R IS  
Sbjct: 127 IQKLASILNKYEDTNVVIEGHTDSVGTESSNQQLSENRAESVASLLRAYGVYGSR-ISTV 185

Query: 156 GFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGNIKK 190
           G+    P+ +N+T  G++ N+R+E+ I+   ++K+
Sbjct: 186 GYGETRPVASNETAQGKKLNRRVEVLIYANDDLKQ 220


>gi|254475762|ref|ZP_05089148.1| OmpA/MotB [Ruegeria sp. R11]
 gi|214030005|gb|EEB70840.1| OmpA/MotB [Ruegeria sp. R11]
          Length = 219

 Score = 72.0 bits (175), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 39/145 (26%), Positives = 74/145 (51%), Gaps = 2/145 (1%)

Query: 43  FGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEV-FLEKKFLPMLQLIAT 101
            G+ LD  E E +  + + GI +   GD +   +P  ++F ++   +       L  +A 
Sbjct: 76  IGNQLDAQERELRQSISNDGITIVNTGDRLIVSLPNDLTFATDSSAISPAVRSDLNKVAA 135

Query: 102 ILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKY 161
            L ++P++++ +  HTDS G+   N  +S+ RA+ +   +   GV  NR  ++ G     
Sbjct: 136 SLVRYPNSLVQVIGHTDSDGSASYNQALSERRANAVADQIQAGGVPYNRL-AIIGRGEDQ 194

Query: 162 PIDTNDTKVGRQNNQRIEIQIFPRG 186
           P+ +N T  G+  N+R+EI + P+G
Sbjct: 195 PVASNLTPEGKARNRRVEIVVIPQG 219


>gi|259417844|ref|ZP_05741763.1| OmpA/MotB [Silicibacter sp. TrichCH4B]
 gi|259346750|gb|EEW58564.1| OmpA/MotB [Silicibacter sp. TrichCH4B]
          Length = 221

 Score = 72.0 bits (175), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 42/144 (29%), Positives = 72/144 (50%), Gaps = 2/144 (1%)

Query: 43  FGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEV-FLEKKFLPMLQLIAT 101
            G  LDK E E +  L +  I +   GD +   +P  ++F ++   +       L+ +A 
Sbjct: 77  IGRELDKQEAELRQSLDNDSISIVNTGDRLIVSLPNDLTFATDSSAISSVVRSDLRKVAG 136

Query: 102 ILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKY 161
            L ++P +V+ +  HTDS G    N  +S+ RA+ +   +   GVS NR + + G     
Sbjct: 137 SLQRYPGSVVQVIGHTDSDGAASYNYSLSERRANAVADEIAAGGVSYNR-MRIIGRGEDQ 195

Query: 162 PIDTNDTKVGRQNNQRIEIQIFPR 185
           P+ +N T  G+  N+R+EI I P+
Sbjct: 196 PVASNLTAEGKARNRRVEIVIIPQ 219


>gi|220918872|ref|YP_002494176.1| OmpA/MotB domain protein [Anaeromyxobacter dehalogenans 2CP-1]
 gi|219956726|gb|ACL67110.1| OmpA/MotB domain protein [Anaeromyxobacter dehalogenans 2CP-1]
          Length = 386

 Score = 72.0 bits (175), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 32/92 (34%), Positives = 52/92 (56%), Gaps = 1/92 (1%)

Query: 95  MLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISV 154
           +L  +A  L   P   +A++ HTD  G    +  +SQ RA+ +++ L  RG+ + R +  
Sbjct: 296 LLDELAQALRDRPRLRVAVEVHTDGAGEAAASKRLSQARAEAVRAALAGRGIEAER-VEA 354

Query: 155 RGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRG 186
           +GF  ++PI +N T  GR  N+R EI+I P G
Sbjct: 355 KGFGAEHPIASNKTARGRAQNRRTEIRILPGG 386


>gi|116327025|ref|YP_796745.1| OmpA-family protein [Leptospira borgpetersenii serovar Hardjo-bovis
           L550]
 gi|116332316|ref|YP_802034.1| OmpA-family protein [Leptospira borgpetersenii serovar Hardjo-bovis
           JB197]
 gi|116119769|gb|ABJ77812.1| OmpA-family protein [Leptospira borgpetersenii serovar Hardjo-bovis
           L550]
 gi|116126005|gb|ABJ77276.1| OmpA-family protein [Leptospira borgpetersenii serovar Hardjo-bovis
           JB197]
          Length = 667

 Score = 72.0 bits (175), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 34/90 (37%), Positives = 52/90 (57%)

Query: 94  PMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFIS 153
           P L  +A I+ + P   I I+ HTD++G  K+NLL+S++RA  I  YL Q+       I 
Sbjct: 575 PELNRLAEIMKENPDIKIQIEGHTDNVGKKKDNLLLSEKRAIAIAEYLSQKHSIPTERIK 634

Query: 154 VRGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
            RGF   +P+  ND++ GR+ N+R+   I 
Sbjct: 635 TRGFGDNFPLSKNDSEEGRRKNRRVNFTIL 664


>gi|262193395|ref|YP_003264604.1| OmpA/MotB domain protein [Haliangium ochraceum DSM 14365]
 gi|262076742|gb|ACY12711.1| OmpA/MotB domain protein [Haliangium ochraceum DSM 14365]
          Length = 458

 Score = 72.0 bits (175), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 30/89 (33%), Positives = 53/89 (59%), Gaps = 1/89 (1%)

Query: 95  MLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISV 154
           +L  +A  L ++PS  + I  HTD  G  + N+ +S+ERAD +K +L+ +G+   R ++ 
Sbjct: 351 ILGDVAATLAEYPSVRVRISGHTDDRGRAEKNVQLSRERADAVKWFLVDKGIEHTRIVTA 410

Query: 155 RGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
            G+  + P+  N T+ GR  N+RIE ++ 
Sbjct: 411 -GYGPERPLADNGTRAGRAKNRRIEFELL 438


>gi|313205418|ref|YP_004044075.1| ompa/motb domain protein [Paludibacter propionicigenes WB4]
 gi|312444734|gb|ADQ81090.1| OmpA/MotB domain protein [Paludibacter propionicigenes WB4]
          Length = 598

 Score = 72.0 bits (175), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 57/95 (60%), Gaps = 1/95 (1%)

Query: 88  LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVS 147
           L+K+   +L  IA  L K P+  I +  HTDS G  + N L+S+ RA  +++YLI+RGV 
Sbjct: 502 LKKRSYTILNEIAKELIKNPAYFIEVHGHTDSKGNSRANKLLSELRASAVRNYLIRRGVD 561

Query: 148 SNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
            NR  SV G+  K P+ TN T  GR  N+R+E  +
Sbjct: 562 GNRIKSV-GYGDKMPVATNKTVKGRTLNRRVEFNV 595


>gi|189347037|ref|YP_001943566.1| OmpA/MotB domain protein [Chlorobium limicola DSM 245]
 gi|189341184|gb|ACD90587.1| OmpA/MotB domain protein [Chlorobium limicola DSM 245]
          Length = 229

 Score = 71.6 bits (174), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 41/149 (27%), Positives = 78/149 (52%), Gaps = 4/149 (2%)

Query: 43  FGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIAT 101
            G+ +DK   E    ++  G  V R+G+ I       + F      +       ++ +A 
Sbjct: 75  IGNYMDKQAAEIDRDVE--GATVERMGEGIRVVFDSGILFSTGSATITATSRDNIERLAR 132

Query: 102 ILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKY 161
           I+N++  T + I+ HTD++G  ++N L+S+ RA+ + + L   GV  +R   V G+    
Sbjct: 133 IINRYDDTNVVIEGHTDTVGNEESNQLLSEHRAEAVSNLLKAYGVYGSRLSPV-GYGESR 191

Query: 162 PIDTNDTKVGRQNNQRIEIQIFPRGNIKK 190
           P+ +N+T+ GR+ N+R+EI I+    +K+
Sbjct: 192 PVASNETESGRRLNRRVEILIYANDELKR 220


>gi|332664040|ref|YP_004446828.1| OmpA/MotB domain-containing protein [Haliscomenobacter hydrossis
           DSM 1100]
 gi|332332854|gb|AEE49955.1| OmpA/MotB domain protein [Haliscomenobacter hydrossis DSM 1100]
          Length = 651

 Score = 71.6 bits (174), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 33/90 (36%), Positives = 58/90 (64%), Gaps = 1/90 (1%)

Query: 94  PMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFIS 153
           P L  +A +LN+ P+  I I  HTD++GT  +NL +S++RA  + +YL+ +G+++ R ++
Sbjct: 563 PELDHLADLLNQNPNLRIQINGHTDNVGTDADNLRLSEQRAKAVYTYLVGKGIAAER-LA 621

Query: 154 VRGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
            +GF    PI  N+T+ GR+ N+R E  + 
Sbjct: 622 YKGFGETQPIADNNTEEGRKVNRRTEFVVL 651


>gi|89889933|ref|ZP_01201444.1| putative outer membrane protein, ompA family [Flavobacteria
           bacterium BBFL7]
 gi|89518206|gb|EAS20862.1| putative outer membrane protein, ompA family [Flavobacteria
           bacterium BBFL7]
          Length = 457

 Score = 71.6 bits (174), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 35/88 (39%), Positives = 52/88 (59%), Gaps = 1/88 (1%)

Query: 95  MLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISV 154
           +L  I  IL K+P+   +I  HTDS+G+ K N  +S  RA+ +K+YL+  G+   R  SV
Sbjct: 369 VLSDITAILKKYPTAKFSIDGHTDSVGSAKLNQRLSDSRANEVKNYLVANGIDEFRLSSV 428

Query: 155 RGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
            G+    P+  N TK GR  N+R+EI +
Sbjct: 429 -GYGEARPVADNKTKTGRAQNRRVEINL 455


>gi|313203887|ref|YP_004042544.1| ompa/motb domain protein [Paludibacter propionicigenes WB4]
 gi|312443203|gb|ADQ79559.1| OmpA/MotB domain protein [Paludibacter propionicigenes WB4]
          Length = 506

 Score = 71.6 bits (174), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 32/95 (33%), Positives = 55/95 (57%), Gaps = 1/95 (1%)

Query: 88  LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVS 147
           ++K    +L  +  ++N  PS  + I  HTD+ G    NL +SQ+RAD +K+YL + GV 
Sbjct: 411 IKKSSFAILNKVVKVMNDNPSYNLEINGHTDNQGAAAMNLTLSQKRADAVKAYLTKNGVD 470

Query: 148 SNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           + + ++ +GF    P+  N T  GR  N+R+E ++
Sbjct: 471 AGK-LAAKGFGQTVPVADNATAAGRAKNRRVEFKV 504


>gi|187923017|ref|YP_001894659.1| OmpA/MotB domain protein [Burkholderia phytofirmans PsJN]
 gi|187714211|gb|ACD15435.1| OmpA/MotB domain protein [Burkholderia phytofirmans PsJN]
          Length = 217

 Score = 71.6 bits (174), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 38/106 (35%), Positives = 58/106 (54%), Gaps = 2/106 (1%)

Query: 76  IPVHVSFVSEVF-LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERA 134
           IP  V+F +  + ++  F P+L  +A  + + P  V  +  HTDS G    N  +S  RA
Sbjct: 102 IPSSVTFDTNSYAVKPSFAPVLDQLAQTMQQNPELVAQVVGHTDSTGQPAYNQTLSVNRA 161

Query: 135 DVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEI 180
           + +  YL QRGV+  R +S +G     PI  N+T+ GR  N+R+EI
Sbjct: 162 ESVTGYLGQRGVAPQR-LSAQGLGQTQPIADNNTEAGRAANRRVEI 206


>gi|310823400|ref|YP_003955758.1| OmpA domain-containing protein [Stigmatella aurantiaca DW4/3-1]
 gi|309396472|gb|ADO73931.1| OmpA domain protein [Stigmatella aurantiaca DW4/3-1]
          Length = 611

 Score = 71.6 bits (174), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 33/96 (34%), Positives = 60/96 (62%), Gaps = 2/96 (2%)

Query: 88  LEKKFLPMLQLIATILNKFPST-VIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGV 146
           ++K+   +L  +A++L + P+   + I+ HTD++G+   N+ +SQ RA  +  YL  +G+
Sbjct: 481 IQKQSFKLLDEVASVLRRNPTLGPVLIEGHTDNVGSRNYNVDLSQRRAKAVLDYLAGKGI 540

Query: 147 SSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
              R +S +GF +  PI TNDT +GR  N+R+E ++
Sbjct: 541 DRKR-LSSKGFGFDQPIATNDTPLGRAKNRRVEFRL 575


>gi|308271281|emb|CBX27889.1| hypothetical protein N47_G32130 [uncultured Desulfobacterium sp.]
          Length = 403

 Score = 71.6 bits (174), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 37/113 (32%), Positives = 63/113 (55%), Gaps = 2/113 (1%)

Query: 70  DMITCYIPVHVSFVSEVF-LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLL 128
           D   C++   V F +E + +  ++ P+L  +  I+ K P   + IQ HTDS GT K N  
Sbjct: 289 DSRGCWVLAGVYFDTEKWNIVSQYFPVLDNVVGIIKKNPDMKLEIQGHTDSRGTEKYNQK 348

Query: 129 ISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQ 181
           +S+ RA  +  YL  +GV  ++ ++ +G+ Y  P   NDT+ G   N+R+E++
Sbjct: 349 LSENRAKSVLEYLAGKGVVRSK-LTAKGYGYSVPAAPNDTEEGMAKNRRVELK 400


>gi|254463375|ref|ZP_05076791.1| OmpA family domain protein [Rhodobacterales bacterium HTCC2083]
 gi|206679964|gb|EDZ44451.1| OmpA family domain protein [Rhodobacteraceae bacterium HTCC2083]
          Length = 222

 Score = 71.2 bits (173), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 42/139 (30%), Positives = 69/139 (49%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSE-VFLEKKFLPMLQLIATILNK 105
           LDK   E Q  L +  + ++  GD +   +P  ++F S+   L       L  +AT L  
Sbjct: 83  LDKQAAELQKSLGNDRVTITNTGDRLIVSLPQDITFASDSATLSSGIQSDLNAVATNLQS 142

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +P++ + +  HTDS G    N  +S +RA+ + + L   GVS  R   + G     P+ +
Sbjct: 143 YPNSTVQVIGHTDSTGEAGYNQNLSVQRANSVVNVLAGAGVSFTRLQGI-GRGEDQPVAS 201

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T+ G+  N+R+EI I P
Sbjct: 202 NLTEEGKAQNRRVEIVILP 220


>gi|34497346|ref|NP_901561.1| outer membrane protein [Chromobacterium violaceum ATCC 12472]
 gi|34103202|gb|AAQ59565.1| probable outer membrane protein [Chromobacterium violaceum ATCC
           12472]
          Length = 223

 Score = 71.2 bits (173), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 46/142 (32%), Positives = 71/142 (50%), Gaps = 3/142 (2%)

Query: 43  FGSSLDKAEDEFQMQLQDTGIVVSRIGD-MITCYIPVHVSFVSEVF-LEKKFLPMLQLIA 100
           +   + K ++  +   + TGI VS+  D  +   IP   SF +  + L+    P+L  +A
Sbjct: 76  WSQHMQKQKEAMEQATKGTGIGVSQTADNRLKINIPSDASFDTNSYALKPSLKPVLDKLA 135

Query: 101 TILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYK 160
           T L + P T + I  HTD+ G+   N  +S  RA   + YL  RGV  NR I + G   +
Sbjct: 136 TTLQQNPVTSVNIIGHTDNTGSDAINNPLSVNRAKATQGYLASRGVDINR-IGIDGRGSR 194

Query: 161 YPIDTNDTKVGRQNNQRIEIQI 182
            P+  N T  GR  N+R+EI +
Sbjct: 195 EPVADNGTVSGRAMNRRVEIYV 216


>gi|149921395|ref|ZP_01909848.1| OmpA domain protein [Plesiocystis pacifica SIR-1]
 gi|149817715|gb|EDM77180.1| OmpA domain protein [Plesiocystis pacifica SIR-1]
          Length = 224

 Score = 71.2 bits (173), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 37/95 (38%), Positives = 55/95 (57%), Gaps = 1/95 (1%)

Query: 85  EVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQR 144
           E  +E +  P+L+ IA +L   P   I I  HTDS G  + N  +SQ R D ++ +L+  
Sbjct: 120 ESTIEPRSFPLLKDIAFVLGYSPQVTIQIAGHTDSKGRSEYNEGLSQRRVDSVREHLLSL 179

Query: 145 GVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIE 179
           GV+  +  SV G+    PIDTN T+ GR +N+R+E
Sbjct: 180 GVNDQQLSSV-GYGEMTPIDTNRTEAGRAHNRRVE 213


>gi|127511243|ref|YP_001092440.1| OmpA/MotB domain-containing protein [Shewanella loihica PV-4]
 gi|126636538|gb|ABO22181.1| OmpA/MotB domain protein [Shewanella loihica PV-4]
          Length = 201

 Score = 71.2 bits (173), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 60/93 (64%), Gaps = 2/93 (2%)

Query: 87  FLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQR-G 145
           +++ ++   ++++AT + ++P+T + I+ H    G+ ++NL +SQ RAD + S L +R G
Sbjct: 85  YIDPQYYDQVEVVATFMRQYPNTKVTIEGHCSKTGSYEHNLALSQNRADAVTSLLSERFG 144

Query: 146 VSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRI 178
           ++S+R  ++ G++Y  P+D   TK+    N+R+
Sbjct: 145 IASDRLTAI-GYSYDRPVDPTHTKMAHTRNRRV 176


>gi|227873496|ref|ZP_03991745.1| OmpA family membrane protein [Oribacterium sinus F0268]
 gi|227840670|gb|EEJ51051.1| OmpA family membrane protein [Oribacterium sinus F0268]
          Length = 414

 Score = 71.2 bits (173), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 57/90 (63%), Gaps = 3/90 (3%)

Query: 95  MLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISV 154
           +L  +AT+L +   T   I  HTDS+ T ++N ++S+ RA+ +KSYL  +GV++   I+ 
Sbjct: 326 ILNDLATVLKEGGITAFQIDGHTDSMDTDEHNQVLSENRANSVKSYLASQGVTAE--ITT 383

Query: 155 RGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
            G+    P+ TNDT  GRQ N+R+EI I P
Sbjct: 384 HGYGESRPVATNDTAEGRQQNRRVEI-IVP 412


>gi|197124193|ref|YP_002136144.1| OmpA/MotB domain protein [Anaeromyxobacter sp. K]
 gi|196174042|gb|ACG75015.1| OmpA/MotB domain protein [Anaeromyxobacter sp. K]
          Length = 543

 Score = 71.2 bits (173), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 32/89 (35%), Positives = 55/89 (61%), Gaps = 2/89 (2%)

Query: 95  MLQLIATILNKFPST-VIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFIS 153
           +L  +A ++   P   V+ I+ HTDS G+   N  +SQ+RA+ +K YL+ +GV ++R + 
Sbjct: 451 LLDDVAKLIAANPQVGVVTIEGHTDSTGSAATNRALSQKRAEAVKDYLVSKGVDASR-LE 509

Query: 154 VRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
            +GF    P+++N T  GR+ N+R+E  I
Sbjct: 510 AKGFGPDQPVESNKTAKGREANRRVEFTI 538


>gi|260062849|ref|YP_003195929.1| OmpA family protein [Robiginitalea biformata HTCC2501]
 gi|88784417|gb|EAR15587.1| OmpA family protein [Robiginitalea biformata HTCC2501]
          Length = 231

 Score = 71.2 bits (173), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 42/148 (28%), Positives = 78/148 (52%), Gaps = 8/148 (5%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIP----VHVSFVSEVFLEKKFLPMLQLIATI 102
           +D+  ++ + +L   G  V R+G+ I         VH +  ++  +E   +  L  +A I
Sbjct: 79  MDRQAEKIEEEL--PGAEVKRVGEGINVTFTQDQGVHFA-TNQSAIEGASVTTLNKLAGI 135

Query: 103 LNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYP 162
             ++P +VI ++ HTDS G    N+ +SQ RA+ + +YL+ +G+  +RF +VR +    P
Sbjct: 136 FKEYPKSVILVEGHTDSAGPEDYNMSLSQRRAESVVNYLVAQGIDKDRF-TVRWYGETQP 194

Query: 163 IDTNDTKVGRQNNQRIEIQIFPRGNIKK 190
              N T  G+  N+R+E+ I     +K+
Sbjct: 195 RADNSTAEGKAQNRRVEMGIIASEALKE 222


>gi|115372712|ref|ZP_01460018.1| hypothetical protein STIAU_6203 [Stigmatella aurantiaca DW4/3-1]
 gi|115370193|gb|EAU69122.1| hypothetical protein STIAU_6203 [Stigmatella aurantiaca DW4/3-1]
          Length = 334

 Score = 71.2 bits (173), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 33/101 (32%), Positives = 61/101 (60%), Gaps = 2/101 (1%)

Query: 83  VSEVFLEKKFLPMLQLIATILNKFPS-TVIAIQSHTDSIGTLKNNLLISQERADVIKSYL 141
             +  ++K+   +L  +A++L + P+   + I+ HTD++G+   N+ +SQ RA  +  YL
Sbjct: 199 TGQAKIQKQSFKLLDEVASVLRRNPTLGPVLIEGHTDNVGSRNYNVDLSQRRAKAVLDYL 258

Query: 142 IQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
             +G+   R +S +GF +  PI TNDT +GR  N+R+E ++
Sbjct: 259 AGKGIDRKR-LSSKGFGFDQPIATNDTPLGRAKNRRVEFRL 298


>gi|295134535|ref|YP_003585211.1| OmpA/MotB family outer hypothetical protein [Zunongwangia profunda
           SM-A87]
 gi|294982550|gb|ADF53015.1| OmpA/MotB family outer membrane protein [Zunongwangia profunda
           SM-A87]
          Length = 232

 Score = 71.2 bits (173), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 42/150 (28%), Positives = 77/150 (51%), Gaps = 6/150 (4%)

Query: 44  GSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVH--VSFVSEVF-LEKKFLPMLQLIA 100
           G+ +DK   + + ++   G  V R+G+ I      +  V F +E + +  K    L  +A
Sbjct: 77  GNRMDKQAKKIETEV--PGAEVERVGEGINVTFDENSGVYFATEKYNINAKSEETLNKLA 134

Query: 101 TILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYK 160
            I  ++P T I ++ HTD+ G+   NL +S+ RA  + ++L   G++++RF   + +   
Sbjct: 135 NIFKEYPDTNILVEGHTDNTGSESYNLTLSKNRAQAVTNFLTDHGIAASRF-DTKWYGEA 193

Query: 161 YPIDTNDTKVGRQNNQRIEIQIFPRGNIKK 190
            P   N T  GR  N+R+EI I    ++K+
Sbjct: 194 QPKYDNSTAEGRSKNRRVEIAIVANEDLKQ 223


>gi|260061425|ref|YP_003194505.1| Thrombospondin type 3 repeat:OmpA/MotB [Robiginitalea biformata
           HTCC2501]
 gi|88785557|gb|EAR16726.1| Thrombospondin type 3 repeat:OmpA/MotB [Robiginitalea biformata
           HTCC2501]
          Length = 446

 Score = 70.9 bits (172), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 56/81 (69%), Gaps = 1/81 (1%)

Query: 102 ILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKY 161
           IL+++P++   ++ HTDS+G+   N  +S+ERA+ ++ +LI  G+ ++R  +V G+  + 
Sbjct: 364 ILDQYPNSRFTVEGHTDSVGSNSLNQKLSEERANSVRDFLINEGIDASRLEAV-GYGEER 422

Query: 162 PIDTNDTKVGRQNNQRIEIQI 182
           PI TN+T+ GR  N+R+EI +
Sbjct: 423 PIATNNTRAGRTQNRRVEINL 443


>gi|311695725|gb|ADP98598.1| OmpA/MotB domain protein [marine bacterium HP15]
          Length = 269

 Score = 70.9 bits (172), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 41/138 (29%), Positives = 75/138 (54%), Gaps = 11/138 (7%)

Query: 54  FQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAI 113
            Q +  D G+V++ +GD++       +    E  + +        +A  + ++ +  + +
Sbjct: 141 MQAEQTDRGMVLT-LGDVLFDLNRAELKPAGETTVGR--------LAEFMAEYENRRVRV 191

Query: 114 QSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQ 173
           + +TDS G    N  +S+ RA+ ++  L+ RG++  R I V+GF  +YP+ TN+T  GRQ
Sbjct: 192 EGYTDSTGAESYNQQLSERRAEAVREALMDRGINRAR-IEVQGFGEQYPVATNETPAGRQ 250

Query: 174 NNQRIEIQIF-PRGNIKK 190
            N+R+EI I    GNIK+
Sbjct: 251 QNRRVEIVISDADGNIKE 268


>gi|220918973|ref|YP_002494277.1| OmpA/MotB domain protein [Anaeromyxobacter dehalogenans 2CP-1]
 gi|219956827|gb|ACL67211.1| OmpA/MotB domain protein [Anaeromyxobacter dehalogenans 2CP-1]
          Length = 544

 Score = 70.9 bits (172), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 32/89 (35%), Positives = 55/89 (61%), Gaps = 2/89 (2%)

Query: 95  MLQLIATILNKFPST-VIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFIS 153
           +L  +A ++   P   V+ I+ HTDS G+   N  +SQ+RA+ +K YL+ +GV ++R + 
Sbjct: 452 LLDDVAKLVAANPQVGVVTIEGHTDSTGSAATNRALSQKRAEAVKDYLVSKGVDASR-LE 510

Query: 154 VRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
            +GF    P+++N T  GR+ N+R+E  I
Sbjct: 511 AKGFGPDQPVESNKTAKGREANRRVEFTI 539


>gi|124004618|ref|ZP_01689462.1| OmpA family protein [Microscilla marina ATCC 23134]
 gi|123989741|gb|EAY29270.1| OmpA family protein [Microscilla marina ATCC 23134]
          Length = 247

 Score = 70.9 bits (172), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 56/88 (63%), Gaps = 1/88 (1%)

Query: 96  LQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVR 155
           L  I  +L K+P   + I+ HTDS+G  + N  +S +RA  +++Y +++G++++R + V 
Sbjct: 160 LNAIVKLLKKYPKARLLIEGHTDSVGNTQKNKALSLKRASFVQAYFVRQGIAAHR-LKVI 218

Query: 156 GFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
           G     PI +NDT VGR  N+RIE+++ 
Sbjct: 219 GKGATTPIASNDTAVGRSKNRRIEVRLI 246


>gi|226939690|ref|YP_002794763.1| OmpA/MotB [Laribacter hongkongensis HLHK9]
 gi|226714616|gb|ACO73754.1| OmpA/MotB [Laribacter hongkongensis HLHK9]
          Length = 225

 Score = 70.9 bits (172), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 44/135 (32%), Positives = 72/135 (53%), Gaps = 14/135 (10%)

Query: 55  QMQLQ---DTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTV 110
           QMQLQ   D  +VV+   D          +F ++   ++  F P +  +A  L ++  T 
Sbjct: 97  QMQLQQNADQSLVVTMNED---------ATFNLNSAVVKPAFYPTMNKVAETLKQYNQTT 147

Query: 111 IAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKV 170
           + I+ +TDS G    N  +S +RA+ +KSYL+ +GV++NR  ++ G     P  +NDT  
Sbjct: 148 LVIRGYTDSTGAAAYNQQLSLKRANAVKSYLVGQGVAANRIQTI-GMGESDPRASNDTAQ 206

Query: 171 GRQNNQRIEIQIFPR 185
           GR  N+R+ I I P+
Sbjct: 207 GRAMNRRVSITIVPQ 221


>gi|88802038|ref|ZP_01117566.1| outer membrane protein [Polaribacter irgensii 23-P]
 gi|88782696|gb|EAR13873.1| outer membrane protein [Polaribacter irgensii 23-P]
          Length = 450

 Score = 70.9 bits (172), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 31/87 (35%), Positives = 55/87 (63%), Gaps = 1/87 (1%)

Query: 96  LQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVR 155
           L  +  I+N+FP    AI+ +TD  G++  NL +S  RA+ +K YL++ G+ + R ++V 
Sbjct: 363 LDGMLAIINEFPQANFAIRGYTDVSGSVSGNLKLSNSRANAVKDYLVKNGIDAAR-LTVA 421

Query: 156 GFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           GF  + P  +N T+ GR  N+R+E+++
Sbjct: 422 GFGQESPTASNKTRAGRIQNRRVEVKV 448


>gi|124009612|ref|ZP_01694285.1| thrombospondin type 3 repeat:OmpA/MotB [Microscilla marina ATCC
           23134]
 gi|123984753|gb|EAY24733.1| thrombospondin type 3 repeat:OmpA/MotB [Microscilla marina ATCC
           23134]
          Length = 493

 Score = 70.9 bits (172), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 32/90 (35%), Positives = 56/90 (62%), Gaps = 1/90 (1%)

Query: 93  LPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFI 152
            P+L  ++ +L K+ ST I ++ HTD+ G    NL +S++RA  +  YLI++G++ +R  
Sbjct: 402 FPVLNELSELLKKYASTKIYLEGHTDNQGDDDANLKLSKDRAQAVADYLIKKGIAKSRIE 461

Query: 153 SVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           S  GF    PI  N T  GR+ N+R+++++
Sbjct: 462 ST-GFGETKPIADNKTAAGRKKNRRVDMKL 490


>gi|298369467|ref|ZP_06980784.1| OmpA family protein [Neisseria sp. oral taxon 014 str. F0314]
 gi|298282024|gb|EFI23512.1| OmpA family protein [Neisseria sp. oral taxon 014 str. F0314]
          Length = 224

 Score = 70.9 bits (172), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 43/149 (28%), Positives = 73/149 (48%), Gaps = 2/149 (1%)

Query: 43  FGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVS-EVFLEKKFLPMLQLIAT 101
            G  +D    + +  L +T + V + G+ I   +P +V+F +    L       L   + 
Sbjct: 73  VGGYMDYQAKKLRESLANTDVKVEQQGNQIKLVMPENVTFATNSATLSANARDALTAASK 132

Query: 102 ILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKY 161
            L ++P T + I  HTD+ G+   N  +S+ RA  + S+L  +GV+ +R  +  G   + 
Sbjct: 133 TLVQYPDTTLTINGHTDNTGSDAINDPLSRNRAQSVASFLQSQGVAGSRLTTA-GHGSRQ 191

Query: 162 PIDTNDTKVGRQNNQRIEIQIFPRGNIKK 190
           P+ +N T  GR  N+R+EI I P  N  K
Sbjct: 192 PVASNATPEGRAQNRRVEILINPDQNAIK 220


>gi|91782349|ref|YP_557555.1| OmpA/MotB family outer membrane protein [Burkholderia xenovorans
           LB400]
 gi|296162308|ref|ZP_06845102.1| OmpA/MotB domain protein [Burkholderia sp. Ch1-1]
 gi|91686303|gb|ABE29503.1| outer membrane protein, OmpA/MotB family [Burkholderia xenovorans
           LB400]
 gi|295887462|gb|EFG67286.1| OmpA/MotB domain protein [Burkholderia sp. Ch1-1]
          Length = 217

 Score = 70.9 bits (172), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 37/106 (34%), Positives = 58/106 (54%), Gaps = 2/106 (1%)

Query: 76  IPVHVSFVSEVF-LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERA 134
           IP  V+F +  + ++  F P+L  +A  + + P  +  +  HTDS G    N  +S  RA
Sbjct: 102 IPSSVTFDTNSYAVKPSFAPVLDQLAQTMQQNPELIAQVVGHTDSTGQPAYNQTLSVNRA 161

Query: 135 DVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEI 180
           + +  YL QRGV+  R +S +G     PI  N+T+ GR  N+R+EI
Sbjct: 162 ESVTGYLGQRGVAPQR-LSAQGMGQTQPIADNNTEAGRAANRRVEI 206


>gi|322418762|ref|YP_004197985.1| OmpA/MotB domain-containing protein [Geobacter sp. M18]
 gi|320125149|gb|ADW12709.1| OmpA/MotB domain protein [Geobacter sp. M18]
          Length = 465

 Score = 70.5 bits (171), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 32/101 (31%), Positives = 60/101 (59%), Gaps = 2/101 (1%)

Query: 83  VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLI 142
           + +  +  +    +  +   + K+P+T   I+ HTD++G+  +N+ +SQ RA+ + S+L+
Sbjct: 236 IDQAIIRTELHDQIAQVGNFMKKYPTTTAVIEGHTDNVGSYNHNMDLSQRRAEAVVSHLV 295

Query: 143 -QRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
            Q G+  +R +S +G+ +  PI  N T+ GRQ N+RIE  I
Sbjct: 296 EQYGIDRSR-LSAKGYGFTRPIADNATEEGRQKNRRIEAVI 335



 Score = 55.1 bits (131), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 28/85 (32%), Positives = 48/85 (56%), Gaps = 2/85 (2%)

Query: 99  IATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQR-GVSSNRFISVRGF 157
           +A  + ++ +T   I+ HTD+ G+   N+ +SQ+RA  +  YL+   G+  +R +S +G+
Sbjct: 376 VADYMKRYTTTTAVIEGHTDNTGSPSQNMKLSQQRAQNVVDYLVNNFGIERSR-LSAKGY 434

Query: 158 AYKYPIDTNDTKVGRQNNQRIEIQI 182
                +  NDT  GRQ N+RI   I
Sbjct: 435 GATRRVAYNDTPEGRQKNRRINAVI 459


>gi|30249028|ref|NP_841098.1| outer membrane protein [Nitrosomonas europaea ATCC 19718]
 gi|30138645|emb|CAD84936.1| Bacterial outer membrane protein [Nitrosomonas europaea ATCC 19718]
          Length = 220

 Score = 70.5 bits (171), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 48/136 (35%), Positives = 68/136 (50%), Gaps = 5/136 (3%)

Query: 51  EDEFQMQ--LQDTGIVVSRIGD-MITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKF 106
           E + QM+     TG+VVS+  D  +   IP  +SF      ++  F P+L   AT L   
Sbjct: 77  EQKIQMENATAGTGVVVSQTPDNQLMLNIPSDISFDTGSAQIKPDFRPILDSFATSLLNN 136

Query: 107 PSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTN 166
           P T + I  HTDS G+   N  +S  RA   + YL  RGV   R I + G     P+ +N
Sbjct: 137 PGTRVTIVGHTDSTGSDAVNNPLSVNRAASTREYLASRGVPFQR-IQIDGRGSYQPVASN 195

Query: 167 DTKVGRQNNQRIEIQI 182
           +T  GR  N+R+EI +
Sbjct: 196 NTAAGRAKNRRVEIYV 211


>gi|162448390|ref|YP_001610757.1| putative ompA family protein [Sorangium cellulosum 'So ce 56']
 gi|161158972|emb|CAN90277.1| putative ompA family protein [Sorangium cellulosum 'So ce 56']
          Length = 617

 Score = 70.5 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 35/93 (37%), Positives = 54/93 (58%), Gaps = 2/93 (2%)

Query: 94  PMLQLIATILNKFPS-TVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFI 152
           P+L  +A +L + P  T I +Q HTD  G    N+ +SQ RA+ +   L+QRG+ + R  
Sbjct: 517 PLLDEVAGVLKEHPEITKIEVQGHTDPRGGRAYNIKLSQARAESVTKALVQRGIEAERLA 576

Query: 153 SVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPR 185
           S +G+    PI  NDT  GRQ N+R++ +I  +
Sbjct: 577 S-KGYGPDVPIAENDTDEGRQKNRRVQFKILEK 608


>gi|73540381|ref|YP_294901.1| OmpA [Ralstonia eutropha JMP134]
 gi|72117794|gb|AAZ60057.1| OmpA [Ralstonia eutropha JMP134]
          Length = 212

 Score = 70.5 bits (171), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 38/110 (34%), Positives = 59/110 (53%), Gaps = 2/110 (1%)

Query: 76  IPVHVSFVSE-VFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERA 134
           IP  V+F ++   ++  F  +L  +A  L +    V  +  HTDS G  + N+ +SQ RA
Sbjct: 101 IPSQVTFDTDSATIKPSFRSVLDQVAQTLGQHQDVVANVVGHTDSTGNAQYNMQLSQRRA 160

Query: 135 DVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
             + +YL  RGV+ NR +S  G     P+  N T+ GR  N+R+EI + P
Sbjct: 161 QSVATYLGDRGVARNR-LSAEGRGQTQPVADNATEAGRTQNRRVEIFLKP 209


>gi|307545103|ref|YP_003897582.1| OmpA/MotB [Halomonas elongata DSM 2581]
 gi|307217127|emb|CBV42397.1| OmpA/MotB [Halomonas elongata DSM 2581]
          Length = 270

 Score = 70.5 bits (171), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 31/89 (34%), Positives = 56/89 (62%), Gaps = 1/89 (1%)

Query: 95  MLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISV 154
           +L  +A+ L    +  + I+ HTDS+G  + N  +SQ RAD + S+L  +G+++NR  ++
Sbjct: 182 VLTDVASKLRANENVRVRIEGHTDSVGPAQYNKDLSQRRADSVASFLASQGIAANRMTTI 241

Query: 155 RGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
            G+  + P+ +NDTK GR  N+R+E+  +
Sbjct: 242 -GYGEEQPVASNDTKAGRAENRRVELGEW 269


>gi|312130324|ref|YP_003997664.1| v-type h(+)-translocating pyrophosphatase [Leadbetterella
           byssophila DSM 17132]
 gi|311906870|gb|ADQ17311.1| V-type H(+)-translocating pyrophosphatase [Leadbetterella
           byssophila DSM 17132]
          Length = 878

 Score = 70.5 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 35/84 (41%), Positives = 53/84 (63%), Gaps = 1/84 (1%)

Query: 99  IATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFA 158
           IA IL ++P   I +  +TD+ GT + NL +S+ERA  +K  LI  G+S +R +S  GF 
Sbjct: 793 IAAILKEYPQVKIKVGGYTDNTGTPEGNLKLSEERATNVKKALIALGISEDR-LSSEGFG 851

Query: 159 YKYPIDTNDTKVGRQNNQRIEIQI 182
            ++P+  N T+ GRQ N+RI I +
Sbjct: 852 QEHPVADNTTEEGRQKNRRIAISV 875


>gi|284035576|ref|YP_003385506.1| OmpA/MotB domain protein [Spirosoma linguale DSM 74]
 gi|283814869|gb|ADB36707.1| OmpA/MotB domain protein [Spirosoma linguale DSM 74]
          Length = 306

 Score = 70.5 bits (171), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 31/87 (35%), Positives = 56/87 (64%), Gaps = 1/87 (1%)

Query: 94  PMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFIS 153
           P L+ +   +   P+  I +  HTD+ G    NLL+S++R +VIK+YL++ G+ ++R I+
Sbjct: 216 PALEQLLQFMQSQPTAEIELSGHTDNQGDFDQNLLLSKQRVEVIKAYLVKNGIPASR-IT 274

Query: 154 VRGFAYKYPIDTNDTKVGRQNNQRIEI 180
            RG+    PI +N+++  RQ N+R+E+
Sbjct: 275 TRGYGPTRPIASNNSETTRQQNRRVEM 301


>gi|224373377|ref|YP_002607749.1| major outer membrane protein [Nautilia profundicola AmH]
 gi|223589055|gb|ACM92791.1| major outer membrane protein [Nautilia profundicola AmH]
          Length = 209

 Score = 70.5 bits (171), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 35/98 (35%), Positives = 63/98 (64%), Gaps = 2/98 (2%)

Query: 84  SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQ 143
           ++  ++K + P LQ +A IL   P+  I +  HTD+IG+ + NL +SQ+RA+ +K+ L+ 
Sbjct: 106 NKAVVKKIYYPELQKVAEILKNNPNLKIEVAGHTDNIGSDEYNLKLSQKRAEAVKNILVN 165

Query: 144 R-GVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEI 180
           + G+  +R ++ +G+  KYP+  N T+  R  N+R+EI
Sbjct: 166 KFGIDPSRIVA-KGYGEKYPLVPNTTETNRALNRRVEI 202


>gi|307826004|ref|ZP_07656218.1| OmpA/MotB domain protein [Methylobacter tundripaludum SV96]
 gi|307732979|gb|EFO03842.1| OmpA/MotB domain protein [Methylobacter tundripaludum SV96]
          Length = 266

 Score = 70.5 bits (171), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 46/171 (26%), Positives = 86/171 (50%), Gaps = 26/171 (15%)

Query: 26  KKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDT------------GIVVSRIGDMI- 72
           +KV L ++  +   +KR    L    DE +++ +D             GI+V+ +GD++ 
Sbjct: 91  RKVDLARATASQTASKRAFEELSAKRDEIRLKARDAEIARLKAKKVPQGILVT-LGDVLF 149

Query: 73  -TCYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQ 131
            T    +    +  ++      P+++     L     T++ I+ HTD+ G+   N  +SQ
Sbjct: 150 DTARSDLKAGSLQNIY------PLVEY----LKVHADTMVKIEGHTDNQGSSDYNAQLSQ 199

Query: 132 ERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
            RA+ ++++L+  GV+  R I+ +G    YPI TN +  GRQ N+R+E+ I
Sbjct: 200 RRAEAVRNFLVTNGVAPER-ITAQGMGKDYPIATNSSAAGRQQNRRVEVTI 249


>gi|108763506|ref|YP_633737.1| OmpA domain-containing protein [Myxococcus xanthus DK 1622]
 gi|108467386|gb|ABF92571.1| OmpA domain protein [Myxococcus xanthus DK 1622]
          Length = 2699

 Score = 70.5 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 38/122 (31%), Positives = 68/122 (55%), Gaps = 3/122 (2%)

Query: 69   GDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPST-VIAIQSHTDSIGTLKNNL 127
            G+ I     V+ +   +V L +   P+L+ +A +L   P   ++ I+ HTD  G    NL
Sbjct: 2574 GERIVILEKVYFATGKDVILARSH-PLLKQVAAVLRANPQVELVRIEGHTDDQGNDAKNL 2632

Query: 128  LISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGN 187
             +SQ RA+ ++++L++ G++  R  +V G+    P+DTN T  GR+NN+R+   I   G 
Sbjct: 2633 DLSQRRANNVRAFLVKEGIAEGRMEAV-GYGETKPVDTNKTAKGRENNRRVGFTILRVGK 2691

Query: 188  IK 189
            ++
Sbjct: 2692 VE 2693


>gi|86131069|ref|ZP_01049668.1| OmpA family protein [Dokdonia donghaensis MED134]
 gi|85818480|gb|EAQ39640.1| OmpA family protein [Dokdonia donghaensis MED134]
          Length = 470

 Score = 70.5 bits (171), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 54/88 (61%), Gaps = 1/88 (1%)

Query: 96  LQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVR 155
           L  +A+++ ++P+T   I+ HTD  G    NL +S +RA  ++SYL  +G+ ++R  S +
Sbjct: 382 LDKVASVMMEYPTTRFLIEGHTDDRGRDAYNLDLSDQRAASVRSYLTGKGIPASRLES-K 440

Query: 156 GFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
           GF    P+ +N T  GRQ N+R+E+ I 
Sbjct: 441 GFGEARPVASNKTAAGRQENRRVELSIL 468


>gi|253582159|ref|ZP_04859382.1| outer membrane protein OmpF [Fusobacterium varium ATCC 27725]
 gi|251835698|gb|EES64236.1| outer membrane protein OmpF [Fusobacterium varium ATCC 27725]
          Length = 186

 Score = 70.5 bits (171), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 49/176 (27%), Positives = 88/176 (50%), Gaps = 4/176 (2%)

Query: 5   LGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIV 64
           L LS  ++  ++GC    ++  K  + +  + + + +    S    E+   +   + G+ 
Sbjct: 6   LMLSASLIVILTGCSSVDKQPLKELVIEETENEFIMEDIDVSKKTLEE--IIVFNEKGVT 63

Query: 65  VSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTL 123
           + R G+ +   +P  V F  ++  ++ K    L  +A  L + P   I I  +TD IG+ 
Sbjct: 64  IRREGNNLVLSMPELVLFDFNKYEVKNKVKGSLNALAKALEENPDIRIKIDGYTDFIGSE 123

Query: 124 KNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIE 179
             NL +S +RA+ IK YL  RGV  +  IS+ G+  + PI +N T+ GR  N+R+E
Sbjct: 124 GYNLELSVKRANAIKDYLTNRGVKPSN-ISIEGYGKQNPIASNQTETGRAKNRRVE 178


>gi|224417733|ref|ZP_03655739.1| CADF precursor [Helicobacter canadensis MIT 98-5491]
 gi|253827077|ref|ZP_04869962.1| outer membrane protein OprF [Helicobacter canadensis MIT 98-5491]
 gi|313141275|ref|ZP_07803468.1| cadf [Helicobacter canadensis MIT 98-5491]
 gi|253510483|gb|EES89142.1| outer membrane protein OprF [Helicobacter canadensis MIT 98-5491]
 gi|313130306|gb|EFR47923.1| cadf [Helicobacter canadensis MIT 98-5491]
          Length = 306

 Score = 70.1 bits (170), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 30/92 (32%), Positives = 57/92 (61%), Gaps = 1/92 (1%)

Query: 92  FLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRF 151
           + P +Q  A  +++ P     I  HTDS G+   N  +S++RA  +K+ ++++G+SS R 
Sbjct: 213 YYPEIQDFAKYMDQNPDKTAVINGHTDSTGSAAYNQKLSEKRAQSVKNEIVKQGISSER- 271

Query: 152 ISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
           +  +G+  + PI +N T+ GRQ N+R+E +++
Sbjct: 272 LEAKGYGEEKPIASNKTREGRQKNRRVEAEVY 303


>gi|262198423|ref|YP_003269632.1| OmpA/MotB domain protein [Haliangium ochraceum DSM 14365]
 gi|262081770|gb|ACY17739.1| OmpA/MotB domain protein [Haliangium ochraceum DSM 14365]
          Length = 1264

 Score = 70.1 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 36/90 (40%), Positives = 59/90 (65%), Gaps = 2/90 (2%)

Query: 95   MLQLIATILNKFPS-TVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFIS 153
            M   +A IL+  PS  +I I+ +TD  G L+ NL ISQ RA++++++LI RGV+ +R  +
Sbjct: 1175 MFAEVAAILHAHPSLRLIQIEGYTDDRGDLEANLRISQHRAEIVRAFLIARGVAEHRLRA 1234

Query: 154  VRGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
            V G+    PI  N ++ GR+ N+R+E++I 
Sbjct: 1235 V-GYGSARPIGDNRSERGRELNRRVELRIL 1263


>gi|134094293|ref|YP_001099368.1| putative outer membrane protein; putative peptidoglycan-associated
           (lipo)-protein [Herminiimonas arsenicoxydans]
 gi|133738196|emb|CAL61241.1| conserved hypothetical protein; putative OmpA domain [Herminiimonas
           arsenicoxydans]
          Length = 225

 Score = 70.1 bits (170), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 44/142 (30%), Positives = 71/142 (50%), Gaps = 3/142 (2%)

Query: 43  FGSSLDKAEDEFQMQLQDTGIVVSRIGD-MITCYIPVHVSFVS-EVFLEKKFLPMLQLIA 100
           + S ++  +   +   Q TG+ V++  D  +   IP  +SF +    +   F P+L   A
Sbjct: 70  WSSRMENQKRAMEQATQGTGVQVTQTSDNRLKLDIPSDISFATGRSDINSSFRPILDRFA 129

Query: 101 TILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYK 160
           T L   P+  + I  HTDS G+   N  +S +RA   + YL  RGV+  R I V G   +
Sbjct: 130 TGLVDNPAATVTIIGHTDSTGSDAINNPLSFDRASRTRDYLAGRGVAPQR-IHVDGRGSR 188

Query: 161 YPIDTNDTKVGRQNNQRIEIQI 182
            P+ +N  + GR  N+R+EI +
Sbjct: 189 EPVASNANEAGRARNRRVEIYV 210


>gi|317402399|gb|EFV82971.1| OmpA family protein [Achromobacter xylosoxidans C54]
          Length = 232

 Score = 70.1 bits (170), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 40/109 (36%), Positives = 60/109 (55%), Gaps = 2/109 (1%)

Query: 76  IPVHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERA 134
           IP +VSF   +  L+   LP+L  +A  LN+ P     +  HTDS G L +N  +S  RA
Sbjct: 121 IPSNVSFDTDKTDLKPALLPVLDSVARSLNQHPELRAKVVGHTDSTGALAHNQTLSVNRA 180

Query: 135 DVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
             +  YL ++GV++ R +SV G     PI  N T  GR  N+R+E+ ++
Sbjct: 181 RSVTDYLSRQGVAATR-LSVEGRGPSDPIGDNATAEGRALNRRVEVYLY 228


>gi|300313671|ref|YP_003777763.1| OmpA family protein [Herbaspirillum seropedicae SmR1]
 gi|300076456|gb|ADJ65855.1| OmpA family protein [Herbaspirillum seropedicae SmR1]
          Length = 241

 Score = 70.1 bits (170), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 72/140 (51%), Gaps = 3/140 (2%)

Query: 43  FGSSLDKAEDEFQMQLQDTGIVVSRIGD-MITCYIPVHVSF-VSEVFLEKKFLPMLQLIA 100
           + + ++  +   +   Q TG+ VS+  D  +   IP  +SF      ++ +  P+L   A
Sbjct: 72  WSNRMENQKRAMEEATQGTGVQVSQTADNRLKLEIPSDISFDTGRADIKPEMRPVLDRFA 131

Query: 101 TILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYK 160
             L + P+T + I  HTD+ G+   N  +S +RA   + YL  RGV++NRF S++G    
Sbjct: 132 ATLVENPATTVTIVGHTDNTGSDAINDPLSLQRASRTRDYLSSRGVAANRF-SIQGRGSH 190

Query: 161 YPIDTNDTKVGRQNNQRIEI 180
            P+  N +   R  N+R+EI
Sbjct: 191 EPLVANTSDANRARNRRVEI 210


>gi|86160165|ref|YP_466950.1| OmpA/MotB family outer membrane protein [Anaeromyxobacter
           dehalogenans 2CP-C]
 gi|85776676|gb|ABC83513.1| outer membrane protein, OmpA/MotB family [Anaeromyxobacter
           dehalogenans 2CP-C]
          Length = 542

 Score = 70.1 bits (170), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 32/89 (35%), Positives = 55/89 (61%), Gaps = 2/89 (2%)

Query: 95  MLQLIATILNKFPST-VIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFIS 153
           +L  +A ++   P   V+ I+ HTDS G+   N  +SQ+RA+ +K YL+ +GV ++R + 
Sbjct: 450 LLDDVAKLVAANPQVGVVTIEGHTDSTGSAATNRALSQKRAESVKDYLVSKGVDASR-LE 508

Query: 154 VRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
            +GF    P+++N T  GR+ N+R+E  I
Sbjct: 509 AKGFGPDRPVESNKTAKGREANRRVEFTI 537


>gi|257470361|ref|ZP_05634452.1| Outer membrane porin F [Fusobacterium ulcerans ATCC 49185]
 gi|317064570|ref|ZP_07929055.1| outer membrane porin F [Fusobacterium ulcerans ATCC 49185]
 gi|313690246|gb|EFS27081.1| outer membrane porin F [Fusobacterium ulcerans ATCC 49185]
          Length = 186

 Score = 70.1 bits (170), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 41/123 (33%), Positives = 67/123 (54%), Gaps = 2/123 (1%)

Query: 58  LQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSH 116
             + G+ + R G+ +   +P  V F  ++  ++ K    L  +A  L + P   I I  +
Sbjct: 57  FNEKGVTIRREGNNLVLSMPELVLFDFNKYEVKNKIKGSLNALAKALEENPDIRIKIDGY 116

Query: 117 TDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQ 176
           TD IG+   NL +S +RAD IK YL  +GV ++  IS+ G+  + PI +N T+ GR  N+
Sbjct: 117 TDFIGSEGYNLELSVKRADAIKDYLTNKGVKASN-ISIEGYGKQNPIASNQTETGRAKNR 175

Query: 177 RIE 179
           R+E
Sbjct: 176 RVE 178


>gi|326571329|gb|EGE21346.1| OmpA family protein [Moraxella catarrhalis BC8]
          Length = 551

 Score = 70.1 bits (170), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 56/92 (60%), Gaps = 1/92 (1%)

Query: 95  MLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISV 154
           +L L A  L   P T + I  HTD+ GT + N  +S+ RA  +K YL+ +GV++ R ++ 
Sbjct: 442 ILDLAAEKLKAVPETTLRIIGHTDTQGTHEYNQDLSESRAAAVKEYLVSKGVAAER-LNT 500

Query: 155 RGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRG 186
           +G ++ YP+ +N T+ GR  N+RIE  +F  G
Sbjct: 501 QGASFDYPVASNATEQGRFQNRRIEFVLFQEG 532


>gi|78189119|ref|YP_379457.1| OmpA family protein [Chlorobium chlorochromatii CaD3]
 gi|78171318|gb|ABB28414.1| OmpA family protein [Chlorobium chlorochromatii CaD3]
          Length = 233

 Score = 70.1 bits (170), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 42/142 (29%), Positives = 74/142 (52%), Gaps = 4/142 (2%)

Query: 43  FGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVS-EVFLEKKFLPMLQLIAT 101
            G+ +DK        ++  G  V R+G+ I       + F +    +       ++ +A 
Sbjct: 79  LGNYMDKQAAAIDQNVE--GAQVQRVGESIRVVFDSGLLFTTGSSTISAASRSNIEQLAR 136

Query: 102 ILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKY 161
           ILN +  T + I+ HTDSIG    N ++S++RA+ + + L   GV+ NR  +V G+    
Sbjct: 137 ILNTYGDTNVVIEGHTDSIGNEATNQVLSEKRAESVATLLKVYGVAPNRMSAV-GYGETR 195

Query: 162 PIDTNDTKVGRQNNQRIEIQIF 183
           P+ TN+T+ GR  N+R+E+ I+
Sbjct: 196 PVATNETEAGRNLNRRVEVLIY 217


>gi|326562428|gb|EGE12747.1| OmpA family protein [Moraxella catarrhalis 7169]
 gi|326562797|gb|EGE13092.1| OmpA family protein [Moraxella catarrhalis 46P47B1]
 gi|326569136|gb|EGE19198.1| OmpA family protein [Moraxella catarrhalis BC1]
 gi|326570622|gb|EGE20658.1| OmpA family protein [Moraxella catarrhalis BC7]
 gi|326574786|gb|EGE24720.1| OmpA family protein [Moraxella catarrhalis O35E]
          Length = 551

 Score = 70.1 bits (170), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 56/92 (60%), Gaps = 1/92 (1%)

Query: 95  MLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISV 154
           +L L A  L   P T + I  HTD+ GT + N  +S+ RA  +K YL+ +GV++ R ++ 
Sbjct: 442 ILDLAAEKLKAVPETTLRIIGHTDTQGTHEYNQDLSESRAAAVKEYLVSKGVAAER-LNT 500

Query: 155 RGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRG 186
           +G ++ YP+ +N T+ GR  N+RIE  +F  G
Sbjct: 501 QGASFDYPVASNATEQGRFQNRRIEFVLFQEG 532


>gi|296113686|ref|YP_003627624.1| OmpA family protein [Moraxella catarrhalis RH4]
 gi|295921380|gb|ADG61731.1| OmpA family protein [Moraxella catarrhalis RH4]
          Length = 551

 Score = 70.1 bits (170), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 56/92 (60%), Gaps = 1/92 (1%)

Query: 95  MLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISV 154
           +L L A  L   P T + I  HTD+ GT + N  +S+ RA  +K YL+ +GV++ R ++ 
Sbjct: 442 ILDLAAEKLKAVPETTLRIIGHTDTQGTHEYNQDLSESRAAAVKEYLVSKGVAAER-LNT 500

Query: 155 RGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRG 186
           +G ++ YP+ +N T+ GR  N+RIE  +F  G
Sbjct: 501 QGASFDYPVASNATEQGRFQNRRIEFVLFQEG 532


>gi|308271290|emb|CBX27898.1| hypothetical protein N47_G32220 [uncultured Desulfobacterium sp.]
          Length = 310

 Score = 70.1 bits (170), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 37/95 (38%), Positives = 54/95 (56%), Gaps = 5/95 (5%)

Query: 92  FLPMLQL----IATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVS 147
            LP  Q+    +A  L   P+  + ++ HTDSIG+   N  +SQ RAD ++ YL+Q+G  
Sbjct: 215 LLPSAQVKLDQVAKALLSIPARNLIVEGHTDSIGSESYNQGLSQRRADAVRDYLVQKGYP 274

Query: 148 SNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           ++R I  RG     PI  N +  GR NN+R+EI I
Sbjct: 275 ADR-IQARGKGEGSPIADNTSPEGRANNRRVEIVI 308


>gi|16262781|ref|NP_435574.1| outer membrane protein [Sinorhizobium meliloti 1021]
 gi|307315940|ref|ZP_07595434.1| Protein of unknown function DUF2092, periplasmic [Sinorhizobium
           meliloti BL225C]
 gi|14523413|gb|AAK64986.1| outer membrane protein [Sinorhizobium meliloti 1021]
 gi|306898414|gb|EFN29107.1| Protein of unknown function DUF2092, periplasmic [Sinorhizobium
           meliloti BL225C]
          Length = 420

 Score = 70.1 bits (170), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 57/96 (59%), Gaps = 1/96 (1%)

Query: 88  LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVS 147
           L+    P+L  IAT L  FP   + I  HTD+ G+ ++N  +S ERA+ IK+ L++RG+ 
Sbjct: 90  LQPGAKPLLDDIATALKNFPDWSLRIVGHTDASGSAESNERLSLERANTIKAALVERGID 149

Query: 148 SNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
           + + ++  G     PI +N+T  G+  N+R+E+  F
Sbjct: 150 AGKLLAA-GAGQSRPIASNETDEGKALNRRVELMRF 184


>gi|84501356|ref|ZP_00999561.1| hypothetical protein OB2597_13363 [Oceanicola batsensis HTCC2597]
 gi|84390647|gb|EAQ03135.1| hypothetical protein OB2597_13363 [Oceanicola batsensis HTCC2597]
          Length = 350

 Score = 70.1 bits (170), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 34/95 (35%), Positives = 52/95 (54%), Gaps = 1/95 (1%)

Query: 88  LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVS 147
           L+    P+L  I  I+++ P   IA+  HTDSIG+  +N  +S+ RA  +  YL  +G+ 
Sbjct: 255 LDDASAPLLDSIYDIISRCPGLRIAVAGHTDSIGSAASNQSLSERRASSVVDYLAAKGLG 314

Query: 148 SNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
             R I+V G+    P+  N T  GR  N+RIE  +
Sbjct: 315 QGRMIAV-GYGEARPVADNGTDAGRSRNRRIEFSV 348


>gi|33598186|ref|NP_885829.1| putative outer membrane protein [Bordetella parapertussis 12822]
 gi|33566744|emb|CAE38956.1| putative outer membrane protein [Bordetella parapertussis]
          Length = 208

 Score = 70.1 bits (170), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 38/109 (34%), Positives = 60/109 (55%), Gaps = 2/109 (1%)

Query: 76  IPVHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERA 134
           IP +VSF   +  L+   LP+L  +A  LN+ P     +  HTDS G+  +N  +S  RA
Sbjct: 97  IPSNVSFDTDKSQLKPALLPVLDSVARALNQHPELRTKVVGHTDSTGSAAHNQQLSVNRA 156

Query: 135 DVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
             + SYL ++GV+  R ++V G     P+  N T  GR  N+R+E+ ++
Sbjct: 157 RAVTSYLGKQGVAQGR-MTVEGRGANDPVGDNATAEGRAANRRVEVYLY 204


>gi|114769969|ref|ZP_01447579.1| OmpA domain protein [alpha proteobacterium HTCC2255]
 gi|114549674|gb|EAU52556.1| OmpA domain protein [alpha proteobacterium HTCC2255]
          Length = 210

 Score = 70.1 bits (170), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 42/139 (30%), Positives = 72/139 (51%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           LD  E+E +  L+ +G ++   G+ +   +P  ++F +    +       L  ++  LNK
Sbjct: 54  LDVQEEELRKNLEGSGALIKNTGNQLIVTLPEAITFDIDSSEVRYSLEDTLIRLSKSLNK 113

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +P T + I  HTD++G    N  +S  RA+ + S L Q  VS +R I   G     P+ +
Sbjct: 114 YPKTNVEIIGHTDNVGGQDYNQKLSTRRAESVSSILAQNDVSRSR-IKAYGRGEIEPMMS 172

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N++  GR +N+R+EI I P
Sbjct: 173 NNSSKGRASNRRVEIMITP 191


>gi|326563483|gb|EGE13746.1| OmpA family protein [Moraxella catarrhalis 103P14B1]
 gi|326572976|gb|EGE22955.1| OmpA family protein [Moraxella catarrhalis CO72]
 gi|326573791|gb|EGE23748.1| OmpA family protein [Moraxella catarrhalis 101P30B1]
          Length = 551

 Score = 69.7 bits (169), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 56/92 (60%), Gaps = 1/92 (1%)

Query: 95  MLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISV 154
           +L L A  L   P T + I  HTD+ GT + N  +S+ RA  +K YL+ +GV++ R ++ 
Sbjct: 442 ILDLAAEKLKAVPETTLRIIGHTDTQGTHEYNQDLSESRAAAVKEYLVSKGVAAER-LNT 500

Query: 155 RGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRG 186
           +G ++ YP+ +N T+ GR  N+RIE  +F  G
Sbjct: 501 QGASFDYPVASNATEQGRFQNRRIEFVLFQEG 532


>gi|325103802|ref|YP_004273456.1| OmpA/MotB domain protein [Pedobacter saltans DSM 12145]
 gi|324972650|gb|ADY51634.1| OmpA/MotB domain protein [Pedobacter saltans DSM 12145]
          Length = 633

 Score = 69.7 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 35/87 (40%), Positives = 51/87 (58%), Gaps = 1/87 (1%)

Query: 96  LQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVR 155
           L ++   LN+  +  I IQ HTD+IG  K N ++S+ RA  +  YL+  G+ S R +  +
Sbjct: 545 LAILIDFLNENKTVNIEIQGHTDNIGDDKANFVLSENRAKSVLKYLVNEGIDSKR-LRYK 603

Query: 156 GFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           GF    PID+ND  +GR NN+R E  I
Sbjct: 604 GFGETAPIDSNDNIIGRANNRRTEFLI 630


>gi|253700958|ref|YP_003022147.1| OmpA/MotB domain protein [Geobacter sp. M21]
 gi|251775808|gb|ACT18389.1| OmpA/MotB domain protein [Geobacter sp. M21]
          Length = 222

 Score = 69.7 bits (169), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 72/126 (57%), Gaps = 3/126 (2%)

Query: 65  VSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTL 123
           V R G+ I   +P  + F  ++  L+  F+  L   A+ L +  + +I IQ HTDS G+ 
Sbjct: 91  VERQGEKIYVTLPSGILFDKNKDLLKPAFMESLARAASSLRESQTDII-IQGHTDSSGSD 149

Query: 124 KNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
             NL +SQ RAD ++ YL+ +GV ++R I++ G+    P   ND++  R  N+R++++I 
Sbjct: 150 AINLPLSQRRADRVRDYLVAQGVPTSRLIAI-GYGATRPQFPNDSEANRLLNRRVQLEIS 208

Query: 184 PRGNIK 189
           P   +K
Sbjct: 209 PNSALK 214


>gi|86160063|ref|YP_466848.1| OmpA/MotB family outer membrane protein [Anaeromyxobacter
           dehalogenans 2CP-C]
 gi|85776574|gb|ABC83411.1| outer membrane protein, OmpA/MotB family [Anaeromyxobacter
           dehalogenans 2CP-C]
          Length = 412

 Score = 69.7 bits (169), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 31/92 (33%), Positives = 50/92 (54%), Gaps = 1/92 (1%)

Query: 95  MLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISV 154
           +L  +A  L   P   +A++ HTD  G    +  +SQ RA+ +++ L  RG+   R +  
Sbjct: 322 LLDELAQALRDRPRLRVAVEVHTDGAGDAAASKRLSQARAEAVRAALAGRGIEGER-VEA 380

Query: 155 RGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRG 186
           RG   ++PI +N T  GR  N+R E++I P G
Sbjct: 381 RGIGAEHPIASNKTARGRAQNRRTEVRILPGG 412


>gi|33603081|ref|NP_890641.1| putative outer membrane protein [Bordetella bronchiseptica RB50]
 gi|33568712|emb|CAE34470.1| putative outer membrane protein [Bordetella bronchiseptica RB50]
          Length = 215

 Score = 69.7 bits (169), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 38/109 (34%), Positives = 60/109 (55%), Gaps = 2/109 (1%)

Query: 76  IPVHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERA 134
           IP +VSF   +  L+   LP+L  +A  LN+ P     +  HTDS G+  +N  +S  RA
Sbjct: 104 IPSNVSFDTDKSQLKPALLPVLDSVARALNQHPELRTKVVGHTDSTGSAAHNQQLSVNRA 163

Query: 135 DVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
             + SYL ++GV+  R ++V G     P+  N T  GR  N+R+E+ ++
Sbjct: 164 RAVTSYLGKQGVAQGR-MTVEGRGANDPVGDNATAEGRAANRRVEVYLY 211


>gi|170691988|ref|ZP_02883152.1| OmpA/MotB domain protein [Burkholderia graminis C4D1M]
 gi|170143272|gb|EDT11436.1| OmpA/MotB domain protein [Burkholderia graminis C4D1M]
          Length = 217

 Score = 69.7 bits (169), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 37/106 (34%), Positives = 55/106 (51%), Gaps = 2/106 (1%)

Query: 76  IPVHVSFVSEVF-LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERA 134
           IP  V+F +  + ++  F P+L  +   L + P  +  +  HTDS G    N  +S  RA
Sbjct: 102 IPSSVTFDTNSYAIKPSFAPVLDQLTQTLQQNPEVIAQVVGHTDSTGQPAYNQTLSVNRA 161

Query: 135 DVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEI 180
             +  YL QRGV+  R +S  G     PI  N+T+ GR  N+R+EI
Sbjct: 162 QSVTGYLAQRGVAPQR-LSAEGMGQNQPIADNNTEAGRAANRRVEI 206


>gi|253698707|ref|YP_003019896.1| OmpA/MotB domain protein [Geobacter sp. M21]
 gi|251773557|gb|ACT16138.1| OmpA/MotB domain protein [Geobacter sp. M21]
          Length = 333

 Score = 69.7 bits (169), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 50/85 (58%), Gaps = 2/85 (2%)

Query: 96  LQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQR-GVSSNRFISV 154
           L+ +A  L +FP+    I+ HTDS+G    N+ +SQ RAD ++ YL+ R GV+  R  +V
Sbjct: 244 LKALADFLKEFPNASGTIEGHTDSVGDKAANMKLSQRRADSVRKYLVDRFGVAPERVKAV 303

Query: 155 RGFAYKYPIDTNDTKVGRQNNQRIE 179
            GF    P   N T  G+Q N+RIE
Sbjct: 304 -GFGPTKPAADNKTAAGKQKNRRIE 327


>gi|192362185|ref|YP_001983947.1| OmpA domain-containing protein [Cellvibrio japonicus Ueda107]
 gi|190688350|gb|ACE86028.1| OmpA domain protein [Cellvibrio japonicus Ueda107]
          Length = 349

 Score = 69.7 bits (169), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 31/92 (33%), Positives = 61/92 (66%), Gaps = 2/92 (2%)

Query: 88  LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQR-GV 146
           ++ ++LP ++ +A  L ++ +TV+ ++ HTDS G+   N  +SQ+RAD +K+ L+++ G+
Sbjct: 245 VKPQYLPQVKKLADALTQYENTVVTVEGHTDSQGSAAFNKRLSQQRADAVKAALVEKFGI 304

Query: 147 SSNRFISVRGFAYKYPIDTNDTKVGRQNNQRI 178
           +++R  +V G+  + PI  N T  GR  N+R+
Sbjct: 305 AADRVTAV-GYGLERPIANNATAEGRAQNRRV 335


>gi|330503720|ref|YP_004380589.1| OmpA/MotB domain-containing protein [Pseudomonas mendocina NK-01]
 gi|328918006|gb|AEB58837.1| OmpA/MotB domain-containing protein [Pseudomonas mendocina NK-01]
          Length = 262

 Score = 69.7 bits (169), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 52/85 (61%), Gaps = 1/85 (1%)

Query: 96  LQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVR 155
           L  +   LN+ P   + I+ HTD++G+   N  +SQ RAD +KS+L  +G++++R ++  
Sbjct: 170 LATLTDFLNRHPERTVTIEGHTDNVGSESANFGLSQRRADSVKSHLQSQGIAASRLLAS- 228

Query: 156 GFAYKYPIDTNDTKVGRQNNQRIEI 180
           G     P+  ND+  GRQ N+R+EI
Sbjct: 229 GMGEGSPVAGNDSAEGRQLNRRVEI 253


>gi|124002133|ref|ZP_01686987.1| outer membrane protein OmpA family [Microscilla marina ATCC 23134]
 gi|123992599|gb|EAY31944.1| outer membrane protein OmpA family [Microscilla marina ATCC 23134]
          Length = 617

 Score = 69.7 bits (169), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 31/95 (32%), Positives = 55/95 (57%), Gaps = 1/95 (1%)

Query: 88  LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVS 147
           + KK LP  + + T L   P   I +  HTD +G+  NN+ +SQ+RA+V+ ++L+ +G+ 
Sbjct: 518 MHKKSLPAAKALLTFLKNNPGVSIEVSGHTDDVGSNSNNVALSQQRANVVYNWLVSKGIE 577

Query: 148 SNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
             R +  +G+  K PI  N+T   R  N+R + ++
Sbjct: 578 KERLVK-KGYGAKVPIIPNETNYARIVNRRTDFRV 611


>gi|332291754|ref|YP_004430363.1| OmpA/MotB domain protein [Krokinobacter diaphorus 4H-3-7-5]
 gi|332169840|gb|AEE19095.1| OmpA/MotB domain protein [Krokinobacter diaphorus 4H-3-7-5]
          Length = 471

 Score = 69.7 bits (169), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 53/88 (60%), Gaps = 1/88 (1%)

Query: 96  LQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVR 155
           L  +A+++ ++P+T   I+ HTD  G    NL +S +RA  ++SYL  +G+ + R  S +
Sbjct: 383 LDKVASVMMEYPTTRFLIEGHTDDRGRDAYNLDLSDQRAASVRSYLTGKGIPAARLES-K 441

Query: 156 GFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
           GF    P+ +N T  GRQ N+R+E+ I 
Sbjct: 442 GFGEARPVASNKTAAGRQENRRVELSIL 469


>gi|83952523|ref|ZP_00961254.1| OmpA domain protein [Roseovarius nubinhibens ISM]
 gi|83836196|gb|EAP75494.1| OmpA domain protein [Roseovarius nubinhibens ISM]
          Length = 203

 Score = 69.7 bits (169), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 40/139 (28%), Positives = 67/139 (48%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           LDK   E +  L +  + V+  GD +   +P  + F +    +       L  +A  L  
Sbjct: 64  LDKQAAELERDLNNDSVTVNNTGDRLIVTMPQDILFAIDSSTVNSGLRGDLLTVARSLQS 123

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +P T + +  HTD+ G+  +N  +S+ RA+ +   L+  GV+ +R I   G     P+ +
Sbjct: 124 YPDTTVQVVGHTDNTGSAAHNQALSERRANAVADVLMNGGVAFSR-IQTYGRGEDQPLAS 182

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T  GR  N+R+EI I P
Sbjct: 183 NLTAEGRAQNRRVEIVILP 201


>gi|326563201|gb|EGE13469.1| OmpA family protein [Moraxella catarrhalis 12P80B1]
          Length = 551

 Score = 69.7 bits (169), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 56/92 (60%), Gaps = 1/92 (1%)

Query: 95  MLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISV 154
           +L L A  L   P T + I  HTD+ GT + N  +S+ RA  +K YL+ +GV++ R ++ 
Sbjct: 442 ILDLAAEKLKAVPETTLRIIGHTDTQGTHEYNQDLSESRAAAVKEYLLSKGVAAER-LNT 500

Query: 155 RGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRG 186
           +G ++ YP+ +N T+ GR  N+RIE  +F  G
Sbjct: 501 QGASFDYPVASNATEQGRFQNRRIEFVLFQEG 532


>gi|59713771|ref|YP_206546.1| OmpA family domain-containing protein [Vibrio fischeri ES114]
 gi|197337822|ref|YP_002158145.1| OmpA family protein [Vibrio fischeri MJ11]
 gi|59482019|gb|AAW87658.1| OmpA family domain protein [Vibrio fischeri ES114]
 gi|197315074|gb|ACH64523.1| OmpA family protein [Vibrio fischeri MJ11]
          Length = 184

 Score = 69.7 bits (169), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 54/90 (60%), Gaps = 1/90 (1%)

Query: 95  MLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISV 154
           +L  +A +LN  P + + I  HTDS G+ K N+ +S +RAD + + L + GV  NR I+ 
Sbjct: 88  VLSQLAKLLNDKPESEVFIAGHTDSRGSKKFNMSLSNQRADSVLALLEENGVDGNR-INT 146

Query: 155 RGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
            GF    PI TN    GR+ N+RIEI+I P
Sbjct: 147 YGFGESEPIATNINAEGRKKNRRIEIRITP 176


>gi|99082288|ref|YP_614442.1| OmpA/MotB [Ruegeria sp. TM1040]
 gi|99038568|gb|ABF65180.1| OmpA/MotB [Ruegeria sp. TM1040]
          Length = 221

 Score = 69.7 bits (169), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 40/144 (27%), Positives = 71/144 (49%), Gaps = 2/144 (1%)

Query: 43  FGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSE-VFLEKKFLPMLQLIAT 101
            G  LDK E E +  L +  I +   GD +   +P  ++F ++   +       L+ +A 
Sbjct: 77  IGRELDKQEAELRQSLDNDSISIVNTGDRLIVSLPNDLTFATDSAAISSVVRSDLRKVAG 136

Query: 102 ILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKY 161
            L ++P +++ +  HTDS G    N  +S+ RA+ +   +   GVS  R + + G     
Sbjct: 137 SLQRYPGSIVQVIGHTDSDGAASYNYSLSERRANAVADEIAAGGVSYGR-MRIIGRGEDQ 195

Query: 162 PIDTNDTKVGRQNNQRIEIQIFPR 185
           P+ +N T  G+  N+R+EI I P+
Sbjct: 196 PVASNLTPEGKARNRRVEIVIIPQ 219


>gi|148975688|ref|ZP_01812519.1| outer membrane protein [Vibrionales bacterium SWAT-3]
 gi|145964761|gb|EDK30013.1| outer membrane protein [Vibrionales bacterium SWAT-3]
          Length = 355

 Score = 69.7 bits (169), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 32/87 (36%), Positives = 54/87 (62%), Gaps = 1/87 (1%)

Query: 96  LQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVR 155
           +Q I  +L  +P + + I  HTDS G  + N++IS++RA  + +Y+ ++G+ S+R I+  
Sbjct: 250 VQPIVEVLQTYPQSTVNIVGHTDSTGAAEYNMMISKKRAAAVAAYIEEQGIESSR-ITAS 308

Query: 156 GFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           G   + PI +NDT  GR  N+R+E  I
Sbjct: 309 GEGEEKPIASNDTAEGRAQNRRVEATI 335


>gi|310814625|ref|YP_003962589.1| OmpA family protein [Ketogulonicigenium vulgare Y25]
 gi|308753360|gb|ADO41289.1| OmpA family protein [Ketogulonicigenium vulgare Y25]
          Length = 227

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 49/138 (35%), Positives = 73/138 (52%), Gaps = 5/138 (3%)

Query: 49  KAEDEFQMQLQ-DTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKF 106
           + E E + QL  + GIV +  G  +T  +P  V F  +   +  +    L+ +A  LN++
Sbjct: 91  RQEAELRQQLGGNVGIVNN--GQNLTVTMPQDVLFGTNSTAVSIQSQTDLRTVAASLNRY 148

Query: 107 PSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTN 166
           P+T I++  HTDS G+   N  +S  RA  + S LI  GV+  R  +V G     PI +N
Sbjct: 149 PNTSISVIGHTDSTGSASYNQDLSVRRAQAVASVLINGGVAPARVYTV-GRGASQPIASN 207

Query: 167 DTKVGRQNNQRIEIQIFP 184
            T  GRQ N+R+EI I P
Sbjct: 208 ATPDGRQLNRRVEIIITP 225


>gi|124003886|ref|ZP_01688734.1| OmpA/MotB, putative [Microscilla marina ATCC 23134]
 gi|123990941|gb|EAY30408.1| OmpA/MotB, putative [Microscilla marina ATCC 23134]
          Length = 389

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 53/91 (58%), Gaps = 1/91 (1%)

Query: 93  LPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFI 152
            P L  +  +L   P   + I  HTD++GT   NL +S  RA  + +YL ++G+ +NR +
Sbjct: 300 FPELDKLVNLLTTHPQIKVRIMGHTDNVGTDTRNLQLSNRRAKSVVTYLKKQGIRANR-L 358

Query: 153 SVRGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
           + +GF    PID+N TK GRQ N+R+E  + 
Sbjct: 359 TFKGFGESRPIDSNVTKEGRQKNRRVEFVVL 389


>gi|261415986|ref|YP_003249669.1| OmpA/MotB domain protein [Fibrobacter succinogenes subsp.
           succinogenes S85]
 gi|261372442|gb|ACX75187.1| OmpA/MotB domain protein [Fibrobacter succinogenes subsp.
           succinogenes S85]
          Length = 700

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 33/90 (36%), Positives = 54/90 (60%), Gaps = 1/90 (1%)

Query: 96  LQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVR 155
           L  IA +L K P+  + +Q HTD  G+ + N  +S++RA  +  YL+++G+ S R  +V 
Sbjct: 612 LNNIAKLLKKLPAVNLEVQGHTDDTGSEEKNKTMSEQRAQAVVKYLVKKGIDSERLRAV- 670

Query: 156 GFAYKYPIDTNDTKVGRQNNQRIEIQIFPR 185
           G+    PI  N TK GR+ N+R+E+  F +
Sbjct: 671 GYGSDKPIADNKTKKGRKLNRRVELVPFEK 700


>gi|156072292|gb|ABU45468.1| OmpA family protein [Fibrobacter succinogenes subsp. succinogenes
           S85]
 gi|302327799|gb|ADL27000.1| OmpA family protein [Fibrobacter succinogenes subsp. succinogenes
           S85]
          Length = 700

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 33/90 (36%), Positives = 54/90 (60%), Gaps = 1/90 (1%)

Query: 96  LQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVR 155
           L  IA +L K P+  + +Q HTD  G+ + N  +S++RA  +  YL+++G+ S R  +V 
Sbjct: 612 LNNIAKLLKKLPAVNLEVQGHTDDTGSEEKNKTMSEQRAQAVVKYLVKKGIDSERLRAV- 670

Query: 156 GFAYKYPIDTNDTKVGRQNNQRIEIQIFPR 185
           G+    PI  N TK GR+ N+R+E+  F +
Sbjct: 671 GYGSDKPIADNKTKKGRKLNRRVELVPFEK 700


>gi|108761081|ref|YP_635504.1| OmpA family protein [Myxococcus xanthus DK 1622]
 gi|108464961|gb|ABF90146.1| OmpA family protein [Myxococcus xanthus DK 1622]
          Length = 352

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 60/103 (58%), Gaps = 3/103 (2%)

Query: 86  VFLEKKFLPMLQLIATILNKFPS-TVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQR 144
             L+ +  P L  +A +L   P   VIAI+ HTD+ G       ++  RA+ ++ YL++R
Sbjct: 249 AALQPRVQPALDNVADVLLVHPRLGVIAIEGHTDNRGDPDVQREVTLARAEAVRDYLVER 308

Query: 145 GVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIF-PRG 186
           GV  +R +   GF    P+++N+T  GR+ N+R+++++  PRG
Sbjct: 309 GVPPDR-LEAWGFGPDKPVESNETAQGREANRRLDLRVVAPRG 350


>gi|311104068|ref|YP_003976921.1| inner membrane lipoprotein YiaD [Achromobacter xylosoxidans A8]
 gi|310758757|gb|ADP14206.1| inner membrane lipoprotein YiaD [Achromobacter xylosoxidans A8]
          Length = 215

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 40/109 (36%), Positives = 59/109 (54%), Gaps = 2/109 (1%)

Query: 76  IPVHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERA 134
           IP  VSF   +  L+   LP+L  +A  LN+ P     +  HTDS G L +N  +S  RA
Sbjct: 104 IPSGVSFDTDKTQLKPALLPVLDSVARSLNQHPELRAKVVGHTDSTGALAHNQTLSVNRA 163

Query: 135 DVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
             +  YL ++GV++ R ++V G     PI  N T  GR  N+R+EI ++
Sbjct: 164 KSVTDYLGKQGVAAGR-LTVEGRGPNDPIGDNATAEGRALNRRVEIYLY 211


>gi|162450796|ref|YP_001613163.1| hypothetical protein sce2524 [Sorangium cellulosum 'So ce 56']
 gi|161161378|emb|CAN92683.1| putative membrane protein [Sorangium cellulosum 'So ce 56']
          Length = 561

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 31/74 (41%), Positives = 49/74 (66%)

Query: 109 TVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDT 168
           T++AI+ HTD+ G+ + N  +S +RA  +++YLI+RG      ++  GF  K PID N+T
Sbjct: 467 TLVAIEGHTDNRGSDQLNEKLSNDRAHSVRTYLIERGGIDPARLTAAGFGPKRPIDDNNT 526

Query: 169 KVGRQNNQRIEIQI 182
           + GRQ N+R+E  I
Sbjct: 527 EAGRQKNRRVEFHI 540


>gi|209809406|ref|YP_002264944.1| putative outer membrane protein, OmpA family [Aliivibrio
           salmonicida LFI1238]
 gi|208010968|emb|CAQ81375.1| putative outer membrane protein, OmpA family [Aliivibrio
           salmonicida LFI1238]
          Length = 185

 Score = 69.3 bits (168), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 45/134 (33%), Positives = 72/134 (53%), Gaps = 2/134 (1%)

Query: 52  DEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVS-EVFLEKKFLPMLQLIATILNKFPSTV 110
           DE    + D    V+++ D I   +    SF S  + ++ +    L  +A +LN  P + 
Sbjct: 44  DELNAIITDDIGSVAQVNDEIIVLLNGDTSFDSGSIVIKSESKDALTQLAQLLNNKPRSE 103

Query: 111 IAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKV 170
           + I  HTDS G+ + N  +S +RA+ + + L Q+GV +NR I+  GF    PI +N    
Sbjct: 104 VFIAGHTDSSGSKQFNTSLSNKRANSVLALLEQKGVDANR-INTYGFGEAEPIASNMNAN 162

Query: 171 GRQNNQRIEIQIFP 184
           GR+ N+RIEI+I P
Sbjct: 163 GRKKNRRIEIRITP 176


>gi|110833683|ref|YP_692542.1| outer membrane protein OprF [Alcanivorax borkumensis SK2]
 gi|110646794|emb|CAL16270.1| outer membrane protein OprF [Alcanivorax borkumensis SK2]
          Length = 384

 Score = 69.3 bits (168), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 33/87 (37%), Positives = 55/87 (63%), Gaps = 2/87 (2%)

Query: 94  PMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQR-GVSSNRFI 152
           P L+ +A  + ++PS  + ++ HTDS G+   N  +SQ+RAD +K+ L+ + GVS++R  
Sbjct: 286 PSLENLAEDMRQYPSANLVLEGHTDSTGSAAYNKKLSQQRADAVKAVLVDKFGVSADRIT 345

Query: 153 SVRGFAYKYPIDTNDTKVGRQNNQRIE 179
           +V G+  + PI  N T  GR  N+R+E
Sbjct: 346 TV-GYGEEKPISDNKTSEGRAENRRVE 371


>gi|237742388|ref|ZP_04572869.1| outer membrane porin F [Fusobacterium sp. 4_1_13]
 gi|256845716|ref|ZP_05551174.1| type VI secretion system OmpA/MotB [Fusobacterium sp. 3_1_36A2]
 gi|294785038|ref|ZP_06750326.1| outer membrane porin F [Fusobacterium sp. 3_1_27]
 gi|229430036|gb|EEO40248.1| outer membrane porin F [Fusobacterium sp. 4_1_13]
 gi|256719275|gb|EEU32830.1| type VI secretion system OmpA/MotB [Fusobacterium sp. 3_1_36A2]
 gi|294486752|gb|EFG34114.1| outer membrane porin F [Fusobacterium sp. 3_1_27]
          Length = 182

 Score = 68.9 bits (167), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 69/131 (52%), Gaps = 5/131 (3%)

Query: 58  LQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEK-KFLPMLQLIATILNKFPSTVIAIQSH 116
             + G+ + R G+ +   +P  + F  + ++ K K  P L  +A  L +     I I  +
Sbjct: 55  FNEEGVTIRREGNNLILSMPELILFDFDKYVVKDKIKPSLSTLAKALGENKDIHIKIDGY 114

Query: 117 TDSIGTLKNNLLISQERADVIKSYLIQRG-VSSNRFISVRGFAYKYPIDTNDTKVGRQNN 175
           TD IGT   NL +S +RA  IK +LI +G + SN  IS+ G+  + P DTN T  GR  N
Sbjct: 115 TDFIGTEAYNLDLSVKRARAIKDFLISKGAIGSN--ISIEGYGEQNPADTNQTAAGRSRN 172

Query: 176 QRIEIQIFPRG 186
           +R+E  I  RG
Sbjct: 173 RRVEF-IISRG 182


>gi|124008054|ref|ZP_01692753.1| peptidoglycan-associated cytoplasmic membrane protein, putative
           [Microscilla marina ATCC 23134]
 gi|123986468|gb|EAY26274.1| peptidoglycan-associated cytoplasmic membrane protein, putative
           [Microscilla marina ATCC 23134]
          Length = 563

 Score = 68.9 bits (167), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 58/96 (60%), Gaps = 1/96 (1%)

Query: 88  LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVS 147
           L+ K L  LQ IA +L K P   + I +HTD+ GT  +N+ +S++RA  +K +L++ GV 
Sbjct: 469 LDDKTLGYLQTIAQLLKKEPQLKLEISAHTDNHGTHDDNMNLSKQRAQAVKEFLVKAGVD 528

Query: 148 SNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
             R +S +G+    P+  N T   R+ N+R+E+++ 
Sbjct: 529 VKR-LSAKGYGETRPLVPNTTVANRERNRRVELKVL 563


>gi|150005847|ref|YP_001300591.1| OmpA family outer membrane protein [Bacteroides vulgatus ATCC 8482]
 gi|149934271|gb|ABR40969.1| outer membrane protein, OmpA family [Bacteroides vulgatus ATCC
           8482]
          Length = 239

 Score = 68.9 bits (167), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 49/157 (31%), Positives = 78/157 (49%), Gaps = 20/157 (12%)

Query: 44  GSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATIL 103
           G  +DKA +E   Q+Q  G  V ++ D       V V+F S +        +     + L
Sbjct: 73  GKKMDKAAEEA-AQIQ--GAQVEQVTDN-NGLQAVKVTFDSGILFNTGNAALSAQAKSAL 128

Query: 104 NKFPSTV--------IAIQSHTDSIG--------TLKNNLLISQERADVIKSYLIQRGVS 147
           +KF + V        ++I  +TD+ G        +++ NL +SQERA  + SYL+  GVS
Sbjct: 129 SKFANNVLNQNRDMDVSIYGYTDNQGWRNSTAEQSIQKNLNLSQERAQSVASYLLGCGVS 188

Query: 148 SNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           +++  SV G     PI  NDT  GRQ N+R+E+ ++ 
Sbjct: 189 NSQIKSVEGLGQADPIGNNDTAEGRQQNRRVEVYMYA 225


>gi|319426588|gb|ADV54662.1| OmpA/MotB domain protein [Shewanella putrefaciens 200]
          Length = 288

 Score = 68.9 bits (167), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 54/82 (65%), Gaps = 1/82 (1%)

Query: 99  IATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFA 158
           +AT L K+P     I+ +TDS+GT + NL +S+ RAD + ++L  +GV S+R +S +G  
Sbjct: 198 LATFLGKYPQRGAIIEGYTDSVGTEEYNLGLSERRADSVSNFLQAQGVQSSR-LSSQGKG 256

Query: 159 YKYPIDTNDTKVGRQNNQRIEI 180
             +P+  N++  GRQ N+R+E+
Sbjct: 257 ESFPVANNESASGRQQNRRVEV 278


>gi|85704529|ref|ZP_01035631.1| hypothetical protein ROS217_05604 [Roseovarius sp. 217]
 gi|85670937|gb|EAQ25796.1| hypothetical protein ROS217_05604 [Roseovarius sp. 217]
          Length = 321

 Score = 68.9 bits (167), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 50/89 (56%), Gaps = 1/89 (1%)

Query: 94  PMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFIS 153
           P+L  +A I+ + P   I I  HTDS G+   N  +S+ RA  +  YL  R VS +R I+
Sbjct: 232 PLLDAVAQIVTRCPDLTIQIAGHTDSFGSAAANQTLSERRAQSVVDYLATRDVSPSRLIA 291

Query: 154 VRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           + G+    P+  N T+ GR+ N+RIE  I
Sbjct: 292 L-GYGETRPVADNSTEQGRRENRRIEFSI 319


>gi|260432355|ref|ZP_05786326.1| inner membrane lipoprotein YiaD [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260416183|gb|EEX09442.1| inner membrane lipoprotein YiaD [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 223

 Score = 68.9 bits (167), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 44/142 (30%), Positives = 68/142 (47%), Gaps = 2/142 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPM-LQLIATILNK 105
           LD+   E + QL + GI +   GD +   +P  ++F ++    +  L   L  +   L  
Sbjct: 82  LDRQAAELRQQLANDGITIVNAGDRLIVTVPNDITFDTDSATVRPALRADLVRVGQNLVN 141

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +P + + I  HTDS G    N  +S+ RA  +   L   GVS  R  ++ G     PI +
Sbjct: 142 YPKSNVQIIGHTDSDGDAGYNQALSERRASAVADILHANGVSYARITTI-GRGENQPIAS 200

Query: 166 NDTKVGRQNNQRIEIQIFPRGN 187
           N T  G+  N+R+EI I P GN
Sbjct: 201 NLTPEGKAQNRRVEIVIVPSGN 222


>gi|224370810|ref|YP_002604974.1| OmpF [Desulfobacterium autotrophicum HRM2]
 gi|223693527|gb|ACN16810.1| OmpF [Desulfobacterium autotrophicum HRM2]
          Length = 213

 Score = 68.9 bits (167), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 51/89 (57%), Gaps = 6/89 (6%)

Query: 96  LQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVR 155
           L  +A +L  FP T I ++ HTDS GT + N+L+SQ RA  +   L+QRGV   R  S+ 
Sbjct: 128 LDRVAKVLRDFPQTRIRVEGHTDSKGTDQYNMLLSQRRAQAVTDALVQRGVDPMRMESI- 186

Query: 156 GFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           GF    P+ +ND      +N+R+ I I P
Sbjct: 187 GFGESQPVSSNDG-----DNRRVNIVIIP 210


>gi|74316262|ref|YP_314002.1| outer membrane protein [Thiobacillus denitrificans ATCC 25259]
 gi|74055757|gb|AAZ96197.1| probable outer membrane protein [Thiobacillus denitrificans ATCC
           25259]
          Length = 331

 Score = 68.9 bits (167), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 45/142 (31%), Positives = 76/142 (53%), Gaps = 15/142 (10%)

Query: 50  AEDEFQMQL-----QDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATILN 104
           AE E Q+Q       D G+VV+ +GD++          V++  L    +  +Q +A  L 
Sbjct: 190 AEQEEQLQALNAKKTDRGLVVT-LGDVLFG--------VNKADLTPGGMRNVQKLADFLK 240

Query: 105 KFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPID 164
           ++ +  + I+ HTDS G    N  +S+ RA+ +K+ LI  GV   R I+ RG+   +P+ 
Sbjct: 241 QYETRKLLIEGHTDSTGGDALNQALSERRAEAVKTALIGMGVDGER-IATRGYGKAFPVA 299

Query: 165 TNDTKVGRQNNQRIEIQIFPRG 186
           +N+T  GRQ N+R+E+ +   G
Sbjct: 300 SNNTAAGRQLNRRVEVVLSENG 321


>gi|159045565|ref|YP_001534359.1| OmpA/MotB domain-containing protein [Dinoroseobacter shibae DFL 12]
 gi|157913325|gb|ABV94758.1| OmpA/MotB domain protein [Dinoroseobacter shibae DFL 12]
          Length = 208

 Score = 68.9 bits (167), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 40/140 (28%), Positives = 69/140 (49%), Gaps = 2/140 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           LD+   + Q +L +  + +   G  +   +P  + F V    ++      L  ++  L  
Sbjct: 70  LDRQARDLQAELGNDAVQIVNTGSELVVTMPQDILFAVDSAVVQSTLQSDLAALSRNLLD 129

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +P T + +  HTD+ G+   N  +SQ RA  + + L+Q GV S+R ++  G     PI +
Sbjct: 130 YPDTTVQVVGHTDNTGSAGYNQELSQRRASAVAAILLQNGVPSSRVVAF-GRGEDQPIAS 188

Query: 166 NDTKVGRQNNQRIEIQIFPR 185
           N  + GR  N+R+EI I PR
Sbjct: 189 NLDEAGRAQNRRVEIIITPR 208


>gi|299145363|ref|ZP_07038431.1| lipoprotein PG3 [Bacteroides sp. 3_1_23]
 gi|298515854|gb|EFI39735.1| lipoprotein PG3 [Bacteroides sp. 3_1_23]
          Length = 238

 Score = 68.9 bits (167), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 48/157 (30%), Positives = 77/157 (49%), Gaps = 20/157 (12%)

Query: 44  GSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATIL 103
           G  +DKA  E +   Q  G  V +I D       V V+F S +        +     + L
Sbjct: 73  GKKMDKAAAEAK---QIEGAQVEQITDN-NGLQAVKVTFDSGILFTTGNANLSAAAKSAL 128

Query: 104 NKFPSTV--------IAIQSHTDSIG--------TLKNNLLISQERADVIKSYLIQRGVS 147
           +KF + V        ++I  +TD+ G        + + NL +SQERA  + SYL+  GVS
Sbjct: 129 SKFANNVLNQNRDMDVSIYGYTDNQGWKNSTAAQSQQKNLNLSQERAQSVSSYLLSCGVS 188

Query: 148 SNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           +N+  SV+G     P+ +NDT  GR+ N+R+E+ ++ 
Sbjct: 189 TNQIKSVQGMGESDPVASNDTAAGREQNRRVEVYMYA 225


>gi|153877096|ref|ZP_02004079.1| OmpA domain protein [Beggiatoa sp. PS]
 gi|152066440|gb|EDN65921.1| OmpA domain protein [Beggiatoa sp. PS]
          Length = 155

 Score = 68.9 bits (167), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 41/126 (32%), Positives = 69/126 (54%), Gaps = 5/126 (3%)

Query: 54  FQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAI 113
           F  Q++ TG  +  + + IT  +    +   +  ++ ++   +Q ++  + K+PST   I
Sbjct: 20  FGSQIETTGCRILEVPEEITLTVLFDTN---KSMVKSEYYAEIQQVSDFMAKYPSTSTEI 76

Query: 114 QSHTDSIGTLKNNLLISQERADVIKSYLI-QRGVSSNRFISVRGFAYKYPIDTNDTKVGR 172
           Q HTDS G+   NL +SQ+RAD +   LI Q  +S +R  +V G+    PI  N T+ GR
Sbjct: 77  QGHTDSSGSDDYNLNLSQQRADAVLEVLISQFNISPSRLAAV-GYGESQPIADNSTREGR 135

Query: 173 QNNQRI 178
           Q N+R+
Sbjct: 136 QQNRRV 141


>gi|197117628|ref|YP_002138055.1| OmpA family outer membrane protein [Geobacter bemidjiensis Bem]
 gi|197086988|gb|ACH38259.1| OmpA family outer membrane protein, OprF domain-containing protein
           [Geobacter bemidjiensis Bem]
          Length = 434

 Score = 68.9 bits (167), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 34/93 (36%), Positives = 57/93 (61%), Gaps = 2/93 (2%)

Query: 88  LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQR-GV 146
           L+ ++ P L+ +A  LN+FP+    I+ HTD++G    N+ +SQ RAD I++ LI+  G+
Sbjct: 335 LKPQYRPELKALADFLNEFPNATGVIEGHTDNVGPKALNMKLSQSRADTIRNSLIKEFGI 394

Query: 147 SSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIE 179
           +  R  +V G+    P+ +N  K G+  N+RIE
Sbjct: 395 APERIKAV-GYGPTKPVASNKDKAGKAKNRRIE 426


>gi|197117764|ref|YP_002138191.1| OmpA family outer membrane protein [Geobacter bemidjiensis Bem]
 gi|197087124|gb|ACH38395.1| OmpA family outer membrane protein [Geobacter bemidjiensis Bem]
          Length = 468

 Score = 68.9 bits (167), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 62/106 (58%), Gaps = 3/106 (2%)

Query: 76  IPVHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERA 134
           I +H  F + +  +  ++   +  +   + K+P+T   I+ HTD++G+  +N  +SQ RA
Sbjct: 231 ITLHGEFDIDKAIIRPEYKEEIAQVGNFMKKYPTTTAVIEGHTDNVGSYNHNQDLSQRRA 290

Query: 135 DVIKSYLI-QRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIE 179
           + + +YL+ Q G+  +R +S +G+ +  PI  N T  G+Q N+RIE
Sbjct: 291 EAVVNYLVEQYGIERSR-LSAKGYGFTRPIADNATDEGKQKNRRIE 335



 Score = 54.3 bits (129), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 28/85 (32%), Positives = 50/85 (58%), Gaps = 2/85 (2%)

Query: 99  IATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQR-GVSSNRFISVRGF 157
           +A  + ++ +T   I+ HTD+ G+ + N+ +SQ+RA  + +YL+   G+  +R +S +G+
Sbjct: 379 VADYMKRYNTTTAVIEGHTDNTGSPEKNMKLSQQRAQNVVNYLVDNFGIERSR-LSAKGY 437

Query: 158 AYKYPIDTNDTKVGRQNNQRIEIQI 182
                I  N+T  GRQ N+RI   I
Sbjct: 438 GATRRISYNNTPEGRQKNRRINAVI 462


>gi|212693137|ref|ZP_03301265.1| hypothetical protein BACDOR_02644 [Bacteroides dorei DSM 17855]
 gi|237709882|ref|ZP_04540363.1| outer membrane protein [Bacteroides sp. 9_1_42FAA]
 gi|237725448|ref|ZP_04555929.1| outer membrane protein [Bacteroides sp. D4]
 gi|254881970|ref|ZP_05254680.1| outer membrane protein [Bacteroides sp. 4_3_47FAA]
 gi|265753535|ref|ZP_06088890.1| outer membrane protein [Bacteroides sp. 3_1_33FAA]
 gi|294776453|ref|ZP_06741929.1| OmpA family protein [Bacteroides vulgatus PC510]
 gi|319641023|ref|ZP_07995729.1| OmpA family Outer membrane protein [Bacteroides sp. 3_1_40A]
 gi|212664242|gb|EEB24814.1| hypothetical protein BACDOR_02644 [Bacteroides dorei DSM 17855]
 gi|229436135|gb|EEO46212.1| outer membrane protein [Bacteroides dorei 5_1_36/D4]
 gi|229455975|gb|EEO61696.1| outer membrane protein [Bacteroides sp. 9_1_42FAA]
 gi|254834763|gb|EET15072.1| outer membrane protein [Bacteroides sp. 4_3_47FAA]
 gi|263235249|gb|EEZ20773.1| outer membrane protein [Bacteroides sp. 3_1_33FAA]
 gi|294449696|gb|EFG18220.1| OmpA family protein [Bacteroides vulgatus PC510]
 gi|317387353|gb|EFV68226.1| OmpA family Outer membrane protein [Bacteroides sp. 3_1_40A]
          Length = 243

 Score = 68.9 bits (167), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 49/158 (31%), Positives = 78/158 (49%), Gaps = 20/158 (12%)

Query: 43  FGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATI 102
            G  +DKA +E   Q+Q  G  V ++ D       V V+F S +        +     + 
Sbjct: 76  IGKKMDKAAEEA-AQIQ--GAQVEQVTDN-NGLQAVKVTFDSGILFNTGNAALSAQAKSA 131

Query: 103 LNKFPSTV--------IAIQSHTDSIG--------TLKNNLLISQERADVIKSYLIQRGV 146
           L+KF + V        ++I  +TD+ G        +++ NL +SQERA  + SYL+  GV
Sbjct: 132 LSKFANNVLNQNRDMDVSIYGYTDNQGWRNSTAEQSIQKNLNLSQERAQSVASYLLGCGV 191

Query: 147 SSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           S+++  SV G     PI  NDT  GRQ N+R+E+ ++ 
Sbjct: 192 SNSQIKSVEGLGQADPIGNNDTAEGRQQNRRVEVYMYA 229


>gi|313205587|ref|YP_004044764.1| ompa/motb domain protein [Riemerella anatipestifer DSM 15868]
 gi|312444903|gb|ADQ81258.1| OmpA/MotB domain protein [Riemerella anatipestifer DSM 15868]
 gi|315022683|gb|EFT35708.1| OmpA/MotB domain protein [Riemerella anatipestifer RA-YM]
 gi|325334983|gb|ADZ11257.1| Outer membrane protein related peptidoglycan-associated
           (lipo)protein [Riemerella anatipestifer RA-GD]
          Length = 230

 Score = 68.9 bits (167), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 51/151 (33%), Positives = 73/151 (48%), Gaps = 7/151 (4%)

Query: 43  FGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYI---PVHVSFVSEVFLEKKFLPMLQLI 99
            GS +DK   E +  L   G  V R+ + I   +    V+  F S   L       L  +
Sbjct: 78  IGSKMDKQAKEIKEAL--PGAEVERVNEGIKITLNENTVNFGFDS-ANLTSVAKTNLDKL 134

Query: 100 ATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAY 159
           A +L   P T I +  HTDS G    NL +S+ RA+ + SYL   G++S+R I+ +G   
Sbjct: 135 AQVLKNNPDTNINVYGHTDSRGADDYNLRLSERRANAVVSYLSSLGIASSRMIA-KGVGE 193

Query: 160 KYPIDTNDTKVGRQNNQRIEIQIFPRGNIKK 190
             PI +NDT  GR  N+R+E  I    N+ K
Sbjct: 194 AEPIASNDTDEGRAKNRRVEFAITANENMIK 224


>gi|163732619|ref|ZP_02140064.1| OmpA family domain protein [Roseobacter litoralis Och 149]
 gi|161393979|gb|EDQ18303.1| OmpA family domain protein [Roseobacter litoralis Och 149]
          Length = 210

 Score = 68.9 bits (167), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 40/140 (28%), Positives = 72/140 (51%), Gaps = 2/140 (1%)

Query: 46  SLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPM-LQLIATILN 104
           +LD+ E E +  L +  + ++  GD +   +P  + F ++ F  +  L   L  +A  L 
Sbjct: 70  NLDQQEAELRRDLGNDDVQITNTGDRLIVSLPQDLLFATDSFSVRPDLQNDLYTVAGSLQ 129

Query: 105 KFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPID 164
            +P++ I +  HTDS G    N  +S+ RA  +   L+  GV+S+R  ++ G     P+ 
Sbjct: 130 NYPASTIQVIGHTDSDGDAAYNQQLSERRAGSVAGILMNAGVTSSRLQTI-GRGESQPVA 188

Query: 165 TNDTKVGRQNNQRIEIQIFP 184
           +N  + G+  N+R+EI I P
Sbjct: 189 SNLNETGKAQNRRVEIVILP 208


>gi|307728928|ref|YP_003906152.1| OmpA/MotB domain-containing protein [Burkholderia sp. CCGE1003]
 gi|307583463|gb|ADN56861.1| OmpA/MotB domain protein [Burkholderia sp. CCGE1003]
          Length = 217

 Score = 68.9 bits (167), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 37/106 (34%), Positives = 58/106 (54%), Gaps = 2/106 (1%)

Query: 76  IPVHVSFVSEVF-LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERA 134
           IP  V+F +  + ++  F P+L  +   L + P  +  +  HTDS G    N  +S  RA
Sbjct: 102 IPSSVTFDTNSYAIKPSFAPVLDQLTQTLQQNPEVIAQVVGHTDSTGQPAYNQTLSVNRA 161

Query: 135 DVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEI 180
             + S+L QRGV++ R +S +G     PI  N+T+ GR  N+R+EI
Sbjct: 162 QSVVSFLEQRGVAAQR-LSAQGMGQNQPIADNNTEAGRAANRRVEI 206


>gi|237721048|ref|ZP_04551529.1| outer membrane protein [Bacteroides sp. 2_2_4]
 gi|293372983|ref|ZP_06619352.1| OmpA family protein [Bacteroides ovatus SD CMC 3f]
 gi|229449883|gb|EEO55674.1| outer membrane protein [Bacteroides sp. 2_2_4]
 gi|292632051|gb|EFF50660.1| OmpA family protein [Bacteroides ovatus SD CMC 3f]
 gi|295084441|emb|CBK65964.1| Outer membrane protein and related peptidoglycan-associated
           (lipo)proteins [Bacteroides xylanisolvens XB1A]
          Length = 238

 Score = 68.9 bits (167), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 48/157 (30%), Positives = 77/157 (49%), Gaps = 20/157 (12%)

Query: 44  GSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATIL 103
           G  +DKA  E +   Q  G  V +I D       V V+F S +        +     + L
Sbjct: 73  GKKMDKAAAEAK---QIEGAQVEQITDN-NGLQAVKVTFDSGILFTTGNANLSAAAKSAL 128

Query: 104 NKFPSTV--------IAIQSHTDSIG--------TLKNNLLISQERADVIKSYLIQRGVS 147
           +KF + V        ++I  +TD+ G        + + NL +SQERA  + SYL+  GVS
Sbjct: 129 SKFANNVLNQNRDMDVSIYGYTDNQGWKNSTAAQSQQKNLNLSQERAQSVSSYLLSCGVS 188

Query: 148 SNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           +N+  SV+G     P+ +NDT  GR+ N+R+E+ ++ 
Sbjct: 189 TNQIKSVQGMGESDPVASNDTAAGREQNRRVEVYMYA 225


>gi|332524606|ref|ZP_08400809.1| OmpA family domain protein [Rubrivivax benzoatilyticus JA2]
 gi|332107918|gb|EGJ09142.1| OmpA family domain protein [Rubrivivax benzoatilyticus JA2]
          Length = 240

 Score = 68.9 bits (167), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 47/83 (56%), Gaps = 1/83 (1%)

Query: 101 TILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYK 160
             LN+ P+    +  HTD  G    NL +S+ERA+ ++++L+ RGV++ R I VRG    
Sbjct: 158 AALNRAPARRFEVVGHTDDAGPRDLNLALSRERAEAVRAHLVARGVAAAR-IEVRGAGPD 216

Query: 161 YPIDTNDTKVGRQNNQRIEIQIF 183
            P   N T  GR  N+RIE++  
Sbjct: 217 EPAADNGTAAGRARNRRIELRTL 239


>gi|313674297|ref|YP_004052293.1| ompa/motb domain protein [Marivirga tractuosa DSM 4126]
 gi|312940995|gb|ADR20185.1| OmpA/MotB domain protein [Marivirga tractuosa DSM 4126]
          Length = 665

 Score = 68.9 bits (167), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 34/90 (37%), Positives = 54/90 (60%), Gaps = 1/90 (1%)

Query: 93  LPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFI 152
           LP+L  + T++ + P   + I  HTD+ G    NLL+S +RA   K YL+ +G++  R  
Sbjct: 574 LPILDKVVTVMQENPDYKLKISGHTDNQGDDDANLLLSHKRAQATKKYLMDQGIAILRLD 633

Query: 153 SVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           +V G+    PI++NDT  GR  N+R+E +I
Sbjct: 634 AV-GYGEMQPIESNDTAEGRAKNRRVEFEI 662


>gi|239818113|ref|YP_002947023.1| OmpA/MotB domain protein [Variovorax paradoxus S110]
 gi|239804690|gb|ACS21757.1| OmpA/MotB domain protein [Variovorax paradoxus S110]
          Length = 187

 Score = 68.9 bits (167), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 38/130 (29%), Positives = 68/130 (52%), Gaps = 3/130 (2%)

Query: 53  EFQMQLQDTGIVVSRIGD-MITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTV 110
           E +   + TG+V+ +  D  +   +P  +SF V    +++    +L  +A  L    +  
Sbjct: 53  ELESSTKGTGVVIEQTADNQLHLVVPNELSFDVGRANVKRNLAQVLDKVAEGLRSAAAAS 112

Query: 111 IAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKV 170
           + +  HTD+ G+ + N  +S  RAD ++++L+ RGVS+   I+  G   + PI  N T  
Sbjct: 113 VRVVGHTDNTGSEEGNERLSVSRADSVRNHLVSRGVSTT-AITTDGRGSREPIADNATPA 171

Query: 171 GRQNNQRIEI 180
           GR  N+R+EI
Sbjct: 172 GRAQNRRVEI 181


>gi|325279362|ref|YP_004251904.1| OmpA/MotB domain-containing protein [Odoribacter splanchnicus DSM
           20712]
 gi|324311171|gb|ADY31724.1| OmpA/MotB domain protein [Odoribacter splanchnicus DSM 20712]
          Length = 235

 Score = 68.9 bits (167), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 36/95 (37%), Positives = 54/95 (56%), Gaps = 1/95 (1%)

Query: 96  LQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVR 155
           L   AT L   P T + I  HTD+ GT   N  IS+ERAD + ++L+ +G+S +R ++  
Sbjct: 134 LTKFATSLKNSPDTDVTIYGHTDNTGTRAVNERISKERADAVANFLVGQGISRSR-LTTE 192

Query: 156 GFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGNIKK 190
           G A+  P+  N T  GR  N+R+EI I    ++ K
Sbjct: 193 GLAFDQPVADNSTAEGRAQNRRVEIYITANADMIK 227


>gi|293603504|ref|ZP_06685926.1| OmpA family protein [Achromobacter piechaudii ATCC 43553]
 gi|292818090|gb|EFF77149.1| OmpA family protein [Achromobacter piechaudii ATCC 43553]
          Length = 210

 Score = 68.9 bits (167), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 39/109 (35%), Positives = 59/109 (54%), Gaps = 2/109 (1%)

Query: 76  IPVHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERA 134
           IP  VSF   +  L+   LP+L  +A  LN+ P     +  HTDS G L +N  +S  RA
Sbjct: 99  IPSGVSFDTDKTQLKPALLPVLDSVARSLNQHPELRAKVVGHTDSTGALAHNQTLSVNRA 158

Query: 135 DVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
             +  YL ++GV++ R +++ G     PI  N T  GR  N+R+EI ++
Sbjct: 159 RSVTDYLAKQGVAATR-LAIEGRGPSDPIGDNATAEGRALNRRVEIYLY 206


>gi|89054158|ref|YP_509609.1| OmpA/MotB [Jannaschia sp. CCS1]
 gi|88863707|gb|ABD54584.1| OmpA/MotB [Jannaschia sp. CCS1]
          Length = 219

 Score = 68.9 bits (167), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 41/139 (29%), Positives = 70/139 (50%), Gaps = 2/139 (1%)

Query: 48  DKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKF 106
           D+   + +  L +  I++   G+ +   +P  + F V    +       L+ +A  LN++
Sbjct: 82  DRQAQDLRGSLSNERILIENTGEALILTLPEGILFDVDSAAIRAGLQGDLRALAFNLNQY 141

Query: 107 PSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTN 166
           P T + ++ HTD+ G+   N  +S  RA  +   L++ GV+  R  SV G     PI TN
Sbjct: 142 PDTRVVVEGHTDNTGSASYNQDLSTRRAQAVSGVLLEGGVAPFRVQSV-GRGESAPIATN 200

Query: 167 DTKVGRQNNQRIEIQIFPR 185
            T  GRQ N+R+E+ I P+
Sbjct: 201 LTPEGRQQNRRVEVIIRPQ 219


>gi|29346604|ref|NP_810107.1| OmpA family outer membrane protein [Bacteroides thetaiotaomicron
           VPI-5482]
 gi|29338500|gb|AAO76301.1| outer membrane protein, OmpA family [Bacteroides thetaiotaomicron
           VPI-5482]
          Length = 266

 Score = 68.9 bits (167), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 49/157 (31%), Positives = 76/157 (48%), Gaps = 20/157 (12%)

Query: 44  GSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATIL 103
           G  +DKA  E +   Q  G  V +I D       V V+F S +        +     + L
Sbjct: 101 GKKMDKAAAEAK---QIEGAQVEQITDN-NGLQAVKVTFDSGILFTTGNATLSAAAKSAL 156

Query: 104 NKFPSTV--------IAIQSHTDSIG--------TLKNNLLISQERADVIKSYLIQRGVS 147
           +KF + V        ++I  +TD+ G        + + NL +SQERA  + SYL+  GVS
Sbjct: 157 SKFANNVLNQNRDMDVSIYGYTDNQGWRNSTAEQSRQKNLNLSQERAQSVASYLLNCGVS 216

Query: 148 SNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           SN+   V+G     PI +NDT  GR+ N+R+E+ ++ 
Sbjct: 217 SNQIKGVQGMGESDPIASNDTAAGREQNRRVEVYMYA 253


>gi|332879143|ref|ZP_08446844.1| OmpA family protein [Capnocytophaga sp. oral taxon 329 str. F0087]
 gi|332682943|gb|EGJ55839.1| OmpA family protein [Capnocytophaga sp. oral taxon 329 str. F0087]
          Length = 454

 Score = 68.6 bits (166), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 58/88 (65%), Gaps = 1/88 (1%)

Query: 95  MLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISV 154
           +L  I  +LNK+ ++  +++ +TD+ G    N  +S++RA  +K+YL+ +G++  R +S 
Sbjct: 366 VLNNIVNVLNKYKNSKFSVEGYTDTSGNKDKNQRLSEDRAYSVKAYLVDKGINPAR-LSA 424

Query: 155 RGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           +GF  + PI +N TK GR+ N+R+EI +
Sbjct: 425 KGFGPEKPIASNKTKKGRELNRRVEINL 452


>gi|153867892|ref|ZP_01998087.1| OmpA family protein [Beggiatoa sp. SS]
 gi|152144788|gb|EDN71913.1| OmpA family protein [Beggiatoa sp. SS]
          Length = 170

 Score = 68.6 bits (166), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 49/73 (67%), Gaps = 1/73 (1%)

Query: 108 STVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTND 167
           S  IA++ HTD+ G+   N  +S+ RA+ +++ LI +G+  NR I ++GF  K P+ TN 
Sbjct: 90  SRAIAVEGHTDNRGSKAYNQRLSKRRAETVQNALITKGIEPNRLI-IKGFGEKEPLTTNA 148

Query: 168 TKVGRQNNQRIEI 180
           TK GRQ N+R+EI
Sbjct: 149 TKNGRQQNRRVEI 161


>gi|158522006|ref|YP_001529876.1| OmpA/MotB domain-containing protein [Desulfococcus oleovorans Hxd3]
 gi|158510832|gb|ABW67799.1| OmpA/MotB domain protein [Desulfococcus oleovorans Hxd3]
          Length = 388

 Score = 68.6 bits (166), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 50/85 (58%), Gaps = 1/85 (1%)

Query: 96  LQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVR 155
           L  + T+L   P   + +Q HTDS G    N ++S++RA  +  Y + RG++++R +S +
Sbjct: 301 LDEVVTVLKNNPELRLEVQGHTDSRGNPGFNQVLSEQRAGAVVRYFVSRGIAADRLVS-K 359

Query: 156 GFAYKYPIDTNDTKVGRQNNQRIEI 180
           GF    PI  NDT  GR  N+R+E+
Sbjct: 360 GFGPSQPIADNDTAEGRAENRRVEL 384


>gi|253568033|ref|ZP_04845444.1| outer membrane protein [Bacteroides sp. 1_1_6]
 gi|298387668|ref|ZP_06997219.1| lipoprotein PG3 [Bacteroides sp. 1_1_14]
 gi|251842106|gb|EES70186.1| outer membrane protein [Bacteroides sp. 1_1_6]
 gi|298259524|gb|EFI02397.1| lipoprotein PG3 [Bacteroides sp. 1_1_14]
          Length = 260

 Score = 68.6 bits (166), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 49/157 (31%), Positives = 76/157 (48%), Gaps = 20/157 (12%)

Query: 44  GSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATIL 103
           G  +DKA  E +   Q  G  V +I D       V V+F S +        +     + L
Sbjct: 95  GKKMDKAAAEAK---QIEGAQVEQITDN-NGLQAVKVTFDSGILFTTGNATLSAAAKSAL 150

Query: 104 NKFPSTV--------IAIQSHTDSIG--------TLKNNLLISQERADVIKSYLIQRGVS 147
           +KF + V        ++I  +TD+ G        + + NL +SQERA  + SYL+  GVS
Sbjct: 151 SKFANNVLNQNRDMDVSIYGYTDNQGWRNSTAEQSRQKNLNLSQERAQSVASYLLNCGVS 210

Query: 148 SNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           SN+   V+G     PI +NDT  GR+ N+R+E+ ++ 
Sbjct: 211 SNQIKGVQGMGESDPIASNDTAAGREQNRRVEVYMYA 247


>gi|237716264|ref|ZP_04546745.1| outer membrane protein [Bacteroides sp. D1]
 gi|294807688|ref|ZP_06766481.1| OmpA family protein [Bacteroides xylanisolvens SD CC 1b]
 gi|229443911|gb|EEO49702.1| outer membrane protein [Bacteroides sp. D1]
 gi|294445124|gb|EFG13798.1| OmpA family protein [Bacteroides xylanisolvens SD CC 1b]
          Length = 238

 Score = 68.6 bits (166), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 48/157 (30%), Positives = 77/157 (49%), Gaps = 20/157 (12%)

Query: 44  GSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATIL 103
           G  +DKA  E +   Q  G  V +I D       V V+F S +        +     + L
Sbjct: 73  GKKMDKAAAEAK---QIEGAQVEQITDN-NGLQAVKVTFDSGILFTTGNANLSAAAKSAL 128

Query: 104 NKFPSTV--------IAIQSHTDSIG--------TLKNNLLISQERADVIKSYLIQRGVS 147
           +KF + V        ++I  +TD+ G        + + NL +SQERA  + SYL+  GVS
Sbjct: 129 SKFANNVLNQNRDMDVSIYGYTDNQGWKNSTAAQSQQKNLNLSQERAQSVSSYLLSCGVS 188

Query: 148 SNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           +N+  SV+G     P+ +NDT  GR+ N+R+E+ ++ 
Sbjct: 189 TNQIKSVQGMGESDPVASNDTAAGREQNRRVEVYMYA 225


>gi|145219523|ref|YP_001130232.1| OmpA/MotB domain-containing protein [Prosthecochloris vibrioformis
           DSM 265]
 gi|145205687|gb|ABP36730.1| OmpA/MotB domain protein [Chlorobium phaeovibrioides DSM 265]
          Length = 229

 Score = 68.6 bits (166), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 44/148 (29%), Positives = 76/148 (51%), Gaps = 4/148 (2%)

Query: 43  FGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPM-LQLIAT 101
            G+ +DK  +E   Q++  G  V R+G+ I       + F +            ++ +A 
Sbjct: 75  IGNYMDKQAEEIDSQVE--GARVERVGESIRVVFDSGILFSTGSSTLTSTSRYNIEKLAR 132

Query: 102 ILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKY 161
           ILN++ +T + I+ HTD+IG    N  +S+ RA+ + + L   GVS  R   V G+    
Sbjct: 133 ILNRYSNTNLVIEGHTDAIGAESLNQTLSERRAESVANLLAGYGVSRYRLSPV-GYGETR 191

Query: 162 PIDTNDTKVGRQNNQRIEIQIFPRGNIK 189
           PI +N+T+ GR+ N+R+E+ I     +K
Sbjct: 192 PIASNETEYGRRLNRRVEVLISANDELK 219


>gi|153004433|ref|YP_001378758.1| OmpA/MotB domain-containing protein [Anaeromyxobacter sp. Fw109-5]
 gi|152028006|gb|ABS25774.1| OmpA/MotB domain protein [Anaeromyxobacter sp. Fw109-5]
          Length = 498

 Score = 68.6 bits (166), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 32/89 (35%), Positives = 53/89 (59%), Gaps = 2/89 (2%)

Query: 95  MLQLIATILNKFPS-TVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFIS 153
           +L  +A+IL   P    + ++ HTD +G    N  +S+ RAD ++  L++RG++ +R +S
Sbjct: 409 LLDQVASILRAHPEIRRVRVEGHTDDVGPALTNKELSERRADSVRDALVRRGIAPSR-LS 467

Query: 154 VRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           +RG+    PI  N TK GR  N+R+E  I
Sbjct: 468 IRGYGESRPIAPNKTKAGRAKNRRVEFVI 496


>gi|34763974|ref|ZP_00144866.1| Outer membrane porin F [Fusobacterium nucleatum subsp. vincentii
           ATCC 49256]
 gi|27886249|gb|EAA23533.1| Outer membrane porin F [Fusobacterium nucleatum subsp. vincentii
           ATCC 49256]
          Length = 172

 Score = 68.6 bits (166), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 69/131 (52%), Gaps = 5/131 (3%)

Query: 58  LQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEK-KFLPMLQLIATILNKFPSTVIAIQSH 116
             + G+ + R G+ +   +P  + F  + ++ K K  P L  +A  L +     I I  +
Sbjct: 45  FNEEGVTIRREGNNLILSMPELILFDFDKYVVKDKIKPSLSTLAKALGENKDIHIKIDGY 104

Query: 117 TDSIGTLKNNLLISQERADVIKSYLIQRG-VSSNRFISVRGFAYKYPIDTNDTKVGRQNN 175
           TD IGT   NL +S +RA  IK +LI +G + SN  IS+ G+  + P DTN T  GR  N
Sbjct: 105 TDFIGTEAYNLDLSVKRARAIKDFLISKGAIGSN--ISIEGYGEQNPADTNQTAAGRSRN 162

Query: 176 QRIEIQIFPRG 186
           +R+E  I  RG
Sbjct: 163 RRVEF-IISRG 172


>gi|162452165|ref|YP_001614532.1| outer membrane protein [Sorangium cellulosum 'So ce 56']
 gi|161162747|emb|CAN94052.1| outer membrane protein [Sorangium cellulosum 'So ce 56']
          Length = 467

 Score = 68.6 bits (166), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 31/92 (33%), Positives = 53/92 (57%), Gaps = 1/92 (1%)

Query: 94  PMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFIS 153
           P L+ +A IL+ +P+  + I+ HTD++G  + N  +S  RA  +++ L  R ++ +R I 
Sbjct: 377 PKLEALADILDAYPTARVRIEGHTDAVGGAEGNRSLSLARAQEVRNELTARQIAPDR-IE 435

Query: 154 VRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPR 185
           V G     P+  NDT  GR  N+RI++ +  R
Sbjct: 436 VAGMGANQPVAPNDTAGGRAQNRRIDVTVLSR 467


>gi|153875874|ref|ZP_02003478.1| OmpA/MotB [Beggiatoa sp. PS]
 gi|152067662|gb|EDN66522.1| OmpA/MotB [Beggiatoa sp. PS]
          Length = 263

 Score = 68.6 bits (166), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 38/91 (41%), Positives = 58/91 (63%), Gaps = 2/91 (2%)

Query: 96  LQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVR 155
           ++ +A  L + P   I+I+ HTD+ G   +NL +S+ RA  +K  L+  G++S R I+V+
Sbjct: 173 IKTLAAFLKQHPYFRISIEGHTDNAGIHTHNLGLSERRATSVKFALMNDGITSKR-ITVK 231

Query: 156 GFAYKYPIDTNDTKVGRQNNQRIEIQIFPRG 186
           GF    PI +N T+ GRQ N+R+EI IF RG
Sbjct: 232 GFGETRPIGSNRTQQGRQKNRRVEIIIF-RG 261


>gi|148266343|ref|YP_001233049.1| OmpA/MotB domain-containing protein [Geobacter uraniireducens Rf4]
 gi|146399843|gb|ABQ28476.1| OmpA/MotB domain protein [Geobacter uraniireducens Rf4]
          Length = 454

 Score = 68.6 bits (166), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 31/105 (29%), Positives = 61/105 (58%), Gaps = 1/105 (0%)

Query: 76  IPVHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERA 134
           I +H+ F + +  +  ++   +  +   + K+P+T   I+ HTD++GT + N+ +SQ RA
Sbjct: 217 ITLHIEFDIDKADIRPEYHDEVAKVGDFMKKYPTTTTVIEGHTDNVGTAEYNMGLSQRRA 276

Query: 135 DVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIE 179
           + + +YL+++    N  +S +G+    P+  N T  G+Q N+RIE
Sbjct: 277 ESVVNYLVEKFGIENSRLSAKGYGLTRPVADNSTNEGKQLNRRIE 321



 Score = 64.7 bits (156), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 54/85 (63%), Gaps = 2/85 (2%)

Query: 99  IATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQR-GVSSNRFISVRGF 157
           +   + K+P+T  AI+ HTD++G  + N+ +SQERA+ + +YL++  G+  +R +S +G+
Sbjct: 365 VGDYMKKYPTTTAAIEGHTDNVGGSEYNMKLSQERAENVVNYLVENFGIERSR-LSAKGY 423

Query: 158 AYKYPIDTNDTKVGRQNNQRIEIQI 182
            +   I  N+T  GRQ N+RI   I
Sbjct: 424 GFTRRIAYNNTAEGRQKNRRINAVI 448


>gi|330975634|gb|EGH75700.1| OmpA/MotB [Pseudomonas syringae pv. aptata str. DSM 50252]
          Length = 250

 Score = 68.6 bits (166), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 39/120 (32%), Positives = 65/120 (54%), Gaps = 2/120 (1%)

Query: 48  DKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEV-FLEKKFLPMLQLIATILNKF 106
           DK E   +  + +TG+ V R GD I   +P +++F ++   +   F   L  +A+ L +F
Sbjct: 87  DKQEAALRESMANTGVEVQRQGDQIKLIMPGNITFATDSSAIASSFYSPLNNLASSLKQF 146

Query: 107 PSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTN 166
               I I  +TDS G+ ++N+ +SQ+RA  + +YL  +GV     +SVRG     PI +N
Sbjct: 147 NQNNIEIVGYTDSTGSRQHNMDLSQQRAQSVATYLTSQGV-DQAHLSVRGAGPDQPIASN 205


>gi|77919971|ref|YP_357786.1| outer membrane protein/peptidoglycan-associated (lipo)proteins
           [Pelobacter carbinolicus DSM 2380]
 gi|77546054|gb|ABA89616.1| outer membrane protein/peptidoglycan-associated (lipo)protein
           [Pelobacter carbinolicus DSM 2380]
          Length = 427

 Score = 68.6 bits (166), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 37/124 (29%), Positives = 69/124 (55%), Gaps = 3/124 (2%)

Query: 61  TGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSI 120
            G++V + G  I+  + +    V +  ++ ++   L+  A  + K+P + I I  HTDS 
Sbjct: 301 AGLMVDQQGCPISLTLAIEFD-VDKADIKPRYHSELKRGADFIRKYPESRILIAGHTDST 359

Query: 121 GTLKNNLLISQERADVIKSYLIQR-GVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIE 179
            +   NL +SQ RAD +++Y+I   G+ + R +  +G+   +PI  N T  GRQ N+R+E
Sbjct: 360 ASDAYNLALSQRRADSVRNYVISNFGIKAER-LEAKGYGEAFPIADNATVQGRQRNRRVE 418

Query: 180 IQIF 183
           + ++
Sbjct: 419 LSVY 422


>gi|319952835|ref|YP_004164102.1| ompa/motb domain protein [Cellulophaga algicola DSM 14237]
 gi|319421495|gb|ADV48604.1| OmpA/MotB domain protein [Cellulophaga algicola DSM 14237]
          Length = 448

 Score = 68.6 bits (166), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 31/84 (36%), Positives = 54/84 (64%), Gaps = 1/84 (1%)

Query: 99  IATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFA 158
           I TIL ++P+    ++ HTDS+G+ K N  +S+ RA  +K +L+++G+   R +S  G+ 
Sbjct: 364 IITILKEYPNAKFTVEGHTDSVGSAKLNQSLSESRALSVKEFLVEKGIEEFR-LSAIGYG 422

Query: 159 YKYPIDTNDTKVGRQNNQRIEIQI 182
            + PI +N T+ GR  N+R+EI +
Sbjct: 423 EEKPIASNSTRAGRTQNRRVEINL 446


>gi|298481010|ref|ZP_06999205.1| lipoprotein PG3 [Bacteroides sp. D22]
 gi|298273033|gb|EFI14599.1| lipoprotein PG3 [Bacteroides sp. D22]
          Length = 255

 Score = 68.6 bits (166), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 48/157 (30%), Positives = 77/157 (49%), Gaps = 20/157 (12%)

Query: 44  GSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATIL 103
           G  +DKA  E +   Q  G  V +I D       V V+F S +        +     + L
Sbjct: 90  GKKMDKAAAEAK---QIEGAQVEQITDN-NGLQAVKVTFDSGILFTTGNANLSAAAKSAL 145

Query: 104 NKFPSTV--------IAIQSHTDSIG--------TLKNNLLISQERADVIKSYLIQRGVS 147
           +KF + V        ++I  +TD+ G        + + NL +SQERA  + SYL+  GVS
Sbjct: 146 SKFANNVLNQNRDMDVSIYGYTDNQGWKNSTAAQSQQKNLNLSQERAQSVSSYLLSCGVS 205

Query: 148 SNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           +N+  SV+G     P+ +NDT  GR+ N+R+E+ ++ 
Sbjct: 206 TNQIKSVQGMGESDPVASNDTAAGREQNRRVEVYMYA 242


>gi|262407869|ref|ZP_06084417.1| outer membrane protein [Bacteroides sp. 2_1_22]
 gi|294646781|ref|ZP_06724404.1| OmpA family protein [Bacteroides ovatus SD CC 2a]
 gi|262354677|gb|EEZ03769.1| outer membrane protein [Bacteroides sp. 2_1_22]
 gi|292637941|gb|EFF56336.1| OmpA family protein [Bacteroides ovatus SD CC 2a]
          Length = 255

 Score = 68.6 bits (166), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 48/157 (30%), Positives = 77/157 (49%), Gaps = 20/157 (12%)

Query: 44  GSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATIL 103
           G  +DKA  E +   Q  G  V +I D       V V+F S +        +     + L
Sbjct: 90  GKKMDKAAAEAK---QIEGAQVEQITDN-NGLQAVKVTFDSGILFTTGNANLSAAAKSAL 145

Query: 104 NKFPSTV--------IAIQSHTDSIG--------TLKNNLLISQERADVIKSYLIQRGVS 147
           +KF + V        ++I  +TD+ G        + + NL +SQERA  + SYL+  GVS
Sbjct: 146 SKFANNVLNQNRDMDVSIYGYTDNQGWKNSTAAQSQQKNLNLSQERAQSVSSYLLSCGVS 205

Query: 148 SNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           +N+  SV+G     P+ +NDT  GR+ N+R+E+ ++ 
Sbjct: 206 TNQIKSVQGMGESDPVASNDTAAGREQNRRVEVYMYA 242


>gi|244538668|dbj|BAH82822.1| fibronectin-binding protein [Campylobacter lari]
          Length = 328

 Score = 68.6 bits (166), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 36/122 (29%), Positives = 64/122 (52%), Gaps = 2/122 (1%)

Query: 62  GIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIG 121
           G ++  IG   T  +  H  F  ++ +  +F   +Q +  +L + P     ++ HTD+ G
Sbjct: 206 GALLDHIGCEKTIMLEGHFGF-DQITINPEFAQKIQEVGKVLEENPQYYTILEGHTDNTG 264

Query: 122 TLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQ 181
               N  +S ERA  +   L + GV+  + I+ +G+ ++ PI +NDTK GR  N+R+E +
Sbjct: 265 PKAYNQKLSLERAKAVAKELEKAGVAKEK-ITTKGYGFEKPIASNDTKEGRAQNRRVEAK 323

Query: 182 IF 183
            F
Sbjct: 324 FF 325


>gi|326799764|ref|YP_004317583.1| OmpA/MotB domain protein [Sphingobacterium sp. 21]
 gi|326550528|gb|ADZ78913.1| OmpA/MotB domain protein [Sphingobacterium sp. 21]
          Length = 169

 Score = 68.6 bits (166), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 62/124 (50%), Gaps = 3/124 (2%)

Query: 62  GIVVSRIGDMITCYIPVHVSFV--SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDS 119
           G  VSR  + +       V F   S    EK  + M  ++A I   +P+  I I  HTDS
Sbjct: 46  GGTVSRTDEGVVLTFESDVLFATNSSYLSEKAKVTMKNMVAYINKNYPNAQIQINGHTDS 105

Query: 120 IGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIE 179
            G    N  +S++RA  +K+Y +  G++ +  I  +G+    P+ TN T  GRQ N+R+E
Sbjct: 106 TGEADYNQWLSEKRAASVKNYAVSIGLNGSN-IKTKGYGKSKPVATNSTADGRQKNRRVE 164

Query: 180 IQIF 183
           + I 
Sbjct: 165 VIIL 168


>gi|254487455|ref|ZP_05100660.1| OmpA family domain protein [Roseobacter sp. GAI101]
 gi|214044324|gb|EEB84962.1| OmpA family domain protein [Roseobacter sp. GAI101]
          Length = 221

 Score = 68.6 bits (166), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 39/140 (27%), Positives = 74/140 (52%), Gaps = 3/140 (2%)

Query: 46  SLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSE-VFLEKKFLPMLQLIATILN 104
           +LD+ E + + QL D+ ++++  GD +   +P  + F ++   ++      L  +A  +N
Sbjct: 82  TLDQQEADLRRQL-DSNVIITNTGDRLIVTLPQDILFATDSTTVQSGMQSDLAALARNVN 140

Query: 105 KFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPID 164
            + ++ + +  HTDS+G    N  +S+ RA+ + + LI  GV  NR  +V G     P+ 
Sbjct: 141 VYSNSTLQVIGHTDSVGDASYNQQLSEGRANAVANVLIGNGVPRNRIQAV-GRGESQPVA 199

Query: 165 TNDTKVGRQNNQRIEIQIFP 184
           +N    G+  N+R+EI I P
Sbjct: 200 SNLNASGKAQNRRVEIVILP 219


>gi|163740474|ref|ZP_02147868.1| OmpA domain protein [Phaeobacter gallaeciensis 2.10]
 gi|161386332|gb|EDQ10707.1| OmpA domain protein [Phaeobacter gallaeciensis 2.10]
          Length = 216

 Score = 68.2 bits (165), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 39/145 (26%), Positives = 73/145 (50%), Gaps = 2/145 (1%)

Query: 43  FGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSE-VFLEKKFLPMLQLIAT 101
            G+ LD  E E +  + + GI +   GD +   +P  ++F ++   +       L  +A+
Sbjct: 72  IGNQLDAQERELRQSISNDGISIVNTGDRLIVSLPNDLTFATDSAAVSPAVRSDLNKVAS 131

Query: 102 ILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKY 161
            L ++P++ + +  HTDS G    N  +S+ RA+ +   +   GV  NR + + G     
Sbjct: 132 SLVRYPNSQVQVIGHTDSDGDAGYNQGLSERRANAVADQIQAGGVPYNR-VQIIGRGESQ 190

Query: 162 PIDTNDTKVGRQNNQRIEIQIFPRG 186
           P+ +N T  G+  N+R+EI + P+G
Sbjct: 191 PVASNLTAEGKARNRRVEIVVIPQG 215


>gi|85706177|ref|ZP_01037272.1| OmpA domain protein [Roseovarius sp. 217]
 gi|85669341|gb|EAQ24207.1| OmpA domain protein [Roseovarius sp. 217]
          Length = 219

 Score = 68.2 bits (165), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 44/143 (30%), Positives = 68/143 (47%), Gaps = 3/143 (2%)

Query: 43  FGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFL-PMLQLIAT 101
            G++LD+ E E + QL D  + +   GD +   +P  + F  + F     L   L  +A 
Sbjct: 77  IGNALDRQEAELRQQL-DNDVQIVNTGDRLILTMPQDILFPVDSFTVASVLRDDLLKVAQ 135

Query: 102 ILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKY 161
            L  +P T + +  HTDS G    N  +S+ RA+ +   L   GVS  R  +  G     
Sbjct: 136 SLQAYPDTTVQVVGHTDSDGAASYNQSLSERRANAVADVLASGGVSYGRLRAF-GRGEDQ 194

Query: 162 PIDTNDTKVGRQNNQRIEIQIFP 184
           P+ +N T  G+  N+R+EI I P
Sbjct: 195 PVASNLTPQGKAQNRRVEIVILP 217


>gi|222823421|ref|YP_002574995.1| outer membrane fibronectin-binding protein [Campylobacter lari
           RM2100]
 gi|222538643|gb|ACM63744.1| outer membrane fibronectin-binding protein [Campylobacter lari
           RM2100]
 gi|244538678|dbj|BAH82830.1| fibronectin-binding protein [Campylobacter lari]
 gi|244538683|dbj|BAH82834.1| fibronectin-binding protein [Campylobacter lari]
          Length = 328

 Score = 68.2 bits (165), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 36/122 (29%), Positives = 64/122 (52%), Gaps = 2/122 (1%)

Query: 62  GIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIG 121
           G ++  IG   T  +  H  F  ++ +  +F   +Q +  +L + P     ++ HTD+ G
Sbjct: 206 GALLDHIGCEKTIMLEGHFGF-DQITINPEFAQKIQEVGKVLEENPQYYTILEGHTDNTG 264

Query: 122 TLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQ 181
               N  +S ERA  +   L + GV+  + I+ +G+ ++ PI +NDTK GR  N+R+E +
Sbjct: 265 PKAYNQKLSLERAKAVAKELEKAGVAKEK-ITTKGYGFEKPIASNDTKEGRAQNRRVEAK 323

Query: 182 IF 183
            F
Sbjct: 324 FF 325


>gi|149194324|ref|ZP_01871421.1| Thrombospondin type 3 repeat:OmpA/MotB [Caminibacter mediatlanticus
           TB-2]
 gi|149135499|gb|EDM23978.1| Thrombospondin type 3 repeat:OmpA/MotB [Caminibacter mediatlanticus
           TB-2]
          Length = 209

 Score = 68.2 bits (165), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 58/94 (61%), Gaps = 2/94 (2%)

Query: 88  LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQ-RGV 146
           ++K + P ++ +A IL   P+  I +  HTD+IG+ K NL +SQ+RA+ +K  L+    +
Sbjct: 108 VKKIYYPQIKKVAEILKANPNLKIEVAGHTDNIGSAKYNLKLSQKRAEAVKKILVNVYHI 167

Query: 147 SSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEI 180
           + NR ++ RG+  KYP+  N T   R  N+R+EI
Sbjct: 168 NPNRIVA-RGYGEKYPLVPNTTSTNRALNRRVEI 200


>gi|253999219|ref|YP_003051282.1| OmpA/MotB domain-containing protein [Methylovorus sp. SIP3-4]
 gi|253985898|gb|ACT50755.1| OmpA/MotB domain protein [Methylovorus sp. SIP3-4]
          Length = 222

 Score = 68.2 bits (165), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 43/140 (30%), Positives = 73/140 (52%), Gaps = 3/140 (2%)

Query: 43  FGSSLDKAEDEFQMQLQDTGIVVSRIGD-MITCYIPVHVSFVS-EVFLEKKFLPMLQLIA 100
           +   +++ + + +     TG+ VS+  D  +   IP  +SF S +  ++  F P+L   A
Sbjct: 71  WSRRMEEQKQQMEQATAGTGVQVSQTADNRLKLDIPSDISFDSGKSDIKPNFRPVLDSFA 130

Query: 101 TILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYK 160
             L   P+T + I  HTD+ GT   N  +S  RA+  + YL+ RGV+S+RF +  G    
Sbjct: 131 QSLVANPATRVTIVGHTDNTGTDAVNNPLSLNRANHARDYLVTRGVASSRF-TTEGRGSH 189

Query: 161 YPIDTNDTKVGRQNNQRIEI 180
            P+  N++   R  N+R+EI
Sbjct: 190 EPLVENNSDANRAKNRRVEI 209


>gi|313201307|ref|YP_004039965.1| ompa/motb domain-containing protein [Methylovorus sp. MP688]
 gi|312440623|gb|ADQ84729.1| OmpA/MotB domain protein [Methylovorus sp. MP688]
          Length = 222

 Score = 68.2 bits (165), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 43/140 (30%), Positives = 73/140 (52%), Gaps = 3/140 (2%)

Query: 43  FGSSLDKAEDEFQMQLQDTGIVVSRIGD-MITCYIPVHVSFVS-EVFLEKKFLPMLQLIA 100
           +   +++ + + +     TG+ VS+  D  +   IP  +SF S +  ++  F P+L   A
Sbjct: 71  WSRRMEEQKQQMEQATAGTGVQVSQTADNRLKLDIPSDISFDSGKSDIKPNFRPVLDSFA 130

Query: 101 TILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYK 160
             L   P+T + I  HTD+ GT   N  +S  RA+  + YL+ RGV+S+RF +  G    
Sbjct: 131 QSLVANPATKVTIVGHTDNTGTDAVNNPLSLNRANHARDYLVTRGVASSRF-TTEGRGSH 189

Query: 161 YPIDTNDTKVGRQNNQRIEI 180
            P+  N++   R  N+R+EI
Sbjct: 190 EPLVENNSDANRAKNRRVEI 209


>gi|163737113|ref|ZP_02144531.1| OmpA/MotB [Phaeobacter gallaeciensis BS107]
 gi|161389717|gb|EDQ14068.1| OmpA/MotB [Phaeobacter gallaeciensis BS107]
          Length = 219

 Score = 68.2 bits (165), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 39/145 (26%), Positives = 73/145 (50%), Gaps = 2/145 (1%)

Query: 43  FGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSE-VFLEKKFLPMLQLIAT 101
            G+ LD  E E +  + + GI +   GD +   +P  ++F ++   +       L  +A+
Sbjct: 75  IGNQLDAQERELRQSISNDGISIVNTGDRLIVSLPNDLTFATDSAAVSPAVRSDLNKVAS 134

Query: 102 ILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKY 161
            L ++P++ + +  HTDS G    N  +S+ RA+ +   +   GV  NR + + G     
Sbjct: 135 SLVRYPNSQVQVIGHTDSDGDAGYNQGLSERRANAVADQIQAGGVPYNR-VQIIGRGESQ 193

Query: 162 PIDTNDTKVGRQNNQRIEIQIFPRG 186
           P+ +N T  G+  N+R+EI + P+G
Sbjct: 194 PVASNLTAEGKARNRRVEIVVIPQG 218


>gi|162450713|ref|YP_001613080.1| ompA family outer membrane protein [Sorangium cellulosum 'So ce
           56']
 gi|161161295|emb|CAN92600.1| omp A family outer membrane protein [Sorangium cellulosum 'So ce
           56']
          Length = 578

 Score = 68.2 bits (165), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 37/106 (34%), Positives = 60/106 (56%), Gaps = 3/106 (2%)

Query: 78  VHVSFVSEVFLEKKFLPMLQLIATILNKFPS-TVIAIQSHTDSIGTLKNNLLISQERADV 136
           V   F S   L + + P+L  +  +L   P   +++I+ HTD+ GT+  N  ++  RA  
Sbjct: 467 VEFEFDSSRILPQSY-PILDEVVRLLKANPEIKLLSIEGHTDNQGTIDYNDRLAHNRAIA 525

Query: 137 IKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           ++ YLI +GV S R  S+ G+  + P+ +NDT  GRQ N+R+E  I
Sbjct: 526 VRVYLINKGVQSERLTSI-GYGSRRPLLSNDTPEGRQRNRRVEFHI 570


>gi|282881335|ref|ZP_06290015.1| OmpA family protein [Prevotella timonensis CRIS 5C-B1]
 gi|281304811|gb|EFA96891.1| OmpA family protein [Prevotella timonensis CRIS 5C-B1]
          Length = 225

 Score = 68.2 bits (165), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 36/101 (35%), Positives = 56/101 (55%)

Query: 84  SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQ 143
           S+  L +     L   +T+L K     + I  HTDS G    N+ +S +RA  + +YL  
Sbjct: 111 SKAILNQASKNELAKFSTVLKKNRDCHVDILGHTDSTGNDGINIPLSNDRAQSVVNYLKS 170

Query: 144 RGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
            GVSS++F +V G     P+ TN+TK GRQ N+R+E+ ++ 
Sbjct: 171 CGVSSSQFQNVSGMGSSQPVATNETKAGRQQNRRVEVYLYA 211


>gi|71909465|ref|YP_287052.1| surface antigen protein [Dechloromonas aromatica RCB]
 gi|71849086|gb|AAZ48582.1| OmpA/MotB:Rickettsia 17 kDa surface antigen [Dechloromonas
           aromatica RCB]
          Length = 221

 Score = 68.2 bits (165), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 46/129 (35%), Positives = 65/129 (50%), Gaps = 3/129 (2%)

Query: 54  FQMQLQDTGIVVSRIGD-MITCYIPVHVSFVSEVF-LEKKFLPMLQLIATILNKFPSTVI 111
            +   Q TGI V++  D  +   IP  +SF S  + +      +L   A+ L + P T +
Sbjct: 87  MEQATQGTGIGVTQTADNQLKLDIPSDLSFDSGHYDINPALHAVLDRFASTLIQNPVTHV 146

Query: 112 AIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVG 171
            I  HTD++G    N  +S  RA   + YL  RGV+SNR IS+ G     PI  N T  G
Sbjct: 147 RIVGHTDNVGGDAINNPLSVNRAAATRDYLASRGVASNR-ISIDGRGSHEPIADNSTPAG 205

Query: 172 RQNNQRIEI 180
           R  N+R+EI
Sbjct: 206 RAKNRRVEI 214


>gi|244538673|dbj|BAH82826.1| fibronectin-binding protein [Campylobacter lari]
          Length = 328

 Score = 68.2 bits (165), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 36/122 (29%), Positives = 64/122 (52%), Gaps = 2/122 (1%)

Query: 62  GIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIG 121
           G ++  IG   T  +  H  F  ++ +  +F   +Q +  +L + P     ++ HTD+ G
Sbjct: 206 GALLDHIGCEKTIMLEGHFGF-DQITVNPEFAQKIQEVGKVLEENPQYYTILEGHTDNTG 264

Query: 122 TLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQ 181
               N  +S ERA  +   L + GV+  + I+ +G+ ++ PI +NDTK GR  N+R+E +
Sbjct: 265 PKAYNQKLSLERAKAVAKELEKAGVAKEK-ITTKGYGFEKPIASNDTKEGRAQNRRVEAK 323

Query: 182 IF 183
            F
Sbjct: 324 FF 325


>gi|51244080|ref|YP_063964.1| outer membrane protein F [Desulfotalea psychrophila LSv54]
 gi|50875117|emb|CAG34957.1| probable outer membrane protein F [Desulfotalea psychrophila LSv54]
          Length = 216

 Score = 68.2 bits (165), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 38/116 (32%), Positives = 64/116 (55%), Gaps = 7/116 (6%)

Query: 70  DMITCYIPVHVSFVSEVF-LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLL 128
           D++T        F +  F ++      +  +AT+LNK+P+T I +  HTDS+G    N  
Sbjct: 104 DVLTATFKGETFFDTNSFTIKPGGWAEVNRVATVLNKYPNTNIKVAGHTDSLGNEAYNQQ 163

Query: 129 ISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           +S+ RA  +K+ LIQ GV+ NR  ++ G+    PI +++ +     N+R+EI I P
Sbjct: 164 LSERRARAVKNALIQYGVNGNRIRAI-GYGESLPISSSNAQ-----NRRVEIVITP 213


>gi|153871249|ref|ZP_02000470.1| outer membrane protein OprF [Beggiatoa sp. PS]
 gi|152072284|gb|EDN69529.1| outer membrane protein OprF [Beggiatoa sp. PS]
          Length = 188

 Score = 68.2 bits (165), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 68/111 (61%), Gaps = 4/111 (3%)

Query: 78  VHVSFVSE-VFLEKKFLPML-QLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERAD 135
           + V F S+   ++ +F P L Q   T+ ++   T+I I  HTD+IG+ + N  +SQ RA 
Sbjct: 79  IRVYFESDSTRIKAEFYPWLHQYAKTLQSELAETMIEIGGHTDNIGSDEYNKDLSQRRAQ 138

Query: 136 VIKSYLIQR-GVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPR 185
            +K+ L+ +  +S+NR I V+G+    P+D N+ + GR  N+R+E++I P+
Sbjct: 139 AVKNILLSKYKISANRLI-VKGYGENQPLDVNENREGRAINRRVELKIVPK 188


>gi|325286152|ref|YP_004261942.1| OmpA/MotB domain-containing protein [Cellulophaga lytica DSM 7489]
 gi|324321606|gb|ADY29071.1| OmpA/MotB domain protein [Cellulophaga lytica DSM 7489]
          Length = 452

 Score = 68.2 bits (165), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 56/88 (63%), Gaps = 2/88 (2%)

Query: 95  MLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISV 154
           M+ +I TIL ++P+    ++ HTDS+G+   N  +S+ RA  +K +L+++G+   R  +V
Sbjct: 365 MVDII-TILKEYPNAKFTVEGHTDSVGSATLNQKLSESRALSVKEFLVEKGIGEFRLSAV 423

Query: 155 RGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
            G+    PI TN T+ GR+ N+R+EI +
Sbjct: 424 -GYGEDKPIATNKTRAGRKQNRRVEINL 450


>gi|153002898|ref|YP_001377223.1| OmpA/MotB domain-containing protein [Anaeromyxobacter sp. Fw109-5]
 gi|152026471|gb|ABS24239.1| OmpA/MotB domain protein [Anaeromyxobacter sp. Fw109-5]
          Length = 510

 Score = 68.2 bits (165), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 53/89 (59%), Gaps = 2/89 (2%)

Query: 95  MLQLIATILNKFPS-TVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFIS 153
           +L  IA +L +    T + I+ H+DS G    N  +SQ RAD +   L++RG++  R +S
Sbjct: 419 LLDEIAKVLAEHAEITRVVIEGHSDSSGGAALNKRLSQARADAVLKALVERGIAKER-LS 477

Query: 154 VRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
            +GF    PI +NDT  GR+ N+R+EI I
Sbjct: 478 AKGFGPSRPIASNDTPEGREANRRVEISI 506


>gi|262194964|ref|YP_003266173.1| OmpA/MotB domain protein [Haliangium ochraceum DSM 14365]
 gi|262078311|gb|ACY14280.1| OmpA/MotB domain protein [Haliangium ochraceum DSM 14365]
          Length = 623

 Score = 68.2 bits (165), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 31/90 (34%), Positives = 54/90 (60%), Gaps = 1/90 (1%)

Query: 93  LPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFI 152
            P+L+ +A +LN  P   + ++ HTD  G    N  +SQ RAD + ++L+++G+++ R +
Sbjct: 525 FPVLKEVARVLNNHPDIELRVEGHTDDRGNDTYNRKLSQRRADSVVAFLVEQGIAAER-L 583

Query: 153 SVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           S +GF  + PI  N +  GR  N+R+E  I
Sbjct: 584 SAKGFGEERPIADNASAQGRDQNRRVEFVI 613


>gi|254787924|ref|YP_003075353.1| OmpA/MotB domain-containing protein [Teredinibacter turnerae T7901]
 gi|237683974|gb|ACR11238.1| OmpA/MotB domain protein [Teredinibacter turnerae T7901]
          Length = 304

 Score = 68.2 bits (165), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 28/85 (32%), Positives = 53/85 (62%), Gaps = 1/85 (1%)

Query: 96  LQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVR 155
           L+ ++ +L ++P   I ++  TDS G    N  +S+ RA+ +   L+  G++ +R +S +
Sbjct: 204 LEKVSDLLAEYPDREILVEGFTDSTGAADYNKNLSERRAEAVVKQLVDNGLAEDR-LSAK 262

Query: 156 GFAYKYPIDTNDTKVGRQNNQRIEI 180
           G+  +YP+ +NDT  GRQ N+R+E+
Sbjct: 263 GYGEEYPVASNDTAAGRQQNRRVEL 287


>gi|242309709|ref|ZP_04808864.1| cadf [Helicobacter pullorum MIT 98-5489]
 gi|239523710|gb|EEQ63576.1| cadf [Helicobacter pullorum MIT 98-5489]
          Length = 308

 Score = 68.2 bits (165), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 55/93 (59%), Gaps = 1/93 (1%)

Query: 91  KFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNR 150
           ++ P +Q  A  + + P     I  HTDS G+   N  +S+ RA  +K  ++++G+S +R
Sbjct: 214 EYYPEIQDFAEYMKQNPDKTATISGHTDSTGSEAYNQKLSERRAISVKEEIVKQGISPDR 273

Query: 151 FISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
            +  +G+  + PI TN TK GRQ N+R+E +++
Sbjct: 274 -LDTKGYGEEKPIATNKTKEGRQANRRVEAEVY 305


>gi|221640526|ref|YP_002526788.1| OmpA/MotB domain-containing protein [Rhodobacter sphaeroides KD131]
 gi|221161307|gb|ACM02287.1| OmpA/MotB domain protein precursor [Rhodobacter sphaeroides KD131]
          Length = 228

 Score = 68.2 bits (165), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 45/151 (29%), Positives = 74/151 (49%), Gaps = 8/151 (5%)

Query: 38  IVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQ 97
           I+    GS+LD+   + +  + ++ + V+  G  +   +P  + F ++        P LQ
Sbjct: 80  ILGGAVGSALDRQAADLRNSIGNSQVSVTNTGSELVVTMPQDILFATD---SANLRPDLQ 136

Query: 98  ----LIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFIS 153
                +A  L ++P++ IA+  HTDS G+   N  +S  RA  +   LI  GV S R +S
Sbjct: 137 RDLGAVAQNLLRYPNSTIAVVGHTDSTGSAAYNQDLSMRRAQSVAGVLIGNGVPSYR-VS 195

Query: 154 VRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
             G     PI +N T  GR  N+R++I I P
Sbjct: 196 AIGRGEDQPIASNLTPEGRAQNRRVDIIIRP 226


>gi|315224547|ref|ZP_07866374.1| OmpA family protein [Capnocytophaga ochracea F0287]
 gi|314945568|gb|EFS97590.1| OmpA family protein [Capnocytophaga ochracea F0287]
          Length = 230

 Score = 68.2 bits (165), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 39/151 (25%), Positives = 77/151 (50%), Gaps = 7/151 (4%)

Query: 43  FGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV----SEVFLEKKFLPMLQL 98
            G+ +DK   + + ++   G  V R+ D I      +   V    ++  +  K    L  
Sbjct: 73  IGNQMDKQAKKIEEEI--PGADVKRVDDGIVVTFDENNGGVYFDTNKYNINNKSRQTLDK 130

Query: 99  IATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFA 158
           ++ IL ++P T + +  HTD++G  + NL +SQ RA  + +Y   +G++ +RF + + + 
Sbjct: 131 LSAILKEYPDTNVIVAGHTDNVGKDEYNLGLSQRRAQAVTNYFKSKGLAGSRF-TTKWYG 189

Query: 159 YKYPIDTNDTKVGRQNNQRIEIQIFPRGNIK 189
            + P+ +N+T  GR  N+R+ + I P   +K
Sbjct: 190 ERNPVASNETADGRAKNRRVNVVIVPNEKMK 220


>gi|256425882|ref|YP_003126535.1| OmpA/MotB domain protein [Chitinophaga pinensis DSM 2588]
 gi|256040790|gb|ACU64334.1| OmpA/MotB domain protein [Chitinophaga pinensis DSM 2588]
          Length = 630

 Score = 68.2 bits (165), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 30/88 (34%), Positives = 52/88 (59%), Gaps = 1/88 (1%)

Query: 96  LQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVR 155
           L  +  +L + P+  I I  HTD+IG  K+N+L+S+ RA  +  YL+ +G+++ R +  +
Sbjct: 542 LNRLVALLRENPTVTIEISGHTDNIGNTKDNVLLSERRAQAVVKYLVDKGIAAER-LQAK 600

Query: 156 GFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
           G+    P+  N T  GR  N+R E++I 
Sbjct: 601 GYGETKPVADNMTAAGRAENRRTELKIL 628


>gi|149185339|ref|ZP_01863656.1| outer membrane protein [Erythrobacter sp. SD-21]
 gi|148831450|gb|EDL49884.1| outer membrane protein [Erythrobacter sp. SD-21]
          Length = 210

 Score = 67.8 bits (164), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 47/147 (31%), Positives = 79/147 (53%), Gaps = 8/147 (5%)

Query: 44  GSSLDKAEDEFQMQLQDTGIVVSRI--GDMITCYIPVHVSFVS-EVFLEKKFLPMLQLIA 100
           G  +D+   E + Q   +GI VS    G+ I   +P  V+F +    +   F   L  +A
Sbjct: 53  GYRMDQQIKELEEQTAGSGIDVSETDGGNAILVNLPDGVTFATGSATINSAFRNTLDNVA 112

Query: 101 TILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYK 160
             L ++P+++I +  +TD+ G+   N  +S++RA  + +YLI RGVSS+R I  +G+  +
Sbjct: 113 ANLVQYPNSLIDVYGYTDTTGSDSLNQRLSEQRAQAVANYLISRGVSSSR-IRWQGYGEQ 171

Query: 161 YP---IDTNDTKVGRQNNQRIEIQIFP 184
           Y    + T D  V    N+R+EI+I P
Sbjct: 172 YEHLKVKTAD-GVNEPMNRRVEIKIIP 197


>gi|114332359|ref|YP_748581.1| OmpA/MotB domain-containing protein [Nitrosomonas eutropha C91]
 gi|114309373|gb|ABI60616.1| OmpA/MotB domain protein [Nitrosomonas eutropha C91]
          Length = 220

 Score = 67.8 bits (164), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 46/136 (33%), Positives = 68/136 (50%), Gaps = 5/136 (3%)

Query: 51  EDEFQMQ--LQDTGIVVSRIGD-MITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKF 106
           E + QM+     TG++VS+  D  +   IP  +SF      ++  F P+L   AT L   
Sbjct: 77  EQKIQMENATAGTGVMVSQTADNRLMLNIPSDISFDTGSAQIKPGFRPILDSFATSLLNN 136

Query: 107 PSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTN 166
           P T + I  HTD+ G+   N  +S  RA   + YL  RGV   R I + G     P+ +N
Sbjct: 137 PGTHVTIVGHTDNTGSDAVNNPLSVNRAASTREYLAGRGVPFQR-IQIDGRGSYQPVASN 195

Query: 167 DTKVGRQNNQRIEIQI 182
           +T  GR  N+R+EI +
Sbjct: 196 NTAAGRARNRRVEIYV 211


>gi|322417908|ref|YP_004197131.1| OmpA/MotB domain-containing protein [Geobacter sp. M18]
 gi|320124295|gb|ADW11855.1| OmpA/MotB domain protein [Geobacter sp. M18]
          Length = 169

 Score = 67.8 bits (164), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 53/88 (60%), Gaps = 2/88 (2%)

Query: 96  LQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQ-RGVSSNRFISV 154
           +  IA I+  +P   + +  HTD++G  + N+ +SQ+RAD +  YL + +GV + R +S 
Sbjct: 80  MTAIAAIMTDYPGFHVQVDGHTDNVGKPEANMKLSQDRADAVVKYLAEKKGVDAKR-LSA 138

Query: 155 RGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           +GF    PI +N TK G+  N+R++  +
Sbjct: 139 KGFGDTQPIASNKTKAGQAKNRRVDFTV 166


>gi|114764072|ref|ZP_01443311.1| OmpA domain protein [Pelagibaca bermudensis HTCC2601]
 gi|114543430|gb|EAU46445.1| OmpA domain protein [Roseovarius sp. HTCC2601]
          Length = 221

 Score = 67.8 bits (164), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 48/141 (34%), Positives = 72/141 (51%), Gaps = 7/141 (4%)

Query: 47  LDKAEDEFQMQL-QDTGIVVSRIGDMITCYIPVHV--SFVSEVFLEKKFLPMLQLIATIL 103
           LDK E E + QL  D GI     GD +   +P  +   F S+  L       ++ + + L
Sbjct: 83  LDKQEAELRQQLGNDVGI--RNTGDRLIVTMPQDILFGFDSDT-LRNDLQADIRTVGSSL 139

Query: 104 NKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPI 163
            ++P+T + +  HTDS G    N  +SQ RA  + + L+  GV S+R ISV G     P+
Sbjct: 140 LQYPNTSVQVVGHTDSDGDAGYNQGLSQRRAQSVANVLVSSGVPSSR-ISVIGRGEAAPV 198

Query: 164 DTNDTKVGRQNNQRIEIQIFP 184
            +N T  G+  N+R+EI I P
Sbjct: 199 ASNLTPEGKAQNRRVEIVILP 219


>gi|27804808|gb|AAO22853.1| outer membrane protein A-like protein [Myxococcus xanthus]
          Length = 241

 Score = 67.8 bits (164), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 59/97 (60%), Gaps = 2/97 (2%)

Query: 84  SEVFLEKKFLPMLQLIATILNKFPS-TVIAIQSHTDSIGTLKNNLLISQERADVIKSYLI 142
           ++  ++K+   +L  +A ++ + P   ++ + +HTD  G   +N  +SQ RA+ ++ YLI
Sbjct: 130 TQARIQKRSYELLDWVARVIREHPEIPLVVVGAHTDDRGFPDDNRRLSQGRAEAVRQYLI 189

Query: 143 QRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIE 179
            R ++  R  ++ G+  + PID+N T  GR+NN+R+E
Sbjct: 190 GRDIAPERLKAL-GYGQERPIDSNATSNGRENNRRVE 225


>gi|27366989|ref|NP_762516.1| outer membrane protein A [Vibrio vulnificus CMCP6]
 gi|37676767|ref|NP_937163.1| outer membrane protein [Vibrio vulnificus YJ016]
 gi|27358557|gb|AAO07506.1| Outer membrane protein A precursor [Vibrio vulnificus CMCP6]
 gi|37201310|dbj|BAC97133.1| outer membrane protein [Vibrio vulnificus YJ016]
          Length = 357

 Score = 67.8 bits (164), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 51/87 (58%), Gaps = 1/87 (1%)

Query: 96  LQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVR 155
           L  +A +L K+P     I  HTDS G+ K N  IS++RA  +  YL+++GV + + + VR
Sbjct: 259 LTPLAEVLIKYPDAEAEIVGHTDSTGSEKVNQRISEQRAQAVADYLVEQGVKAEQ-LKVR 317

Query: 156 GFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           G     PI +N T  GR  N+R+E+ I
Sbjct: 318 GAGESQPIASNKTAEGRAQNRRVEVTI 344


>gi|222054709|ref|YP_002537071.1| OmpA/MotB domain protein [Geobacter sp. FRC-32]
 gi|221563998|gb|ACM19970.1| OmpA/MotB domain protein [Geobacter sp. FRC-32]
          Length = 474

 Score = 67.8 bits (164), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 55/82 (67%), Gaps = 2/82 (2%)

Query: 99  IATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQR-GVSSNRFISVRGF 157
           +   + ++P T   I+ HTD++GT ++NL +S+ RA+ + +YL+ + G+  +R +S  G+
Sbjct: 261 VGEFMQRYPDTTAVIEGHTDNVGTDEHNLDLSRRRAESVTNYLVDKFGIDRSR-LSSTGY 319

Query: 158 AYKYPIDTNDTKVGRQNNQRIE 179
            +K+P+  N T+ G+Q N+RI+
Sbjct: 320 GFKHPVADNGTEAGKQKNRRID 341



 Score = 57.8 bits (138), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 55/92 (59%), Gaps = 2/92 (2%)

Query: 88  LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQR-GV 146
           ++ ++   +  +A  + ++P+T   I+ HTD+ GT   N  +SQERA+ + +YL+++ G+
Sbjct: 374 IQPRYHDEIAKVAEYMKRYPTTTALIEGHTDNTGTADFNQKLSQERAENVVNYLVEKLGI 433

Query: 147 SSNRFISVRGFAYKYPIDTNDTKVGRQNNQRI 178
             +R +S +G+     +  N T  GR+ N+RI
Sbjct: 434 ERSR-LSAKGYGASRRLAYNTTAEGRKKNRRI 464


>gi|124007996|ref|ZP_01692696.1| outer membrane protein [Microscilla marina ATCC 23134]
 gi|123986580|gb|EAY26379.1| outer membrane protein [Microscilla marina ATCC 23134]
          Length = 336

 Score = 67.8 bits (164), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 34/101 (33%), Positives = 56/101 (55%), Gaps = 1/101 (0%)

Query: 83  VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLI 142
           VS   +E      L  +   LN++P  V+ +  HTD+ G    N L+SQ RA  +++YL 
Sbjct: 235 VSSSKIESTSFDELDRLVRTLNEYPKMVVQLNGHTDNQGGATRNQLLSQHRARSVRNYLA 294

Query: 143 QRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
            +G++ +R + V+GF    PI  N+T  GR  N+R+E ++ 
Sbjct: 295 NKGIARHR-VKVKGFGASQPIADNNTLKGRIRNRRVEFEVL 334


>gi|83718754|ref|YP_443463.1| OmpA domain-containing protein [Burkholderia thailandensis E264]
 gi|167621163|ref|ZP_02389794.1| OmpA domain protein [Burkholderia thailandensis Bt4]
 gi|257137752|ref|ZP_05586014.1| OmpA domain-containing protein [Burkholderia thailandensis E264]
 gi|83652579|gb|ABC36642.1| OmpA domain protein [Burkholderia thailandensis E264]
          Length = 311

 Score = 67.8 bits (164), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 32/85 (37%), Positives = 50/85 (58%), Gaps = 1/85 (1%)

Query: 95  MLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISV 154
           +L  +A  L K P+  + I  HTD+ G   +N+ +SQ RAD +K YL+ +G++S +  + 
Sbjct: 223 ILDQMAGALAKMPNRTVEIIGHTDNSGNRASNIALSQSRADAVKGYLVTKGIASQQLTTT 282

Query: 155 RGFAYKYPIDTNDTKVGRQNNQRIE 179
            G     PI +ND+  GR  N+RIE
Sbjct: 283 -GVGPDQPIASNDSADGRARNRRIE 306


>gi|254786261|ref|YP_003073690.1| hypothetical protein TERTU_2240 [Teredinibacter turnerae T7901]
 gi|237686902|gb|ACR14166.1| conserved repeat domain protein [Teredinibacter turnerae T7901]
          Length = 3228

 Score = 67.8 bits (164), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 29/87 (33%), Positives = 53/87 (60%), Gaps = 1/87 (1%)

Query: 96   LQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVR 155
            LQ     L ++P   I+I++HTD++G  ++NL +S+ RA  ++ + +  GV + R +S R
Sbjct: 3134 LQNAVDALQRYPRLAISIRAHTDAVGKAEDNLALSEARALAVQQFFVAAGVDNER-LSAR 3192

Query: 156  GFAYKYPIDTNDTKVGRQNNQRIEIQI 182
            G+    P+  N T  GR  N+R+E+++
Sbjct: 3193 GYGEAEPVADNSTAAGRAQNRRVELKL 3219


>gi|85709715|ref|ZP_01040780.1| outer membrane protein [Erythrobacter sp. NAP1]
 gi|85688425|gb|EAQ28429.1| outer membrane protein [Erythrobacter sp. NAP1]
          Length = 231

 Score = 67.8 bits (164), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 48/153 (31%), Positives = 78/153 (50%), Gaps = 12/153 (7%)

Query: 38  IVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGD--MITCYIPVHVSFVS-EVFLEKKFLP 94
           +V K+F    D    E   +L+ TG+ V  IGD   I   +P  V+F S    +   F  
Sbjct: 73  VVGKQF----DDQIRELDEELEGTGVDVEEIGDQDAILVRLPDGVTFASGSATINPGFYD 128

Query: 95  MLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISV 154
            L  +A  L ++P++++ +   TD+ G+   N  +S++RA  +  YL  RGV+ +R ++ 
Sbjct: 129 SLNSVANSLIQYPNSLVDVYGFTDTTGSDSLNQRLSEQRAQAVADYLASRGVARSR-LAT 187

Query: 155 RGFAYKYP---IDTNDTKVGRQNNQRIEIQIFP 184
           RG+   Y    I T D  V    N+R+EI+I P
Sbjct: 188 RGYGESYDYLRIKTAD-GVAEPLNRRVEIKIIP 219


>gi|213028311|ref|ZP_03342758.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Typhi str. 404ty]
          Length = 111

 Score = 67.8 bits (164), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 35/101 (34%), Positives = 56/101 (55%), Gaps = 1/101 (0%)

Query: 84  SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQ 143
           S   L+      L  +A +L ++P T + +  +TDS G+   N+ +SQ+RAD + S LI 
Sbjct: 10  SSATLKPAGANTLTGVAMVLKEYPKTAVNVVGYTDSTGSHDLNMRLSQQRADSVASSLIT 69

Query: 144 RGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           +GV ++R I   G     PI +N T  G+  N+R+EI + P
Sbjct: 70  QGVDASR-IRTSGMGPANPIASNSTAEGKAQNRRVEITLSP 109


>gi|213963452|ref|ZP_03391706.1| OmpA family protein [Capnocytophaga sputigena Capno]
 gi|213953860|gb|EEB65188.1| OmpA family protein [Capnocytophaga sputigena Capno]
          Length = 454

 Score = 67.8 bits (164), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 56/88 (63%), Gaps = 1/88 (1%)

Query: 95  MLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISV 154
           +L  I  +LNK+ +   +I+ +TD+ G    N  +S++RA  +K+YLI +G+   R ++ 
Sbjct: 366 VLNNIVNVLNKYKNAKFSIEGYTDTSGNKAKNQKLSEDRAYSVKAYLIDKGIDQAR-LTA 424

Query: 155 RGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           +GF  + PI +N TK GR+ N+R+EI +
Sbjct: 425 KGFGPEKPIASNKTKKGRELNRRVEINL 452


>gi|77464614|ref|YP_354118.1| OmpA family protein [Rhodobacter sphaeroides 2.4.1]
 gi|126463454|ref|YP_001044568.1| OmpA/MotB domain-containing protein [Rhodobacter sphaeroides ATCC
           17029]
 gi|332559507|ref|ZP_08413829.1| OmpA/MotB domain-containing protein [Rhodobacter sphaeroides WS8N]
 gi|77389032|gb|ABA80217.1| OmpA family protein [Rhodobacter sphaeroides 2.4.1]
 gi|126105118|gb|ABN77796.1| OmpA/MotB domain protein [Rhodobacter sphaeroides ATCC 17029]
 gi|332277219|gb|EGJ22534.1| OmpA/MotB domain-containing protein [Rhodobacter sphaeroides WS8N]
          Length = 228

 Score = 67.4 bits (163), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 45/151 (29%), Positives = 73/151 (48%), Gaps = 8/151 (5%)

Query: 38  IVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQ 97
           I+    GS+LD+   + +  + ++ + V+  G  +   +P  + F ++        P LQ
Sbjct: 80  ILGGAVGSALDRQAADLRNSIGNSQVSVTNTGSELVVTMPQDILFATD---SANLRPDLQ 136

Query: 98  ----LIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFIS 153
                +A  L ++P++ IA+  HTDS G    N  +S  RA  +   LI  GV S R +S
Sbjct: 137 RDLGAVAQNLLRYPNSTIAVVGHTDSTGAAAYNQDLSMRRAQSVAGVLIGNGVPSYR-VS 195

Query: 154 VRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
             G     PI +N T  GR  N+R++I I P
Sbjct: 196 AIGRGEDQPIASNLTPEGRAQNRRVDIIIRP 226


>gi|45656435|ref|YP_000521.1| peptidoglycan associated periplasmic protein [Leptospira
           interrogans serovar Copenhageni str. Fiocruz L1-130]
 gi|45599670|gb|AAS69158.1| peptidoglycan associated periplasmic protein [Leptospira
           interrogans serovar Copenhageni str. Fiocruz L1-130]
          Length = 660

 Score = 67.4 bits (163), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 32/92 (34%), Positives = 52/92 (56%)

Query: 94  PMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFIS 153
           P L  +A I+ + P   I I+ HTD+IG  K+NL++S++RA  +  YL Q+   S   I 
Sbjct: 567 PELDRLAEIVKENPDIEIQIEGHTDNIGKKKDNLILSEKRAAAVAEYLFQKHSISKTRIQ 626

Query: 154 VRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPR 185
            +GF    P+  ND++  R+ N+R+   I  +
Sbjct: 627 TKGFGDSVPLSKNDSEEARKKNRRVNFTILKK 658


>gi|224023377|ref|ZP_03641743.1| hypothetical protein BACCOPRO_00070 [Bacteroides coprophilus DSM
           18228]
 gi|224016599|gb|EEF74611.1| hypothetical protein BACCOPRO_00070 [Bacteroides coprophilus DSM
           18228]
          Length = 239

 Score = 67.4 bits (163), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 47/158 (29%), Positives = 75/158 (47%), Gaps = 20/158 (12%)

Query: 43  FGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATI 102
            G  +DKA  + Q   Q  G  V ++ D       V V+F S +        +       
Sbjct: 72  IGKKMDKAAQQAQ---QIEGAEVEQVTDN-NGLQAVKVTFDSGILFTTSSATLSSAAKAS 127

Query: 103 LNKFPSTV--------IAIQSHTDSIG--------TLKNNLLISQERADVIKSYLIQRGV 146
           L+KF + V        +AI  +TD+ G        +++ NL +SQERA  + SYL+  GV
Sbjct: 128 LSKFANNVLNQNRDMDVAIYGYTDNQGWRNSTKEQSVQKNLNLSQERAQSVSSYLLGCGV 187

Query: 147 SSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           S+++  SV G     P+  N T+ GRQ N+R+E+ ++ 
Sbjct: 188 SASQIKSVEGMGESNPVADNSTEAGRQENRRVEVYMYA 225


>gi|167589254|ref|ZP_02381642.1| OmpA/MotB domain protein [Burkholderia ubonensis Bu]
          Length = 246

 Score = 67.4 bits (163), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 52/88 (59%), Gaps = 1/88 (1%)

Query: 95  MLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISV 154
           +L  +A  L+K P+  + +  HTD+ G   +N+ +SQ RAD +K YLI +G++S +  + 
Sbjct: 158 VLDQMAAALSKMPNRTVDLIGHTDNSGNRASNIALSQARADAVKGYLITKGIASQQMTTT 217

Query: 155 RGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
            G     PI  NDT  GR  N+RI+ ++
Sbjct: 218 -GVGPDQPIAPNDTAEGRARNRRIDFRV 244


>gi|39995916|ref|NP_951867.1| OmpA domain-containing protein [Geobacter sulfurreducens PCA]
 gi|39982680|gb|AAR34140.1| OmpA domain protein [Geobacter sulfurreducens PCA]
 gi|298504930|gb|ADI83653.1| OmpA domain porin [Geobacter sulfurreducens KN400]
          Length = 466

 Score = 67.4 bits (163), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 39/116 (33%), Positives = 66/116 (56%), Gaps = 4/116 (3%)

Query: 69  GDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNL 127
           G M  C I +++ F + +  +  ++   ++ +A  L ++PST   I+ HTD++G    N+
Sbjct: 221 GLMKYC-ITLNIEFDIDKADVRPQYHDEVKRVADFLKEYPSTTAVIEGHTDNVGDDAYNM 279

Query: 128 LISQERADVIKSYLIQR-GVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
            +SQ RA+ + +YL+   G+   R +S RGF    PI  N T+ G+Q N+RIE  I
Sbjct: 280 RLSQRRAESVVNYLVDNFGIDRTR-LSARGFGKTRPIADNSTEAGKQRNRRIEAII 334



 Score = 57.8 bits (138), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 30/105 (28%), Positives = 60/105 (57%), Gaps = 3/105 (2%)

Query: 76  IPVHVSFVSEVF-LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERA 134
           I + V F ++ + ++ ++   +  +   + + P+T   I+ HTD +GT  +N+ +S  RA
Sbjct: 353 IALKVQFDTDKWDIKPQYRGEIAKVGDFMTRNPTTTAIIEGHTDRVGTADHNMKLSLRRA 412

Query: 135 DVIKSYLIQR-GVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRI 178
           + + +YL++  G+  +R +S +G+ +  PI  N T  GR  N+RI
Sbjct: 413 EAVVNYLVEHFGIERSR-LSAKGYGFSRPIAYNSTAEGRALNRRI 456


>gi|244538688|dbj|BAH82838.1| fibronectin-binding protein [Campylobacter lari]
          Length = 328

 Score = 67.4 bits (163), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 36/122 (29%), Positives = 63/122 (51%), Gaps = 2/122 (1%)

Query: 62  GIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIG 121
           G ++  IG   T  +  H  F  ++ +  +F   +Q +  +L + P     ++ HTDS G
Sbjct: 206 GALLDHIGCEKTIALEGHFGF-DQISINPEFAQKIQEVGKVLEENPQYYTILEGHTDSTG 264

Query: 122 TLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQ 181
           +   N  +S ERA  +   L + GV+  + I+ +G+ +  P  +NDTK GR  N+R+E +
Sbjct: 265 SKTYNQKLSLERAKAVAKELEKSGVAKEK-IATKGYGFDKPKASNDTKEGRAQNRRVEAK 323

Query: 182 IF 183
            F
Sbjct: 324 FF 325


>gi|49083000|gb|AAT50900.1| PA3692 [synthetic construct]
          Length = 262

 Score = 67.4 bits (163), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 53/87 (60%), Gaps = 1/87 (1%)

Query: 96  LQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVR 155
           +Q +A  L + P   + ++ +TDS G+   N  +S+ RAD ++  L+ RG+S  R ++ R
Sbjct: 161 IQQLAEFLQQNPERQVIVEGYTDSTGSANYNQRLSERRADSVRMALLSRGISPER-VATR 219

Query: 156 GFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           G+  +YP+ +N T  GR  N+R+E+ I
Sbjct: 220 GYGKEYPVASNGTSSGRAMNRRVEVTI 246


>gi|160885976|ref|ZP_02066979.1| hypothetical protein BACOVA_03981 [Bacteroides ovatus ATCC 8483]
 gi|260170568|ref|ZP_05756980.1| OmpA family outer membrane protein [Bacteroides sp. D2]
 gi|315918915|ref|ZP_07915155.1| outer membrane protein [Bacteroides sp. D2]
 gi|156108789|gb|EDO10534.1| hypothetical protein BACOVA_03981 [Bacteroides ovatus ATCC 8483]
 gi|313692790|gb|EFS29625.1| outer membrane protein [Bacteroides sp. D2]
          Length = 238

 Score = 67.4 bits (163), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 47/157 (29%), Positives = 76/157 (48%), Gaps = 20/157 (12%)

Query: 44  GSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATIL 103
           G  +DKA  E +   Q  G  V +I D       V V+F S +        +     + L
Sbjct: 73  GKKMDKAAAEAK---QIEGAQVEQITDN-NGLQAVKVTFDSGILFTTGNANLSAAAKSAL 128

Query: 104 NKFPSTV--------IAIQSHTDSIG--------TLKNNLLISQERADVIKSYLIQRGVS 147
           +KF + V        ++I  +TD+ G        + + NL +SQERA  + SYL+  GVS
Sbjct: 129 SKFANNVLNQNRDMDVSIYGYTDNQGWKNSTAAQSQQKNLNLSQERAQSVSSYLLSCGVS 188

Query: 148 SNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           +N+   V+G     P+ +NDT  GR+ N+R+E+ ++ 
Sbjct: 189 TNQIKGVQGMGESDPVASNDTAAGREQNRRVEVYMYA 225


>gi|308050039|ref|YP_003913605.1| OmpA/MotB domain protein [Ferrimonas balearica DSM 9799]
 gi|307632229|gb|ADN76531.1| OmpA/MotB domain protein [Ferrimonas balearica DSM 9799]
          Length = 296

 Score = 67.4 bits (163), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 42/128 (32%), Positives = 69/128 (53%), Gaps = 11/128 (8%)

Query: 73  TCYIPVHVSFVSEVFLEKK---FLP------MLQLIATILNKFPS-TVIAIQSHTDSIGT 122
           T  +P   S V  V L  +    LP       L  IA  +   P  T + +  HTD++G 
Sbjct: 164 TALVPQPFSAVRHVTLSYRSGQLLPNTAQLNQLSDIAAYVAADPRITEVLVDGHTDNVGD 223

Query: 123 LKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
              NL +S++RAD + + L +RG+S +R I VRG   +YP+ +N+   GRQ+N+R+ I++
Sbjct: 224 HLANLALSRDRADEVGALLHERGISRDR-IQVRGHGERYPLLSNNNAQGRQHNRRVTIRL 282

Query: 183 FPRGNIKK 190
              G +++
Sbjct: 283 VRDGQVQE 290


>gi|153806760|ref|ZP_01959428.1| hypothetical protein BACCAC_01032 [Bacteroides caccae ATCC 43185]
 gi|149131437|gb|EDM22643.1| hypothetical protein BACCAC_01032 [Bacteroides caccae ATCC 43185]
          Length = 238

 Score = 67.4 bits (163), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 47/157 (29%), Positives = 76/157 (48%), Gaps = 20/157 (12%)

Query: 44  GSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATIL 103
           G  +DKA  E +   Q  G  V +I D       V V+F S +        +     + L
Sbjct: 73  GKKMDKAAAEAK---QIEGAQVEQITDN-NGLQAVKVTFDSGILFTTGNANLSAAAKSAL 128

Query: 104 NKFPSTV--------IAIQSHTDSIG--------TLKNNLLISQERADVIKSYLIQRGVS 147
           +KF + V        ++I  +TD+ G        + + NL +SQERA  + SYL+  GVS
Sbjct: 129 SKFANNVLNQNRDMDVSIYGYTDNQGWKNSTAAQSQQKNLNLSQERAQSVSSYLLSCGVS 188

Query: 148 SNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           +N+   V+G     P+ +NDT  GR+ N+R+E+ ++ 
Sbjct: 189 TNQIKGVQGMGESDPVASNDTAAGREQNRRVEVYMYA 225


>gi|24216384|ref|NP_713865.1| OmpA family protein [Leptospira interrogans serovar Lai str. 56601]
 gi|24197668|gb|AAN50883.1| OmpA family protein [Leptospira interrogans serovar Lai str. 56601]
          Length = 660

 Score = 67.4 bits (163), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 32/92 (34%), Positives = 52/92 (56%)

Query: 94  PMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFIS 153
           P L  +A I+ + P   I I+ HTD+IG  K+NL++S++RA  +  YL Q+   S   I 
Sbjct: 567 PELDRLAEIVKENPDIEIQIEGHTDNIGKKKDNLILSEKRAAAVAEYLFQKHSISKTRIQ 626

Query: 154 VRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPR 185
            +GF    P+  ND++  R+ N+R+   I  +
Sbjct: 627 TKGFGDSVPLSKNDSEEARKKNRRVNFTILKK 658


>gi|167583014|ref|ZP_02375888.1| OmpA domain protein [Burkholderia thailandensis TXDOH]
          Length = 324

 Score = 67.4 bits (163), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 32/85 (37%), Positives = 50/85 (58%), Gaps = 1/85 (1%)

Query: 95  MLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISV 154
           +L  +A  L K P+  + I  HTD+ G   +N+ +SQ RAD +K YL+ +G++S +  + 
Sbjct: 236 ILDQMAGALAKMPNRTVEIIGHTDNSGNRASNIALSQSRADAVKGYLVTKGIASQQLTTT 295

Query: 155 RGFAYKYPIDTNDTKVGRQNNQRIE 179
            G     PI +ND+  GR  N+RIE
Sbjct: 296 -GVGPDQPIASNDSADGRARNRRIE 319


>gi|313204239|ref|YP_004042896.1| ompa/motb domain protein [Paludibacter propionicigenes WB4]
 gi|312443555|gb|ADQ79911.1| OmpA/MotB domain protein [Paludibacter propionicigenes WB4]
          Length = 410

 Score = 67.4 bits (163), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 49/145 (33%), Positives = 80/145 (55%), Gaps = 10/145 (6%)

Query: 45  SSLDKAEDEFQMQLQDTGIVVSRIG-----DMITCYIPVHVSFVSEVFLEKKFLPMLQLI 99
           ++ ++A D+ ++Q     I  +++      D +T  + V+  F S   L  +   +L  +
Sbjct: 267 ANAERAADKAKLQADLKDIPQAKVSADSNQDALTVLLDVNFEFGSSE-LSSRSRAILDDV 325

Query: 100 ATIL--NKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGF 157
           A +L  NK  S ++ I  HTD+IG  K N  +S+ERA  +K YLI +G+S++  I V GF
Sbjct: 326 ALVLKVNKAWSKLL-ISGHTDNIGGDKANKKLSEERAAGVKKYLISKGISAS-VIDVAGF 383

Query: 158 AYKYPIDTNDTKVGRQNNQRIEIQI 182
             + P  TN+TK GR  N+R E+ I
Sbjct: 384 GKEKPKTTNETKEGRYKNRRAELVI 408


>gi|294670063|ref|ZP_06735018.1| OmpA family protein [Neisseria elongata subsp. glycolytica ATCC
           29315]
 gi|291308146|gb|EFE49389.1| OmpA family protein [Neisseria elongata subsp. glycolytica ATCC
           29315]
          Length = 162

 Score = 67.4 bits (163), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 73/137 (53%), Gaps = 2/137 (1%)

Query: 52  DEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTV 110
           ++ +  L +TG+ V R G+ I   +P +V+F  +   L       L   A  L ++  T 
Sbjct: 17  EKLRESLANTGVDVERNGNQIKLVMPENVTFPTNSSTLNANAQNALAAAAQTLTQYHDTT 76

Query: 111 IAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKV 170
           + I  HTD+ G+   N  +SQ RA  + SYL  RGVS++R +++ G   + PI +N T  
Sbjct: 77  LTINGHTDNTGSDAINDPLSQRRAQAVASYLQSRGVSASR-MNIFGHGSRQPIASNATVE 135

Query: 171 GRQNNQRIEIQIFPRGN 187
           GR  N+R+EI I P  N
Sbjct: 136 GRAQNRRVEILINPDQN 152


>gi|152983975|ref|YP_001346830.1| outer membrane protein [Pseudomonas aeruginosa PA7]
 gi|150959133|gb|ABR81158.1| probable outer membrane protein [Pseudomonas aeruginosa PA7]
          Length = 261

 Score = 67.4 bits (163), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 53/87 (60%), Gaps = 1/87 (1%)

Query: 96  LQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVR 155
           +Q +A  L + P   + ++ +TDS G+   N  +S+ RAD ++  L+ RG+S  R ++ R
Sbjct: 161 IQQLAEFLQQNPERQVIVEGYTDSTGSANYNQRLSERRADSVRMALLSRGISPER-VATR 219

Query: 156 GFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           G+  +YP+ +N T  GR  N+R+E+ I
Sbjct: 220 GYGKEYPVASNGTSSGRAMNRRVEVTI 246


>gi|15598888|ref|NP_252382.1| Lipotoxon F, LptF [Pseudomonas aeruginosa PAO1]
 gi|107103206|ref|ZP_01367124.1| hypothetical protein PaerPA_01004275 [Pseudomonas aeruginosa PACS2]
 gi|116051689|ref|YP_789472.1| putative outer membrane protein, OmpA [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|218890031|ref|YP_002438895.1| putative outer membrane protein precursor [Pseudomonas aeruginosa
           LESB58]
 gi|254236602|ref|ZP_04929925.1| hypothetical protein PACG_02605 [Pseudomonas aeruginosa C3719]
 gi|254242387|ref|ZP_04935709.1| hypothetical protein PA2G_03131 [Pseudomonas aeruginosa 2192]
 gi|296387801|ref|ZP_06877276.1| putative outer membrane protein precursor [Pseudomonas aeruginosa
           PAb1]
 gi|313109098|ref|ZP_07795070.1| putative outer membrane protein precursor [Pseudomonas aeruginosa
           39016]
 gi|9949856|gb|AAG07080.1|AE004788_10 Lipotoxon F, LptF [Pseudomonas aeruginosa PAO1]
 gi|115586910|gb|ABJ12925.1| putative outer membrane protein, OmpA [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|126168533|gb|EAZ54044.1| hypothetical protein PACG_02605 [Pseudomonas aeruginosa C3719]
 gi|126195765|gb|EAZ59828.1| hypothetical protein PA2G_03131 [Pseudomonas aeruginosa 2192]
 gi|218770254|emb|CAW26019.1| probable outer membrane protein precursor [Pseudomonas aeruginosa
           LESB58]
 gi|310881572|gb|EFQ40166.1| putative outer membrane protein precursor [Pseudomonas aeruginosa
           39016]
          Length = 261

 Score = 67.4 bits (163), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 53/87 (60%), Gaps = 1/87 (1%)

Query: 96  LQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVR 155
           +Q +A  L + P   + ++ +TDS G+   N  +S+ RAD ++  L+ RG+S  R ++ R
Sbjct: 161 IQQLAEFLQQNPERQVIVEGYTDSTGSANYNQRLSERRADSVRMALLSRGISPER-VATR 219

Query: 156 GFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           G+  +YP+ +N T  GR  N+R+E+ I
Sbjct: 220 GYGKEYPVASNGTSSGRAMNRRVEVTI 246


>gi|186472491|ref|YP_001859833.1| OmpA/MotB domain-containing protein [Burkholderia phymatum STM815]
 gi|184194823|gb|ACC72787.1| OmpA/MotB domain protein [Burkholderia phymatum STM815]
          Length = 166

 Score = 67.4 bits (163), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 42/138 (30%), Positives = 77/138 (55%), Gaps = 5/138 (3%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           LD++++E   +    GI V++  + +   +P  V F  +E  L       L  +  +LN+
Sbjct: 23  LDRSKEETLNK--QAGIEVTQTKEGVQVRLPEKVLFNFNESSLRPDAATALSRVVVVLNR 80

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
               +I I+ HTD++GT + N  +S+ RA  +   L +RG+S++R I+++G+A+  P+  
Sbjct: 81  THKPMI-IEGHTDNVGTREYNQQLSEARAKSVADELERRGISASR-ITLKGYAFDRPVAD 138

Query: 166 NDTKVGRQNNQRIEIQIF 183
           N+T  GR  N+R EI + 
Sbjct: 139 NNTPEGRARNRRTEIVVM 156


>gi|260642406|ref|ZP_05415772.2| lipoprotein PG3 [Bacteroides finegoldii DSM 17565]
 gi|260622249|gb|EEX45120.1| lipoprotein PG3 [Bacteroides finegoldii DSM 17565]
          Length = 260

 Score = 67.4 bits (163), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 48/157 (30%), Positives = 76/157 (48%), Gaps = 20/157 (12%)

Query: 44  GSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATIL 103
           G  +DKA  E +   Q  G  V +I D       V V+F S +        +     + L
Sbjct: 95  GKKMDKAAAEAK---QIEGAQVEQITDN-NGLKAVKVTFDSGILFTTGNASLSPAAKSAL 150

Query: 104 NKFPSTV--------IAIQSHTDSIG--------TLKNNLLISQERADVIKSYLIQRGVS 147
           +KF + V        ++I  +TD+ G        + + NL +SQERA  + SYL+  GVS
Sbjct: 151 SKFANNVLNQNRDMDVSIYGYTDNQGWRNSTAEQSRQKNLNLSQERAQSVASYLLNCGVS 210

Query: 148 SNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           SN+   V+G     P+ +NDT  GR+ N+R+E+ ++ 
Sbjct: 211 SNQIKGVQGMGESDPVASNDTAAGREQNRRVEVYMYA 247


>gi|312959441|ref|ZP_07773958.1| OmpA/MotB [Pseudomonas fluorescens WH6]
 gi|311286158|gb|EFQ64722.1| OmpA/MotB [Pseudomonas fluorescens WH6]
          Length = 231

 Score = 67.4 bits (163), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 52/105 (49%)

Query: 78  VHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVI 137
           VH  F S          +  + A +  + PS  + +  HTDS+G    N  +SQ+RA  +
Sbjct: 125 VHFQFDSANLTTADKTTLDTIAARLKQEAPSAQLRVSGHTDSVGADAYNQKLSQKRAHSV 184

Query: 138 KSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
             YLI RGV  + F+SV G     P+  N T  GR  N+R +IQI
Sbjct: 185 TEYLISRGVPRSSFVSVVGAGESQPVADNKTAEGRALNRRTQIQI 229


>gi|227538390|ref|ZP_03968439.1| OmpA/MotB family protein [Sphingobacterium spiritivorum ATCC 33300]
 gi|227241772|gb|EEI91787.1| OmpA/MotB family protein [Sphingobacterium spiritivorum ATCC 33300]
          Length = 438

 Score = 67.4 bits (163), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 32/90 (35%), Positives = 56/90 (62%), Gaps = 2/90 (2%)

Query: 94  PMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFIS 153
           P L  +A++L +  +  + +  HTD+ G+++ NL +S+ERA+ +K+YL  +G + +R I 
Sbjct: 351 PSLDRVASLLIE-KNFSLKLAGHTDNTGSMQTNLRLSKERAEAVKAYLTSKGANPSR-IE 408

Query: 154 VRGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
             G+    PI TN T  GRQ N+R+E  ++
Sbjct: 409 ATGYGPNQPIATNATAEGRQQNRRVEFTLY 438


>gi|194290514|ref|YP_002006421.1| outer membrane lipoprotein [Cupriavidus taiwanensis LMG 19424]
 gi|193224349|emb|CAQ70360.1| putative outer membrane lipoprotein [Cupriavidus taiwanensis LMG
           19424]
          Length = 212

 Score = 67.4 bits (163), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 37/110 (33%), Positives = 57/110 (51%), Gaps = 2/110 (1%)

Query: 76  IPVHVSFVSE-VFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERA 134
           IP  V+F ++   ++  F  +L  +A  L++       +  HTDS G    N+ +SQ RA
Sbjct: 101 IPSQVTFDTDSATIKPSFRSVLDQVAQTLSQHQDVSANVVGHTDSTGNPNYNMQLSQRRA 160

Query: 135 DVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
             +  YL  RGV+ NR +S  G     P+  N T+ GR  N+R+EI + P
Sbjct: 161 QSVAGYLGDRGVARNR-LSAEGRGQSQPVADNGTEAGRAQNRRVEIFLKP 209


>gi|237740757|ref|ZP_04571238.1| outer membrane porin F [Fusobacterium sp. 2_1_31]
 gi|229422774|gb|EEO37821.1| outer membrane porin F [Fusobacterium sp. 2_1_31]
          Length = 173

 Score = 67.4 bits (163), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 68/127 (53%), Gaps = 5/127 (3%)

Query: 62  GIVVSRIGDMITCYIPVHVSFVSEVFLEKKFL-PMLQLIATILNKFPSTVIAIQSHTDSI 120
           G+ + R G+ +   +P  + F  + +  K  + P L  +A  L +     I I  +TD I
Sbjct: 50  GVTIRREGNNLILSMPELILFDFDKYAVKDGIKPSLATLAKALGENKDIHIKIDGYTDFI 109

Query: 121 GTLKNNLLISQERADVIKSYLIQRG-VSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIE 179
           GT   NL +S +RA  IK +LI +G + SN  IS+ G+  + P DTN T+ GR  N+R+E
Sbjct: 110 GTEAYNLELSVKRARAIKDFLISKGAIGSN--ISIEGYGEQNPADTNKTEAGRSRNRRVE 167

Query: 180 IQIFPRG 186
             I  RG
Sbjct: 168 F-IISRG 173


>gi|254438169|ref|ZP_05051663.1| OmpA family protein [Octadecabacter antarcticus 307]
 gi|198253615|gb|EDY77929.1| OmpA family protein [Octadecabacter antarcticus 307]
          Length = 220

 Score = 67.0 bits (162), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 41/138 (29%), Positives = 69/138 (50%), Gaps = 3/138 (2%)

Query: 48  DKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKF 106
           D+ E E + ++  +  +V+  G  +   +P  + F      L       L  +A  +N+F
Sbjct: 83  DRQEAELRQEMGSSAQIVN-TGSQLIVTLPQDILFDTGSSALTGGLRNDLNTLAGSMNRF 141

Query: 107 PSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTN 166
           P++ + +  HTD  G+   N  +S  RA  + + LIQ GV+ NR  S+ G     PI TN
Sbjct: 142 PNSTVNVIGHTDWDGSAAFNQDLSARRAQAVSAVLIQSGVAPNRIRSI-GRGEDAPIATN 200

Query: 167 DTKVGRQNNQRIEIQIFP 184
             + G++ N+R+EI I P
Sbjct: 201 LNEEGKRQNRRVEITITP 218


>gi|83944251|ref|ZP_00956706.1| OmpA family protein [Sulfitobacter sp. EE-36]
 gi|83953292|ref|ZP_00962014.1| OmpA family protein [Sulfitobacter sp. NAS-14.1]
 gi|83842260|gb|EAP81428.1| OmpA family protein [Sulfitobacter sp. NAS-14.1]
 gi|83844795|gb|EAP82677.1| OmpA family protein [Sulfitobacter sp. EE-36]
          Length = 222

 Score = 67.0 bits (162), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 72/140 (51%), Gaps = 3/140 (2%)

Query: 46  SLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSE-VFLEKKFLPMLQLIATILN 104
           SLDK E + + QL D+ ++++  GD +   +P  + F ++   ++      L  +A  +N
Sbjct: 82  SLDKQEADLRRQL-DSDVIITNTGDRLIVTLPQDILFATDSTQVQAGMQNDLAALARNVN 140

Query: 105 KFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPID 164
            + ++ + I  HTDS G    N  +S+ RA  + + L+  GV  +R  SV G     P+ 
Sbjct: 141 VYSNSTLQIVGHTDSDGEASYNQQLSEGRARAVANVLVSNGVPGSRIQSV-GRGESQPVA 199

Query: 165 TNDTKVGRQNNQRIEIQIFP 184
           +N    G+  N+R+EI I P
Sbjct: 200 SNLNAAGKAQNRRVEIVILP 219


>gi|120599047|ref|YP_963621.1| OmpA/MotB domain-containing protein [Shewanella sp. W3-18-1]
 gi|146292882|ref|YP_001183306.1| OmpA/MotB domain-containing protein [Shewanella putrefaciens CN-32]
 gi|120559140|gb|ABM25067.1| OmpA/MotB domain protein [Shewanella sp. W3-18-1]
 gi|145564572|gb|ABP75507.1| OmpA/MotB domain protein [Shewanella putrefaciens CN-32]
          Length = 288

 Score = 67.0 bits (162), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 31/82 (37%), Positives = 53/82 (64%), Gaps = 1/82 (1%)

Query: 99  IATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFA 158
           +A  L K+P     I+ +TDS+GT + NL +S+ RAD + ++L  +GV S+R +S +G  
Sbjct: 198 LAAFLGKYPQRGAIIEGYTDSVGTEEYNLGLSERRADSVSNFLQAQGVQSSR-LSSQGKG 256

Query: 159 YKYPIDTNDTKVGRQNNQRIEI 180
             +P+  N++  GRQ N+R+E+
Sbjct: 257 ESFPVANNESASGRQQNRRVEV 278


>gi|95929277|ref|ZP_01312021.1| OmpA/MotB [Desulfuromonas acetoxidans DSM 684]
 gi|95134775|gb|EAT16430.1| OmpA/MotB [Desulfuromonas acetoxidans DSM 684]
          Length = 217

 Score = 67.0 bits (162), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 34/86 (39%), Positives = 52/86 (60%), Gaps = 1/86 (1%)

Query: 99  IATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFA 158
           +A IL ++  T I +  HTDS G+ + NL +S+ RA  +++ L+  GV S R  +V GF 
Sbjct: 132 LAAILTEYHKTTILVAGHTDSTGSEEYNLGLSERRAMAVRNILVASGVISTRITTV-GFG 190

Query: 159 YKYPIDTNDTKVGRQNNQRIEIQIFP 184
              PI  N T+ GRQ N+R+ ++I P
Sbjct: 191 ESAPIADNSTEYGRQLNRRVALKITP 216


>gi|197116453|ref|YP_002136880.1| OmpA family outer membrane lipoprotein [Geobacter bemidjiensis Bem]
 gi|197085813|gb|ACH37084.1| OmpA family outer membrane lipoprotein [Geobacter bemidjiensis Bem]
          Length = 333

 Score = 67.0 bits (162), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 54/93 (58%), Gaps = 2/93 (2%)

Query: 88  LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQR-GV 146
           ++ ++   L+ +A  L +FP+    I+ HTDS+G    N+ +SQ RAD ++ YL+ + G+
Sbjct: 236 IKPQYHDELKALADFLKEFPNATGTIEGHTDSVGDKAANMKLSQRRADSVRKYLVDKFGI 295

Query: 147 SSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIE 179
           +  R  +V G+    P   N T  G+Q N+RIE
Sbjct: 296 APERVKAV-GYGPTKPAADNKTAAGKQKNRRIE 327


>gi|149276320|ref|ZP_01882464.1| OmpA/MotB [Pedobacter sp. BAL39]
 gi|149232840|gb|EDM38215.1| OmpA/MotB [Pedobacter sp. BAL39]
          Length = 448

 Score = 67.0 bits (162), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 49/73 (67%), Gaps = 1/73 (1%)

Query: 111 IAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKV 170
           + +  HTD+ G++  NL +S+ERA+ +K+YL+ +GV+++R +   G+    PI TN T  
Sbjct: 377 LKLAGHTDNTGSMALNLRLSKERAESVKAYLVSQGVNASR-VEATGYGPNQPIATNKTAA 435

Query: 171 GRQNNQRIEIQIF 183
           GRQ N+R+E  ++
Sbjct: 436 GRQQNRRVEFTLY 448


>gi|323495404|ref|ZP_08100481.1| outer membrane protein OmpA [Vibrio brasiliensis LMG 20546]
 gi|323310327|gb|EGA63514.1| outer membrane protein OmpA [Vibrio brasiliensis LMG 20546]
          Length = 324

 Score = 67.0 bits (162), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 58/97 (59%), Gaps = 2/97 (2%)

Query: 88  LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVS 147
           L+ +    L  +   LN +P   + +  +TDS G  + N ++S++RA+ + S L Q+G+ 
Sbjct: 222 LKPESASQLDELVEFLNTYPQAKVEVIGYTDSSGAAEYNQVVSEKRAESVASTLEQKGID 281

Query: 148 SNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           ++R I+ RG     P+ +NDT+ GRQ N+R+E+ I P
Sbjct: 282 ASR-ITARGEGENNPVASNDTREGRQQNRRVEV-IVP 316


>gi|312892040|ref|ZP_07751540.1| OmpA/MotB domain protein [Mucilaginibacter paludis DSM 18603]
 gi|311295412|gb|EFQ72581.1| OmpA/MotB domain protein [Mucilaginibacter paludis DSM 18603]
          Length = 460

 Score = 67.0 bits (162), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 34/92 (36%), Positives = 57/92 (61%), Gaps = 4/92 (4%)

Query: 93  LPMLQLIATIL-NKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRF 151
           LP L  +A +L NK  +  + +  HTD+ G+   N+ +S+ERA+ IK+YL+ +G +++R 
Sbjct: 372 LPSLDKVAELLVNK--NFSLKLAGHTDNSGSAALNMRLSKERAEAIKTYLVSKGANASR- 428

Query: 152 ISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
           I   G+    PI +N T  GRQ N+R+E  ++
Sbjct: 429 IEATGYGMNQPIASNKTAAGRQQNRRVEFTLY 460


>gi|116249829|ref|YP_765667.1| hypothetical protein RL0063 [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115254477|emb|CAK05551.1| conserved hypothetical protein [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 418

 Score = 67.0 bits (162), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 53/86 (61%), Gaps = 1/86 (1%)

Query: 95  MLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISV 154
           +L  IAT L  FP   + I  HTD+ G  + N  +S ERA+ IK+ L++RGV+++R ++ 
Sbjct: 95  LLDDIATALKNFPDWSLRIVGHTDASGNAETNERLSLERANAIKAALVERGVNTDRLLAA 154

Query: 155 RGFAYKYPIDTNDTKVGRQNNQRIEI 180
            G     PI +N+T  G+  N+R+E+
Sbjct: 155 -GAGQTRPIASNETAEGKALNRRVEL 179


>gi|108756980|ref|YP_628607.1| OmpA family protein [Myxococcus xanthus DK 1622]
 gi|108460860|gb|ABF86045.1| OmpA family protein [Myxococcus xanthus DK 1622]
          Length = 409

 Score = 67.0 bits (162), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 35/82 (42%), Positives = 50/82 (60%), Gaps = 2/82 (2%)

Query: 105 KFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPID 164
           K   + + I+ HTDS+G+   N  +S  RA+ ++ +LI +GVS +R I VRG     P+ 
Sbjct: 312 KVSDSPMVIEGHTDSMGSDAMNEALSYRRAEHVREFLISQGVSRDR-IQVRGLGEYRPVA 370

Query: 165 TNDTKVGRQNNQRIEIQIFPRG 186
            N T  GR NN+R+EI I PRG
Sbjct: 371 NNSTPEGRANNRRVEI-ILPRG 391


>gi|296328018|ref|ZP_06870553.1| outer membrane protein OmpF [Fusobacterium nucleatum subsp.
           nucleatum ATCC 23726]
 gi|296154974|gb|EFG95756.1| outer membrane protein OmpF [Fusobacterium nucleatum subsp.
           nucleatum ATCC 23726]
          Length = 182

 Score = 67.0 bits (162), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 45/131 (34%), Positives = 68/131 (51%), Gaps = 5/131 (3%)

Query: 58  LQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFL-PMLQLIATILNKFPSTVIAIQSH 116
             + G+ + R G+ +   +P  + F  + +  K  + P L  +A  L +     I I  +
Sbjct: 55  FNEEGVTIRREGNNLILSMPELILFDFDKYAVKDGIKPSLSTLAKALGENKDIHIKIDGY 114

Query: 117 TDSIGTLKNNLLISQERADVIKSYLIQRG-VSSNRFISVRGFAYKYPIDTNDTKVGRQNN 175
           TD IGT   NL +S +RA  IK +LI +G + SN  IS+ G+  + P DTN T  GR  N
Sbjct: 115 TDFIGTEAYNLDLSVKRARAIKDFLISKGAIGSN--ISIEGYGEQNPADTNQTAAGRSRN 172

Query: 176 QRIEIQIFPRG 186
           +R+E  I  RG
Sbjct: 173 RRVEF-IISRG 182


>gi|332828413|gb|EGK01122.1| hypothetical protein HMPREF9455_02644 [Dysgonomonas gadei ATCC
           BAA-286]
          Length = 224

 Score = 67.0 bits (162), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 48/148 (32%), Positives = 71/148 (47%), Gaps = 15/148 (10%)

Query: 44  GSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVF-------LEKKFLPML 96
           G+ +DK + E +   Q  G  V  I D       + V+F S +        L       L
Sbjct: 73  GNKMDKQKKELE---QINGAQVESINDGQA----IKVTFESGILFATNSSTLNSASQSAL 125

Query: 97  QLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRG 156
              AT LN  P T + I  HTD+ G+   N  +S++RA  + ++L  +GVS +R +S +G
Sbjct: 126 TSFATSLNNNPDTDVQIYGHTDNTGSDAINNPLSEKRAQSVYNFLQTKGVSGSRMVS-QG 184

Query: 157 FAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           F    P+  N T  GR  N+R+EI I P
Sbjct: 185 FGSTQPVADNSTVAGRSQNRRVEIYILP 212


>gi|253997300|ref|YP_003049364.1| OmpA/MotB domain-containing protein [Methylotenera mobilis JLW8]
 gi|253983979|gb|ACT48837.1| OmpA/MotB domain protein [Methylotenera mobilis JLW8]
          Length = 217

 Score = 67.0 bits (162), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 42/138 (30%), Positives = 74/138 (53%), Gaps = 7/138 (5%)

Query: 49  KAEDEFQMQLQD----TGIVVSRIGD-MITCYIPVHVSF-VSEVFLEKKFLPMLQLIATI 102
           K ++E + Q+++    TG+ V++  D  +   IP  +SF V    ++  F  +L   AT 
Sbjct: 73  KRQEEQKRQMEEATAGTGVGVTQTADNRLKLDIPSDISFDVGRADIKANFRAVLDTFATS 132

Query: 103 LNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYP 162
           L   P++ + +  HTD+ G+   N  +S  RA  ++ Y++ RGV  +R I++ G   + P
Sbjct: 133 LVNNPASNVTVIGHTDNTGSDAVNNPLSVNRAASVRDYVVARGVQHSR-ITIEGRGAREP 191

Query: 163 IDTNDTKVGRQNNQRIEI 180
           +  NDT   R  N+R+EI
Sbjct: 192 LVANDTAANRAKNRRVEI 209


>gi|294142621|ref|YP_003558599.1| OmpA family protein [Shewanella violacea DSS12]
 gi|293329090|dbj|BAJ03821.1| OmpA family protein [Shewanella violacea DSS12]
          Length = 200

 Score = 67.0 bits (162), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 57/93 (61%), Gaps = 2/93 (2%)

Query: 87  FLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQR-G 145
           +++  +   +++IA  +N FP+T + I+ H    G+ ++NL +SQ RA+ + S L +   
Sbjct: 83  YIDPMYYDQVEVIAVFMNDFPNTNVTIEGHCSKTGSYEHNLALSQNRANAVTSLLAEHYS 142

Query: 146 VSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRI 178
           ++S+R  ++ G++Y  P+D +DT +    N+R+
Sbjct: 143 IASDRLTAI-GYSYDRPVDESDTDMAHTRNRRV 174


>gi|304384331|ref|ZP_07366742.1| lipoprotein PG3 [Prevotella marshii DSM 16973]
 gi|304334647|gb|EFM00929.1| lipoprotein PG3 [Prevotella marshii DSM 16973]
          Length = 226

 Score = 67.0 bits (162), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 46/145 (31%), Positives = 73/145 (50%), Gaps = 10/145 (6%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVF--LEKKFLPM-----LQLI 99
           +DK + + Q Q+Q+    V  + D +     V V+F S +   L K  L       L   
Sbjct: 71  MDKVKAQTQAQVQNAK--VEEVTD-VNGLKAVKVTFDSGILFALNKAELNATSKNELMNF 127

Query: 100 ATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAY 159
           + +L K     + IQ +TDS G    NL +S  RA  + SYL Q GV  ++F +V+G+  
Sbjct: 128 SNVLKKNTDCQVDIQGYTDSTGNDDINLPLSNSRAQAVVSYLAQCGVPYSQFKNVKGYGS 187

Query: 160 KYPIDTNDTKVGRQNNQRIEIQIFP 184
             P+  N T+ GR+ N+R+E+ I+ 
Sbjct: 188 SNPVADNSTEAGRKQNRRVEVYIYA 212


>gi|303240559|ref|ZP_07327075.1| OmpA/MotB domain protein [Acetivibrio cellulolyticus CD2]
 gi|302591961|gb|EFL61693.1| OmpA/MotB domain protein [Acetivibrio cellulolyticus CD2]
          Length = 556

 Score = 67.0 bits (162), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 72/137 (52%), Gaps = 2/137 (1%)

Query: 44  GSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATIL 103
           GS+    E + + + QD   +      +    IP       +  ++ + + +L  +  +L
Sbjct: 413 GSASQAEEKKKEFKQQDAQSIEKNTERVAKVDIPPVYYDSGKATVKAESIAVLNQVKEML 472

Query: 104 NKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPI 163
           ++FP   + I +HTD++G  +NNL +S++RAD +K YL+Q+GV   R I+ RG+    PI
Sbjct: 473 SQFPEYYLIIDAHTDTVGNNENNLKLSKDRADEVKKYLVQKGVDEKRIIA-RGWGEDRPI 531

Query: 164 DTNDTKVG-RQNNQRIE 179
              ++  G +  N+R E
Sbjct: 532 VPKESTEGDKAKNRRTE 548


>gi|110678313|ref|YP_681320.1| OmpA family domain-containing protein [Roseobacter denitrificans
           OCh 114]
 gi|109454429|gb|ABG30634.1| OmpA family domain protein [Roseobacter denitrificans OCh 114]
          Length = 221

 Score = 67.0 bits (162), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 39/140 (27%), Positives = 71/140 (50%), Gaps = 2/140 (1%)

Query: 46  SLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPM-LQLIATILN 104
           +LD+ E E +  L +  + ++  GD +   +P  + F ++ F  +  L   L  +A  L 
Sbjct: 81  NLDQQEAELRRDLGNDDVQITNTGDRLIVSLPQDLLFATDSFSVRPDLQNDLYTVAGSLQ 140

Query: 105 KFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPID 164
            +P++ I +  HTDS G    N  +S+ RA  +   L+  GV+ +R  ++ G     P+ 
Sbjct: 141 NYPASTIQVIGHTDSDGDAAYNQRLSERRAGSVAGILMDAGVTPSRLQTI-GRGESQPVA 199

Query: 165 TNDTKVGRQNNQRIEIQIFP 184
           +N  + G+  N+R+EI I P
Sbjct: 200 SNLNEAGKAQNRRVEIIILP 219


>gi|262068085|ref|ZP_06027697.1| outer membrane porin F [Fusobacterium periodonticum ATCC 33693]
 gi|291378171|gb|EFE85689.1| outer membrane porin F [Fusobacterium periodonticum ATCC 33693]
          Length = 183

 Score = 67.0 bits (162), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 68/127 (53%), Gaps = 5/127 (3%)

Query: 62  GIVVSRIGDMITCYIPVHVSFVSEVFLEKKFL-PMLQLIATILNKFPSTVIAIQSHTDSI 120
           G+ + R G+ +   +P  + F  + +  K+ + P L  +A  L +     I I  +TD I
Sbjct: 60  GVTIRREGNNLILSMPELILFDFDKYAVKEGIKPSLATLAKALGENKDIHIKIDGYTDFI 119

Query: 121 GTLKNNLLISQERADVIKSYLIQRG-VSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIE 179
           GT   NL +S +RA  IK +LI +G + SN  IS+ G+  + P DTN T  GR  N+R+E
Sbjct: 120 GTEAYNLDLSVKRARAIKDFLISKGAIGSN--ISIEGYGEQNPADTNQTAAGRSRNRRVE 177

Query: 180 IQIFPRG 186
             I  RG
Sbjct: 178 F-IISRG 183


>gi|255020103|ref|ZP_05292174.1| outer membrane protein [Acidithiobacillus caldus ATCC 51756]
 gi|254970465|gb|EET27956.1| outer membrane protein [Acidithiobacillus caldus ATCC 51756]
          Length = 183

 Score = 67.0 bits (162), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 36/103 (34%), Positives = 58/103 (56%), Gaps = 2/103 (1%)

Query: 78  VHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVI 137
           ++  F S   L++  + +L  +A    K P  VI +  +   +GT   NL +SQ+RA+ +
Sbjct: 71  INFKFNSSKLLDRD-IKVLDEVAEFAQKHPDAVINVNGYASKVGTYAYNLKLSQQRAESV 129

Query: 138 KSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEI 180
             YL Q GV  +R + ++G +Y+ PI +N T  GR  NQR+EI
Sbjct: 130 ARYLEQHGVPRDRMV-LKGHSYEDPIASNATPQGRFENQRVEI 171


>gi|157889026|dbj|BAF80970.1| fibronectin-binding protein [Campylobacter lari]
          Length = 328

 Score = 67.0 bits (162), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 63/122 (51%), Gaps = 2/122 (1%)

Query: 62  GIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIG 121
           G ++  IG   T  +  H  F  +  +  +F   +Q +  +L + P     ++ HTD+IG
Sbjct: 206 GALLDHIGCEKTIALEGHFGF-DQTDINPEFAQKIQEVGKVLEENPQYYTILEGHTDNIG 264

Query: 122 TLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQ 181
               N  +S ERA V+   L + GV+  + I+ +G+ +  P  +NDTK GR  N+R+E +
Sbjct: 265 PKAYNQKLSLERAKVVAKELEKTGVTKEK-IATKGYGFDKPKASNDTKEGRAQNRRVEAK 323

Query: 182 IF 183
            F
Sbjct: 324 FF 325


>gi|89899024|ref|YP_521495.1| OmpA/MotB [Rhodoferax ferrireducens T118]
 gi|89343761|gb|ABD67964.1| OmpA/MotB [Rhodoferax ferrireducens T118]
          Length = 217

 Score = 67.0 bits (162), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 46/145 (31%), Positives = 72/145 (49%), Gaps = 3/145 (2%)

Query: 43  FGSSLDKAEDEFQMQLQDTGIVVSRIGD-MITCYIPVHVSF-VSEVFLEKKFLPMLQLIA 100
           + + + K + + +     TG+ V +  D  +   IP  +SF ++   ++    P+L   A
Sbjct: 70  WSTQMAKKKADMERATAGTGVDVMQTADNQLKLNIPSDISFDINRFDIKPNMRPILDQFA 129

Query: 101 TILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYK 160
             L+  P+T I I  HTDS G+   N  +S  RA   + YL+ RGV   R I + G    
Sbjct: 130 QGLSSQPNTEIRIIGHTDSTGSDSINDPLSVNRAASARDYLVARGVDGRR-IQINGRGSH 188

Query: 161 YPIDTNDTKVGRQNNQRIEIQIFPR 185
            PI  N+T+ GR  N+RIEI +  R
Sbjct: 189 EPIADNNTERGRAQNRRIEIFLAER 213


>gi|213163752|ref|ZP_03349462.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Typhi str. E00-7866]
          Length = 196

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 38/117 (32%), Positives = 65/117 (55%), Gaps = 2/117 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D  E + + +++ TG+ V+R GD I   +P +V+F  S   L+      L  +A +L +
Sbjct: 81  MDVQEAKLRDKMRGTGVSVTRSGDNIILNMPNNVTFDSSSATLKPAGANTLTGVAMVLKE 140

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYP 162
           +P T + +  +TDS G+   N+ +SQ+RAD + S LI +GV ++R I   G     P
Sbjct: 141 YPKTAVNVVGYTDSTGSHDLNMRLSQQRADSVASSLITQGVDASR-IRTSGMGPANP 196


>gi|294782096|ref|ZP_06747422.1| outer membrane porin F [Fusobacterium sp. 1_1_41FAA]
 gi|294480737|gb|EFG28512.1| outer membrane porin F [Fusobacterium sp. 1_1_41FAA]
          Length = 183

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 68/127 (53%), Gaps = 5/127 (3%)

Query: 62  GIVVSRIGDMITCYIPVHVSFVSEVFLEKKFL-PMLQLIATILNKFPSTVIAIQSHTDSI 120
           G+ + R G+ +   +P  + F  + ++ K  + P L  +A  L +     I I  +TD I
Sbjct: 60  GVTIRREGNNLILSMPELILFDFDKYVVKDGIKPSLATLAKALGENKDIHIKIDGYTDFI 119

Query: 121 GTLKNNLLISQERADVIKSYLIQRG-VSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIE 179
           GT   NL +S +RA  IK +LI +G + SN  IS+ G+  + P DTN T  GR  N+R+E
Sbjct: 120 GTEAYNLDLSVKRARAIKEFLISKGAIGSN--ISIEGYGEQNPADTNQTAAGRSRNRRVE 177

Query: 180 IQIFPRG 186
             I  RG
Sbjct: 178 F-IISRG 183


>gi|332662636|ref|YP_004445424.1| OmpA/MotB domain-containing protein [Haliscomenobacter hydrossis
           DSM 1100]
 gi|332331450|gb|AEE48551.1| OmpA/MotB domain protein [Haliscomenobacter hydrossis DSM 1100]
          Length = 550

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 54/93 (58%), Gaps = 1/93 (1%)

Query: 93  LPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFI 152
           L +L  +A I+N++P  ++ +  HTD++G    NL +S+ R     +YL  +G+S+   I
Sbjct: 459 LEVLDKVAEIMNRYPDFMLYMDGHTDNVGEEATNLRLSESRVLACSAYLQTKGISAAN-I 517

Query: 153 SVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPR 185
             +GF    P+  N T  GR+ N+R+E ++ P+
Sbjct: 518 RTQGFGESKPLADNKTAAGRRQNRRVEFRVEPK 550


>gi|74318472|ref|YP_316212.1| outer membrane protein [Thiobacillus denitrificans ATCC 25259]
 gi|74057967|gb|AAZ98407.1| outer membrane protein [Thiobacillus denitrificans ATCC 25259]
          Length = 402

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 56/102 (54%), Gaps = 2/102 (1%)

Query: 80  VSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIK 138
           VSF    V L    + +L   A  LN +    + +  HTDS  +   NL +SQ RA+ ++
Sbjct: 299 VSFEPGSVRLTPDSITILDNAAASLNAWGEVRVEVAGHTDSTHSAAFNLELSQRRAEAVR 358

Query: 139 SYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEI 180
           +YL+++GV + R ++ RG+    P+  N T  GR  N+R+E+
Sbjct: 359 AYLVKKGVRAER-LTARGYGESQPVADNRTAAGRAQNRRVEL 399


>gi|85375533|ref|YP_459595.1| outer membrane protein [Erythrobacter litoralis HTCC2594]
 gi|84788616|gb|ABC64798.1| outer membrane protein [Erythrobacter litoralis HTCC2594]
          Length = 231

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 46/148 (31%), Positives = 73/148 (49%), Gaps = 8/148 (5%)

Query: 43  FGSSLDKAEDEFQMQLQDTGIVVSRIGD--MITCYIPVHVSFVS-EVFLEKKFLPMLQLI 99
            G   D    E   Q   +G+ V  +GD   I   +P  V+F S    +   F P L  I
Sbjct: 74  IGDQFDDQIRELDEQTAGSGVDVEEVGDQDAILVRLPDGVTFASGSARINSAFYPTLNEI 133

Query: 100 ATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAY 159
           A  L ++P+++I +   TD+ G+   N  +S+ RA  +  YL+ RGV+ +R I+ +G+  
Sbjct: 134 AESLKRYPNSLIDVYGFTDTTGSDALNQQLSESRAQTVADYLVARGVARSR-IATQGYGE 192

Query: 160 KYP---IDTNDTKVGRQNNQRIEIQIFP 184
           +     I T D  V    N+R+EI+I P
Sbjct: 193 RREYLRIQTAD-NVNEPLNRRVEIKITP 219


>gi|86141593|ref|ZP_01060139.1| Outer membrane protein and related peptidoglycan-associated
           (lipo)protein [Leeuwenhoekiella blandensis MED217]
 gi|85832152|gb|EAQ50607.1| Outer membrane protein and related peptidoglycan-associated
           (lipo)protein [Leeuwenhoekiella blandensis MED217]
          Length = 224

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 38/144 (26%), Positives = 73/144 (50%), Gaps = 6/144 (4%)

Query: 44  GSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVH--VSFVSEVF-LEKKFLPMLQLIA 100
           G  +DK     + ++   G  V R+ D I      +  V F +  + +       L  ++
Sbjct: 69  GKKMDKQAQRIEEEI--PGAEVERVDDGIVVNFDENSGVYFATNKYNINSASQETLNGLS 126

Query: 101 TILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYK 160
            ++ ++P T + +  HTDS G+   N+ +S+ RA  + +YL+ +G++S RF + + +  +
Sbjct: 127 RVMQEYPQTNVLVVGHTDSTGSADYNMTLSKNRAQAVTNYLVSQGIASGRF-TTQWYGEE 185

Query: 161 YPIDTNDTKVGRQNNQRIEIQIFP 184
            P  TN+T  GR  N+R+ + I P
Sbjct: 186 QPKYTNETAEGRSKNRRVTLAIVP 209


>gi|256422985|ref|YP_003123638.1| OmpA/MotB domain protein [Chitinophaga pinensis DSM 2588]
 gi|256037893|gb|ACU61437.1| OmpA/MotB domain protein [Chitinophaga pinensis DSM 2588]
          Length = 1026

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 30/91 (32%), Positives = 55/91 (60%), Gaps = 1/91 (1%)

Query: 93   LPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFI 152
            LP L  +A +L       + +  HTD+ GT   N  +S++R++ ++ YL+ +GV + R I
Sbjct: 932  LPSLDKMAALLQAHREWQLLLSGHTDNEGTETFNQTLSEKRSEAVRQYLVTKGVDAER-I 990

Query: 153  SVRGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
            + +G+    P+ TN ++ GR  N+R+E++IF
Sbjct: 991  TTKGYGQSKPLTTNSSEAGRGKNRRVEMEIF 1021


>gi|157889011|dbj|BAF80958.1| fibronectin-binding protein [Campylobacter lari]
          Length = 328

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 36/122 (29%), Positives = 62/122 (50%), Gaps = 2/122 (1%)

Query: 62  GIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIG 121
           G ++  IG   T  +  H  F  +  +  +F   +Q +  +L + P     ++ HTDS G
Sbjct: 206 GALLDHIGCEKTIALEGHFGF-DQTSINPEFAQKIQEVGKVLEENPQYYTILEGHTDSTG 264

Query: 122 TLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQ 181
           +   N  +S ERA  +   L + GV+  + I+ +G+ +  P  +NDTK GR  N+R+E +
Sbjct: 265 SKTYNQKLSLERAKAVAKELEKSGVAKEK-IATKGYGFDKPKASNDTKEGRAQNRRVEAK 323

Query: 182 IF 183
            F
Sbjct: 324 FF 325


>gi|255624443|ref|XP_002540477.1| Inner membrane lipoprotein yiaD precursor, putative [Ricinus
           communis]
 gi|223495460|gb|EEF21906.1| Inner membrane lipoprotein yiaD precursor, putative [Ricinus
           communis]
          Length = 225

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 36/104 (34%), Positives = 59/104 (56%), Gaps = 1/104 (0%)

Query: 83  VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLI 142
           V    L  + +   Q +A +L + P +V+ ++  TDS GT  +NL +SQ RA+ +++ LI
Sbjct: 116 VDRAELSAEGMRTAQKLADVLLQEPQSVVLVEGFTDSTGTSSHNLDLSQRRAEAVRNALI 175

Query: 143 QRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRG 186
             GV  N+ I+ RG+   YP+ +N     RQ N+R+EI +   G
Sbjct: 176 GLGVPGNK-IATRGYGEAYPVASNADAGSRQLNRRVEIVLSQNG 218


>gi|152981732|ref|YP_001352854.1| OmpA family protein [Janthinobacterium sp. Marseille]
 gi|151281809|gb|ABR90219.1| OmpA family protein [Janthinobacterium sp. Marseille]
          Length = 229

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 45/140 (32%), Positives = 67/140 (47%), Gaps = 3/140 (2%)

Query: 43  FGSSLDKAEDEFQMQLQDTGIVVSRIGD-MITCYIPVHVSFVS-EVFLEKKFLPMLQLIA 100
           + S ++  +   +   Q TG+ VS+  D  +   IP  +SF +    +     P+L   A
Sbjct: 70  WSSKMENQKRAMEQATQGTGVQVSQTSDNRLKLEIPSDISFATGRSDINPSLQPILDRFA 129

Query: 101 TILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYK 160
           T L   P+  + I  HTDS G+   N  +S +RA   + YL  RGV+  R I V G    
Sbjct: 130 TGLVDNPTATVTIIGHTDSTGSDAINNPLSFDRASRTRDYLTGRGVAPQR-IYVDGRGSH 188

Query: 161 YPIDTNDTKVGRQNNQRIEI 180
            PI +N    GR  N+R+EI
Sbjct: 189 EPIASNADAAGRARNRRVEI 208


>gi|311108875|ref|YP_003981728.1| OmpA family protein 4 [Achromobacter xylosoxidans A8]
 gi|310763564|gb|ADP19013.1| OmpA family protein 4 [Achromobacter xylosoxidans A8]
          Length = 264

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 50/85 (58%), Gaps = 1/85 (1%)

Query: 95  MLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISV 154
           +L  +A ++ K  S  + I  HTDS G+   NL +SQ RAD +K+YL+ +G+   RF ++
Sbjct: 176 LLDKVADVVPKLHSDKVQIIGHTDSSGSRSTNLALSQARADAVKTYLVDKGLPPARFETL 235

Query: 155 RGFAYKYPIDTNDTKVGRQNNQRIE 179
            G     P+ TN T  GR  N+RIE
Sbjct: 236 -GAGPDQPLATNATAEGRAKNRRIE 259


>gi|323529927|ref|YP_004232079.1| OmpA/MotB domain-containing protein [Burkholderia sp. CCGE1001]
 gi|323386929|gb|ADX59019.1| OmpA/MotB domain protein [Burkholderia sp. CCGE1001]
          Length = 321

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 33/85 (38%), Positives = 49/85 (57%), Gaps = 1/85 (1%)

Query: 95  MLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISV 154
           +L  +A  + K  +  +AI  HTD+ G   +N+ +SQ RAD +K YL+ +GV   + +S 
Sbjct: 233 ILDQMAAAMQKMTTKTVAIIGHTDNSGNRASNIALSQARADAVKGYLVAKGVPPQQ-MST 291

Query: 155 RGFAYKYPIDTNDTKVGRQNNQRIE 179
            G     PI +NDT  GR  N+RIE
Sbjct: 292 TGVGPDQPIASNDTADGRARNRRIE 316


>gi|238026069|ref|YP_002910300.1| OmpA/MotB [Burkholderia glumae BGR1]
 gi|237875263|gb|ACR27596.1| OmpA/MotB [Burkholderia glumae BGR1]
          Length = 355

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 32/85 (37%), Positives = 51/85 (60%), Gaps = 1/85 (1%)

Query: 95  MLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISV 154
           +L  +A  +++  +  +AI  HTD+ G   +N+ +SQ RAD +K YL+ +G+ S + +S 
Sbjct: 267 ILDQMAAAMSRMANRSVAIIGHTDNSGNRASNIALSQARADAVKGYLVAKGIPSQQ-LST 325

Query: 155 RGFAYKYPIDTNDTKVGRQNNQRIE 179
            G     PI +NDT  GR  N+RIE
Sbjct: 326 TGVGPDQPIASNDTAEGRARNRRIE 350


>gi|237741116|ref|ZP_04571597.1| outer membrane protein [Fusobacterium sp. 4_1_13]
 gi|229430648|gb|EEO40860.1| outer membrane protein [Fusobacterium sp. 4_1_13]
          Length = 144

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 30/77 (38%), Positives = 49/77 (63%)

Query: 111 IAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKV 170
           I IQ HTDSIG+   N  +S+ RA+ +K+ L++ G++ +R + +     + PI TN+TK 
Sbjct: 57  ITIQGHTDSIGSNAYNFKLSRRRAESVKAKLLEFGLAEDRIVGIEAMGEEQPIATNETKE 116

Query: 171 GRQNNQRIEIQIFPRGN 187
           GR  N+R+E ++  R N
Sbjct: 117 GRAQNRRVEFKLVQREN 133


>gi|258405399|ref|YP_003198141.1| OmpA/MotB domain-containing protein [Desulfohalobium retbaense DSM
           5692]
 gi|257797626|gb|ACV68563.1| OmpA/MotB domain protein [Desulfohalobium retbaense DSM 5692]
          Length = 227

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 41/149 (27%), Positives = 75/149 (50%), Gaps = 8/149 (5%)

Query: 38  IVNKRFGSSLDKAEDEFQMQL-QDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPM 95
           I   R G+ +D+ E E +  L Q+    V R  D++      +V F      ++   +  
Sbjct: 70  IAGNRVGAYMDRQEQELRNALAQERAASVRREQDILRATFDSNVLFDFDSARVKPGGVSE 129

Query: 96  LQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVR 155
           L   A++ N++P T I ++ HTD+ G+ + N+ +S+ RA  +K  L+Q+GV   R +S  
Sbjct: 130 LNRAASVFNRYPQTRIRVEGHTDASGSEEYNMDLSRRRAQAVKDVLVQQGVDPRR-VSTV 188

Query: 156 GFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           G+    P+ ++        N+R+E+ I P
Sbjct: 189 GYGETQPVSSDPAA-----NRRVEVVIEP 212


>gi|19703678|ref|NP_603240.1| Outer membrane porin F [Fusobacterium nucleatum subsp. nucleatum
           ATCC 25586]
 gi|19713798|gb|AAL94539.1| Outer membrane porin F [Fusobacterium nucleatum subsp. nucleatum
           ATCC 25586]
          Length = 172

 Score = 66.6 bits (161), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 45/131 (34%), Positives = 68/131 (51%), Gaps = 5/131 (3%)

Query: 58  LQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFL-PMLQLIATILNKFPSTVIAIQSH 116
             + G+ + R G+ +   +P  + F  + +  K  + P L  +A  L +     I I  +
Sbjct: 45  FNEEGVTIRREGNNLILSMPELILFDFDKYAVKDGIKPSLSTLAKALGENKDIHIKIDGY 104

Query: 117 TDSIGTLKNNLLISQERADVIKSYLIQRG-VSSNRFISVRGFAYKYPIDTNDTKVGRQNN 175
           TD IGT   NL +S +RA  IK +LI +G + SN  IS+ G+  + P DTN T  GR  N
Sbjct: 105 TDFIGTEAYNLDLSVKRARAIKDFLISKGAIGSN--ISIEGYGEQNPADTNQTAAGRSRN 162

Query: 176 QRIEIQIFPRG 186
           +R+E  I  RG
Sbjct: 163 RRVEF-IISRG 172


>gi|262198074|ref|YP_003269283.1| hypothetical protein Hoch_4901 [Haliangium ochraceum DSM 14365]
 gi|262081421|gb|ACY17390.1| Myxococcales GC_trans_RRR domain protein [Haliangium ochraceum DSM
            14365]
          Length = 1987

 Score = 66.6 bits (161), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 33/97 (34%), Positives = 57/97 (58%), Gaps = 2/97 (2%)

Query: 88   LEKKFLPMLQLIATILNKFPSTV-IAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGV 146
            L+++  P+LQ +A +L   P    + ++ HTD+ G    N+ +SQ RA+ + ++L+Q GV
Sbjct: 1851 LQRRSNPLLQNVAQVLIAHPEIEHVRVEGHTDNRGDPTYNMNLSQSRAEAVVAFLVQEGV 1910

Query: 147  SSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
             + R  +V GF    P++ N T+ GR  N+R+E  I 
Sbjct: 1911 EAKRLAAV-GFGETQPLEDNKTRRGRAANRRVEFNIL 1946


>gi|194336698|ref|YP_002018492.1| OmpA/MotB domain protein [Pelodictyon phaeoclathratiforme BU-1]
 gi|194309175|gb|ACF43875.1| OmpA/MotB domain protein [Pelodictyon phaeoclathratiforme BU-1]
          Length = 229

 Score = 66.6 bits (161), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 41/145 (28%), Positives = 74/145 (51%), Gaps = 4/145 (2%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +DK   E    ++  G  V R+G+ I       + F      +       ++ +A ILN+
Sbjct: 79  MDKQAAEIDHDVE--GARVERVGEGIRVIFDSGILFSTGSATITSTSRYNIEKLARILNR 136

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +  T + I+ HTDSIG+   N  +S+ RAD + + L    VS  R   + G+    P+ +
Sbjct: 137 YNETSLVIEGHTDSIGSDDANQSLSERRADSVANLLEAYRVSGRRLSPI-GYGETRPVSS 195

Query: 166 NDTKVGRQNNQRIEIQIFPRGNIKK 190
           N+T+ GR+ N+R+E+ I+   ++K+
Sbjct: 196 NETEYGRKLNRRVEVLIYANDDLKR 220


>gi|319796494|ref|YP_004158134.1| ompa/motb domain protein [Variovorax paradoxus EPS]
 gi|315598957|gb|ADU40023.1| OmpA/MotB domain protein [Variovorax paradoxus EPS]
          Length = 188

 Score = 66.6 bits (161), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 36/130 (27%), Positives = 67/130 (51%), Gaps = 3/130 (2%)

Query: 53  EFQMQLQDTGIVVSRIGD-MITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTV 110
           + +   + TG+V+ +  D  +   IP  +SF      +++    +L  +A  L    +  
Sbjct: 54  DLEASTKGTGVVIEQTADNQLHVVIPNELSFDTGRANVKRNLAQVLDKVAEGLKSATAAS 113

Query: 111 IAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKV 170
           + +  HTD+ G+ + N  +S  RAD ++++L+ RGVS+   I+  G   + P+  N T  
Sbjct: 114 VRVVGHTDATGSEEGNERLSVSRADSVRNHLVGRGVSTT-AITTDGRGSREPLADNGTAA 172

Query: 171 GRQNNQRIEI 180
           GR  N+R+EI
Sbjct: 173 GRAQNRRVEI 182


>gi|92113921|ref|YP_573849.1| OmpA/MotB [Chromohalobacter salexigens DSM 3043]
 gi|91797011|gb|ABE59150.1| OmpA/MotB [Chromohalobacter salexigens DSM 3043]
          Length = 294

 Score = 66.6 bits (161), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 47/145 (32%), Positives = 78/145 (53%), Gaps = 12/145 (8%)

Query: 44  GSSLDKAED---EFQMQLQDT--GIVVSRIG---DMITCYIPVHVSFVSEVFLEKKFLPM 95
           G  LD   D   ++Q Q  DT  G  V+ +G   D++     V+  F S   L  +   +
Sbjct: 150 GCPLDSDGDGVPDYQDQCPDTPAGAEVNALGCAADLV--LKDVNFEFDS-ATLTSEAENI 206

Query: 96  LQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVR 155
           L  +A  L+   S  + ++ +TDS+G+   N  +SQ RAD +K YL+ +GV+++  I+  
Sbjct: 207 LDDVAAKLSSNESVDVRLEGYTDSVGSASYNKDLSQRRADSVKEYLVSKGVNADS-ITTY 265

Query: 156 GFAYKYPIDTNDTKVGRQNNQRIEI 180
           G+  + PI TN+T  GR  N+R+E+
Sbjct: 266 GYGEQNPIATNETAEGRAENRRVEL 290


>gi|295134914|ref|YP_003585590.1| OmpA/MotB domain-containing protein [Zunongwangia profunda SM-A87]
 gi|294982929|gb|ADF53394.1| OmpA/MotB domain-containing protein [Zunongwangia profunda SM-A87]
          Length = 618

 Score = 66.6 bits (161), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 48/82 (58%), Gaps = 1/82 (1%)

Query: 77  PVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADV 136
           P+   F +E  +  +    L  I  +L  FP   I I+SHTDS G+   NLL+SQ RA  
Sbjct: 507 PIFFEF-NEYDIRPRAAKQLDHIVYVLESFPEMKIKIESHTDSRGSDTYNLLLSQNRAKS 565

Query: 137 IKSYLIQRGVSSNRFISVRGFA 158
            K+YLI RG++ NR +S++G+ 
Sbjct: 566 TKNYLISRGIAENRIVSIKGYG 587


>gi|45600818|gb|AAS70302.1| motility protein B [Leptospira interrogans serovar Copenhageni str.
           Fiocruz L1-130]
          Length = 266

 Score = 66.6 bits (161), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 43/149 (28%), Positives = 73/149 (48%), Gaps = 5/149 (3%)

Query: 42  RFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVS-EVFLEKKFLPMLQLIA 100
           R     ++ E++   +++   I + R  D +   I   +SF S    L+K+ LP L  I 
Sbjct: 118 RLSDQANELENKLTDEIKKGQIRLKRFHDRLVINIDDKISFDSGSADLKKQILPALDKIK 177

Query: 101 TILNKFPSTVIAIQSHTDSI----GTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRG 156
            IL  +P  +I I+ HTD++        +N  +S ERA  +  Y ++  +   R  S+ G
Sbjct: 178 EILGNYPGNLIIIEGHTDNVPIRTKKFSDNWQLSGERALSVLHYFLESKILDPRNFSLAG 237

Query: 157 FAYKYPIDTNDTKVGRQNNQRIEIQIFPR 185
           +    PI +NDT   R  N+R++I + PR
Sbjct: 238 YGEFQPIVSNDTPENRALNRRVDIVVVPR 266


>gi|157889001|dbj|BAF80950.1| fibronectin-binding protein [Campylobacter lari]
          Length = 328

 Score = 66.6 bits (161), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 36/122 (29%), Positives = 63/122 (51%), Gaps = 2/122 (1%)

Query: 62  GIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIG 121
           G ++  IG   T  +  H  F  ++ +  +F   +Q +  +L + P     ++ HTDS G
Sbjct: 206 GALLDHIGCEKTIALEGHFGF-DQISINPEFAQKIQEVGKVLEENPQYYTILEGHTDSTG 264

Query: 122 TLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQ 181
           +   N  +S ERA  +   L + GV+  + I+ +G+ +  P  +NDTK GR  N+R+E +
Sbjct: 265 SKVYNQKLSLERAKAVAKELEKSGVAKEK-IATKGYGFDKPKASNDTKEGRAQNRRVEAK 323

Query: 182 IF 183
            F
Sbjct: 324 FF 325


>gi|167571440|ref|ZP_02364314.1| ompA family protein [Burkholderia oklahomensis C6786]
          Length = 308

 Score = 66.6 bits (161), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 33/85 (38%), Positives = 49/85 (57%), Gaps = 1/85 (1%)

Query: 95  MLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISV 154
           +L  +A  L K  S  + I  HTD+ G   +N+ +SQ RAD +K YL+ +G++S +  + 
Sbjct: 220 ILDQMAGALAKMSSRTVEIIGHTDNSGNRASNIALSQARADAVKGYLVAKGIASQQLTTT 279

Query: 155 RGFAYKYPIDTNDTKVGRQNNQRIE 179
            G     PI +NDT  GR  N+RIE
Sbjct: 280 -GVGPDQPIASNDTNDGRARNRRIE 303


>gi|262376393|ref|ZP_06069622.1| conserved hypothetical protein [Acinetobacter lwoffii SH145]
 gi|262308532|gb|EEY89666.1| conserved hypothetical protein [Acinetobacter lwoffii SH145]
          Length = 255

 Score = 66.6 bits (161), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 54/91 (59%), Gaps = 1/91 (1%)

Query: 93  LPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFI 152
           + +L  + + LNK     I I  HTDS G +  NL++SQ+RA+ +KSYLI + V ++  +
Sbjct: 166 IQILDEMVSALNKVSGKKIRIIGHTDSSGDINKNLMLSQQRAEAVKSYLIAKNVPTH-LL 224

Query: 153 SVRGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
           S +G     P+  N T  GR+ N+RIE ++ 
Sbjct: 225 STKGSGSSKPVADNATADGRKRNRRIEFEVL 255


>gi|149374667|ref|ZP_01892441.1| outer membrane protein; OmpA family [Marinobacter algicola DG893]
 gi|149361370|gb|EDM49820.1| outer membrane protein; OmpA family [Marinobacter algicola DG893]
          Length = 271

 Score = 66.6 bits (161), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 43/166 (25%), Positives = 81/166 (48%), Gaps = 11/166 (6%)

Query: 25  KKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVS 84
           +K++ L    D     +R    L    +  Q +  D G+V++ +GD++       +    
Sbjct: 112 RKELELEMRADEAAQARREAKELRLQMEAMQAEQTDRGMVLT-LGDVLFDLDKAELKSSG 170

Query: 85  EVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQR 144
           E  + +        +A  + ++ +  + ++ +TDS G    N  +S+ RA  +   LI+ 
Sbjct: 171 EATVRR--------LAEFMAEYENRRVRVEGYTDSTGEASYNQGLSERRAQAVSDTLIEM 222

Query: 145 GVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIF-PRGNIK 189
           G+S  R +  +GF  ++P+ +NDT  GRQ N+R+EI I    GNI+
Sbjct: 223 GISRTR-VETKGFGEQFPVASNDTSGGRQQNRRVEIVISDEEGNIE 267


>gi|146329067|ref|YP_001209253.1| OmpA family protein [Dichelobacter nodosus VCS1703A]
 gi|146232537|gb|ABQ13515.1| OmpA family protein [Dichelobacter nodosus VCS1703A]
          Length = 298

 Score = 66.6 bits (161), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 33/98 (33%), Positives = 61/98 (62%), Gaps = 3/98 (3%)

Query: 87  FLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQR-G 145
           F+++++   ++ +A  L ++P+T + ++ HTDS  + + N+ +SQ R + ++  LIQ  G
Sbjct: 201 FVKQQYYSEIETVAGYLRQYPNTTVTLEGHTDSNASEQYNINLSQRRVNAVRDVLIQHYG 260

Query: 146 VSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
           +S  R IS  G+    PI +N+T  GRQ N+R+ I +F
Sbjct: 261 ISPAR-ISAVGYGESQPIASNNTAAGRQQNRRV-IAVF 296


>gi|313674928|ref|YP_004052924.1| ompa/motb domain protein [Marivirga tractuosa DSM 4126]
 gi|312941626|gb|ADR20816.1| OmpA/MotB domain protein [Marivirga tractuosa DSM 4126]
          Length = 679

 Score = 66.6 bits (161), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 60/108 (55%), Gaps = 2/108 (1%)

Query: 78  VHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVI 137
           ++ +F      E  F P L  +  ++++ P   I I  HTDS G+   NL++S+ RA  +
Sbjct: 574 IYFNFDKTTLKEASF-PELDRLTDLMSQNPGIKIEIIGHTDSKGSDDYNLILSEGRAQAV 632

Query: 138 KSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPR 185
             YL+++G++ NR ++ +G     PI +N+T  GR  N+R+E  I  +
Sbjct: 633 MEYLLEKGIAQNR-MTFKGLGETAPISSNNTDEGRAENRRVEFTIVAK 679


>gi|255264641|ref|ZP_05343983.1| inner membrane lipoprotein YiaD [Thalassiobium sp. R2A62]
 gi|255106976|gb|EET49650.1| inner membrane lipoprotein YiaD [Thalassiobium sp. R2A62]
          Length = 223

 Score = 66.6 bits (161), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 44/143 (30%), Positives = 69/143 (48%), Gaps = 3/143 (2%)

Query: 43  FGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEV-FLEKKFLPMLQLIAT 101
            G  LD+ E   +  L    + ++  G  +   +P  + F ++   L       L  +A 
Sbjct: 82  IGQRLDQQEVALRQSLGGN-VGITNTGSELIVSLPQDILFATDSSTLTGGLQSDLNALAN 140

Query: 102 ILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKY 161
            LN++P+T + +  HTD++G    N  +S  RA  + + L+  GVSS R I+  G     
Sbjct: 141 NLNQYPNTTVNVIGHTDNVGDAGYNDGLSTRRATAVANVLLNAGVSSGR-INAFGRGEAQ 199

Query: 162 PIDTNDTKVGRQNNQRIEIQIFP 184
           PI TN T  GR  N+R+EI I P
Sbjct: 200 PIATNLTDEGRAQNRRVEIVITP 222


>gi|332668302|ref|YP_004451090.1| OmpA/MotB domain-containing protein [Haliscomenobacter hydrossis DSM
            1100]
 gi|332337116|gb|AEE54217.1| OmpA/MotB domain protein [Haliscomenobacter hydrossis DSM 1100]
          Length = 1170

 Score = 66.6 bits (161), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 31/100 (31%), Positives = 55/100 (55%), Gaps = 1/100 (1%)

Query: 83   VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLI 142
            V  + ++  F+P+L  +   L   P  ++ +  HT+ +   +  + +S  RA  +  YLI
Sbjct: 1067 VDSINIKSSFIPILDEVFEFLTDNPGIIVEVGGHTNGLCQDEFCIRLSTARAKSVAEYLI 1126

Query: 143  QRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
            ++G+ + R +  +G+    PI TN T  GRQ NQR+EI+I
Sbjct: 1127 KKGIDAKR-VQFKGYGRSVPIATNSTPEGRQKNQRVEIKI 1165


>gi|326799819|ref|YP_004317638.1| OmpA/MotB domain protein [Sphingobacterium sp. 21]
 gi|326550583|gb|ADZ78968.1| OmpA/MotB domain protein [Sphingobacterium sp. 21]
          Length = 434

 Score = 66.6 bits (161), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 48/73 (65%), Gaps = 1/73 (1%)

Query: 111 IAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKV 170
           + +  HTD+ G++K N+ +S+ERA+ +K+YL+ +G + +R I   G+    PI TN T  
Sbjct: 363 LKLAGHTDNTGSMKLNMRLSKERAEAVKAYLVSKGANPSR-IEATGYGPTQPIATNATAE 421

Query: 171 GRQNNQRIEIQIF 183
           GRQ N+R+E  ++
Sbjct: 422 GRQANRRVEFTLY 434


>gi|302878485|ref|YP_003847049.1| OmpA/MotB domain-containing protein [Gallionella capsiferriformans
           ES-2]
 gi|302581274|gb|ADL55285.1| OmpA/MotB domain protein [Gallionella capsiferriformans ES-2]
          Length = 347

 Score = 66.6 bits (161), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 34/81 (41%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 105 KFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPID 164
           K+  + +AI  HTDS G+ K N  +S  RA+ +K+YL+++GVS+ R I+ +G A   P+ 
Sbjct: 259 KYKESNLAISGHTDSRGSEKLNQKLSLSRAESVKAYLVKKGVSAAR-ITTKGEASTRPVA 317

Query: 165 TNDTKVGRQNNQRIEIQIFPR 185
            N TK GR  N+R+EI    R
Sbjct: 318 DNKTKAGRAQNRRVEINSVVR 338


>gi|325954634|ref|YP_004238294.1| OmpA/MotB domain protein [Weeksella virosa DSM 16922]
 gi|323437252|gb|ADX67716.1| OmpA/MotB domain protein [Weeksella virosa DSM 16922]
          Length = 234

 Score = 66.2 bits (160), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 45/144 (31%), Positives = 73/144 (50%), Gaps = 8/144 (5%)

Query: 43  FGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYI----PVHVSFVSEVFLEKKFLPMLQL 98
            G  +DK  ++ +  L   G  V R  + I   +     V   + SE    K    + +L
Sbjct: 79  IGQHMDKQAEKIEQVL--PGAEVVRTDEGINLILNENSSVTFDYNSENLTSKAKNSLDKL 136

Query: 99  IATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFA 158
           I  +  ++P T + I  HTD++G+   NL +S++RA  + +YL+ +G+SS+R  S +G  
Sbjct: 137 I-QVFKEYPDTNLLIVGHTDNVGSQNFNLPLSEKRAKSVVNYLVSKGISSSRLTS-KGVG 194

Query: 159 YKYPIDTNDTKVGRQNNQRIEIQI 182
              PI  N T  GR  N+R+EI I
Sbjct: 195 LSEPIADNSTAAGRAQNRRVEIAI 218


>gi|256819127|ref|YP_003140406.1| OmpA/MotB domain-containing protein [Capnocytophaga ochracea DSM
           7271]
 gi|256580710|gb|ACU91845.1| OmpA/MotB domain protein [Capnocytophaga ochracea DSM 7271]
          Length = 230

 Score = 66.2 bits (160), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 39/151 (25%), Positives = 76/151 (50%), Gaps = 7/151 (4%)

Query: 43  FGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV----SEVFLEKKFLPMLQL 98
            G+ +DK   + + ++   G  V R+ D I      +   V    ++  +  K    L  
Sbjct: 73  IGNQMDKQAKKIEEEI--PGADVKRVDDGIVVTFDENNGGVYFDTNKYNINNKSRQTLDK 130

Query: 99  IATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFA 158
           ++ IL ++P T + +  HTD++G  + NL +SQ RA  + +Y   +G+  +RF + + + 
Sbjct: 131 LSAILKEYPDTNVIVAGHTDNVGKDEYNLGLSQRRAQAVTNYFKSKGLVGSRF-TTKWYG 189

Query: 159 YKYPIDTNDTKVGRQNNQRIEIQIFPRGNIK 189
            + P+ +N+T  GR  N+R+ + I P   +K
Sbjct: 190 ERNPVASNETADGRAKNRRVNVVIVPNEKMK 220


>gi|157889031|dbj|BAF80974.1| fibronectin-binding protein [Campylobacter lari]
 gi|157889036|dbj|BAF80978.1| fibronectin-binding protein [Campylobacter lari]
          Length = 328

 Score = 66.2 bits (160), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 36/122 (29%), Positives = 63/122 (51%), Gaps = 2/122 (1%)

Query: 62  GIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIG 121
           G ++  IG   T  +  H  F  +  +  +F   +Q +  IL + P     ++ HTDS G
Sbjct: 206 GALLDHIGCEKTIALEGHFGF-DQTNINPEFAQKIQEVGKILEENPQYYTILEGHTDSTG 264

Query: 122 TLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQ 181
               N  +S ERA+ +   L + GV+  + ++ +G+ ++ P  +NDTK GR  N+R+E +
Sbjct: 265 PKAYNQKLSLERANAVAKELEKTGVAKEKIVT-KGYGFEKPKASNDTKEGRAQNRRVEAK 323

Query: 182 IF 183
            F
Sbjct: 324 FF 325


>gi|167564292|ref|ZP_02357208.1| ompA family protein [Burkholderia oklahomensis EO147]
          Length = 243

 Score = 66.2 bits (160), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 33/85 (38%), Positives = 49/85 (57%), Gaps = 1/85 (1%)

Query: 95  MLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISV 154
           +L  +A  L K  S  + I  HTD+ G   +N+ +SQ RAD +K YL+ +G++S +  + 
Sbjct: 155 ILDQMAGALAKMSSRTVEIIGHTDNSGNRASNIALSQARADAVKGYLVAKGIASQQLTTT 214

Query: 155 RGFAYKYPIDTNDTKVGRQNNQRIE 179
            G     PI +NDT  GR  N+RIE
Sbjct: 215 -GVGPDQPIASNDTNDGRARNRRIE 238


>gi|317402977|gb|EFV83516.1| outer membrane protein A [Achromobacter xylosoxidans C54]
          Length = 197

 Score = 66.2 bits (160), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 48/74 (64%), Gaps = 2/74 (2%)

Query: 109 TVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDT 168
           T+IA+  HTDSIGT   N  +S+ RA  +K+YL+ +G+  NR I   G   K PI +N T
Sbjct: 121 TIIAV-GHTDSIGTDAYNQKLSERRAASVKAYLVSKGIDPNR-IYTEGKGEKNPIASNKT 178

Query: 169 KVGRQNNQRIEIQI 182
           K GR  N+R+EI+I
Sbjct: 179 KEGRAQNRRVEIEI 192


>gi|186476941|ref|YP_001858411.1| OmpA/MotB domain-containing protein [Burkholderia phymatum STM815]
 gi|184193400|gb|ACC71365.1| OmpA/MotB domain protein [Burkholderia phymatum STM815]
          Length = 217

 Score = 66.2 bits (160), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 37/106 (34%), Positives = 54/106 (50%), Gaps = 2/106 (1%)

Query: 76  IPVHVSFVSEVF-LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERA 134
           IP  V+F +  + ++  F P+L  +A  LN+ P  V  +  HTDS G    N  +S  RA
Sbjct: 103 IPSSVTFDTNSYAIKPSFAPVLSQVAQTLNQNPEVVAQVVGHTDSTGQPAYNQTLSVNRA 162

Query: 135 DVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEI 180
             +   L   GV+  R +S  G     PI  N+T+ GR  N+R+EI
Sbjct: 163 QSVAQQLATDGVAPQR-LSATGMGANQPIADNNTETGRAQNRRVEI 207


>gi|292490769|ref|YP_003526208.1| OmpA/MotB domain protein [Nitrosococcus halophilus Nc4]
 gi|291579364|gb|ADE13821.1| OmpA/MotB domain protein [Nitrosococcus halophilus Nc4]
          Length = 301

 Score = 66.2 bits (160), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 45/133 (33%), Positives = 65/133 (48%), Gaps = 14/133 (10%)

Query: 57  QLQDT--GIVVSRIGDMITCYIPV------HVSFVSEVFLEKKFLPMLQLIATILNKFPS 108
           Q  DT  G+ V  +G    C  PV      H +F S   L  +   +L   A  L   P 
Sbjct: 172 QCPDTPAGVEVDEVG----CPEPVVLEGGVHFAFDS-AKLTPEARDILDETADSLRTHPD 226

Query: 109 TVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDT 168
             + I+ HTDS+G    N  +SQ RA+   +YL+ +GV  +R  +V G+    PI +N T
Sbjct: 227 LEVTIEGHTDSVGNADYNKRLSQLRAEAAMNYLVSQGVDQSRLEAV-GYGEAQPIASNKT 285

Query: 169 KVGRQNNQRIEIQ 181
           K GR  N+R+E+ 
Sbjct: 286 KEGRAQNRRVELH 298


>gi|157889046|dbj|BAF80986.1| fibronectin-binding protein [Campylobacter lari]
          Length = 328

 Score = 66.2 bits (160), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 36/122 (29%), Positives = 63/122 (51%), Gaps = 2/122 (1%)

Query: 62  GIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIG 121
           G ++  IG   T  +  H  F  +  +  +F   +Q +  IL + P     ++ HTDS G
Sbjct: 206 GALLDHIGCEKTIALEGHFGF-DQTNINPEFAQKIQEVGKILEENPQYYTILEGHTDSTG 264

Query: 122 TLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQ 181
               N  +S ERA+ +   L + GV+  + ++ +G+ ++ P  +NDTK GR  N+R+E +
Sbjct: 265 PKAYNQKLSLERANAVAKELEKTGVAKEKIVT-KGYGFEKPKASNDTKEGRAQNRRVEAK 323

Query: 182 IF 183
            F
Sbjct: 324 FF 325


>gi|189499949|ref|YP_001959419.1| OmpA/MotB domain-containing protein [Chlorobium phaeobacteroides
           BS1]
 gi|189495390|gb|ACE03938.1| OmpA/MotB domain protein [Chlorobium phaeobacteroides BS1]
          Length = 229

 Score = 66.2 bits (160), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 35/93 (37%), Positives = 57/93 (61%), Gaps = 1/93 (1%)

Query: 96  LQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVR 155
           +Q +A ILNK+  T I ++ HTDS G+   N  +S++RA+ + S L    VS +R IS  
Sbjct: 127 IQKLANILNKYSDTDIVVEGHTDSQGSETYNQQLSEKRAESVSSLLRAYNVSKSR-ISTI 185

Query: 156 GFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGNI 188
           G+    P+ +N+T  GR+ N+R+E+ I+   N+
Sbjct: 186 GYGETRPVASNETASGRKLNRRVEVLIYANDNL 218


>gi|227538391|ref|ZP_03968440.1| OmpA/MotB family protein [Sphingobacterium spiritivorum ATCC 33300]
 gi|227241773|gb|EEI91788.1| OmpA/MotB family protein [Sphingobacterium spiritivorum ATCC 33300]
          Length = 440

 Score = 66.2 bits (160), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 32/90 (35%), Positives = 56/90 (62%), Gaps = 2/90 (2%)

Query: 94  PMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFIS 153
           P L  +A++L +  +  + +  HTD+ G++K NL +S+ERA+ +K+YL  +G + +R I 
Sbjct: 353 PSLDRVASLLIE-KNFSLKLAGHTDNTGSMKTNLRLSKERAEAVKAYLSGKGANPSR-IE 410

Query: 154 VRGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
             G+    PI +N T  GRQ N+R+E  ++
Sbjct: 411 ATGYGPNQPIASNATAEGRQQNRRVEFTLY 440


>gi|300770792|ref|ZP_07080670.1| OmpA/MotB family protein [Sphingobacterium spiritivorum ATCC 33861]
 gi|300762349|gb|EFK59167.1| OmpA/MotB family protein [Sphingobacterium spiritivorum ATCC 33861]
          Length = 438

 Score = 66.2 bits (160), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 32/90 (35%), Positives = 56/90 (62%), Gaps = 2/90 (2%)

Query: 94  PMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFIS 153
           P L  +A++L +  +  + +  HTD+ G++K NL +S+ERA+ +K+YL  +G + +R I 
Sbjct: 351 PSLDRVASLLIE-KNFSLKLAGHTDNTGSMKTNLRLSKERAEAVKAYLSGKGANPSR-IE 408

Query: 154 VRGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
             G+    PI +N T  GRQ N+R+E  ++
Sbjct: 409 ATGYGPNQPIASNATAEGRQQNRRVEFTLY 438


>gi|300770791|ref|ZP_07080669.1| OmpA/MotB family protein [Sphingobacterium spiritivorum ATCC 33861]
 gi|300762348|gb|EFK59166.1| OmpA/MotB family protein [Sphingobacterium spiritivorum ATCC 33861]
          Length = 440

 Score = 66.2 bits (160), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 32/90 (35%), Positives = 56/90 (62%), Gaps = 2/90 (2%)

Query: 94  PMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFIS 153
           P L  +A++L +  +  + +  HTD+ G++K NL +S+ERA+ +K+YL  +G + +R I 
Sbjct: 353 PSLDRVASLLIE-KNFSLKLAGHTDNTGSMKTNLRLSKERAEAVKAYLSGKGANPSR-IE 410

Query: 154 VRGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
             G+    PI +N T  GRQ N+R+E  ++
Sbjct: 411 ATGYGPNQPIASNATAEGRQQNRRVEFTLY 440


>gi|315918088|ref|ZP_07914328.1| outer membrane porin F [Fusobacterium gonidiaformans ATCC 25563]
 gi|317058194|ref|ZP_07922679.1| outer membrane porin F [Fusobacterium sp. 3_1_5R]
 gi|313683870|gb|EFS20705.1| outer membrane porin F [Fusobacterium sp. 3_1_5R]
 gi|313691963|gb|EFS28798.1| outer membrane porin F [Fusobacterium gonidiaformans ATCC 25563]
          Length = 189

 Score = 66.2 bits (160), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 39/119 (32%), Positives = 64/119 (53%), Gaps = 2/119 (1%)

Query: 62  GIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSI 120
           G+ + R G+ +   +P  + F  ++  ++    P L+ +A  L       I I  +TD I
Sbjct: 66  GVTIRREGNNLILSMPELILFDFNKYEVKNGIKPSLRTLANALGANADIKIKIDGYTDFI 125

Query: 121 GTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIE 179
           G+   NL +S  RA  IKSYL+ +G   N  IS+ G+  + P+ +NDT+ GR  N+R+E
Sbjct: 126 GSEGYNLELSVNRAKAIKSYLVAQGAIENN-ISIEGYGKQNPVASNDTESGRARNRRVE 183


>gi|157889051|dbj|BAF80990.1| fibronectin-binding protein [Campylobacter lari]
          Length = 328

 Score = 66.2 bits (160), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 36/122 (29%), Positives = 63/122 (51%), Gaps = 2/122 (1%)

Query: 62  GIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIG 121
           G ++  IG   T  +  H  F  +  +  +F   +Q +  IL + P     ++ HTDS G
Sbjct: 206 GALLDHIGCEKTIALEGHFGF-DQTNINPEFAQKIQEVGKILEENPQYYTILEGHTDSTG 264

Query: 122 TLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQ 181
               N  +S ERA+ +   L + GV+  + ++ +G+ ++ P  +NDTK GR  N+R+E +
Sbjct: 265 PKAYNQKLSLERANAVAKELEKTGVAKEKIVT-KGYGFEKPKASNDTKEGRAQNRRVEAK 323

Query: 182 IF 183
            F
Sbjct: 324 FF 325


>gi|157889041|dbj|BAF80982.1| fibronectin-binding protein [Campylobacter lari]
          Length = 328

 Score = 66.2 bits (160), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 36/122 (29%), Positives = 63/122 (51%), Gaps = 2/122 (1%)

Query: 62  GIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIG 121
           G ++  IG   T  +  H  F  +  +  +F   +Q +  IL + P     ++ HTDS G
Sbjct: 206 GALLDHIGCEKTIALEGHFGF-DQTNINPEFAQKIQEVGKILEENPQYYTILEGHTDSTG 264

Query: 122 TLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQ 181
               N  +S ERA+ +   L + GV+  + ++ +G+ ++ P  +NDTK GR  N+R+E +
Sbjct: 265 PKAYNQKLSLERANAVAKELEKTGVAKEKIVT-KGYGFEKPKASNDTKEGRAQNRRVEAK 323

Query: 182 IF 183
            F
Sbjct: 324 FF 325


>gi|289208562|ref|YP_003460628.1| OmpA/MotB domain protein [Thioalkalivibrio sp. K90mix]
 gi|288944193|gb|ADC71892.1| OmpA/MotB domain protein [Thioalkalivibrio sp. K90mix]
          Length = 238

 Score = 66.2 bits (160), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 39/144 (27%), Positives = 70/144 (48%), Gaps = 2/144 (1%)

Query: 42  RFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIA 100
           R G  +D      + +L    + + R G +IT   P   +F  +   +    +  L  + 
Sbjct: 92  RVGFYMDVLTARLRQKLAGHDVEMEREGRIITLIFPGAKAFETNSAEIHPDMVSTLDALG 151

Query: 101 TILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYK 160
            +L ++ ++++ I  HTDS G    N  +S++RA  +  +L   GV   R I++ G+   
Sbjct: 152 QVLEEYDASLVTIAGHTDSAGARGYNQHLSEQRALSVGRHLHDNGVGEARIIAI-GYGPD 210

Query: 161 YPIDTNDTKVGRQNNQRIEIQIFP 184
            PI  NDT  GR  N+R+E+++ P
Sbjct: 211 RPIADNDTPHGRALNRRVELRVEP 234


>gi|307727734|ref|YP_003910947.1| OmpA/MotB domain-containing protein [Burkholderia sp. CCGE1003]
 gi|307588259|gb|ADN61656.1| OmpA/MotB domain protein [Burkholderia sp. CCGE1003]
          Length = 321

 Score = 66.2 bits (160), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 32/85 (37%), Positives = 48/85 (56%), Gaps = 1/85 (1%)

Query: 95  MLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISV 154
           +L  +A  + K  +  +AI  HTD+ G   +N+ +SQ RAD +K YL+ +G+   +  + 
Sbjct: 233 ILDQMAAAMQKMTTRTVAIIGHTDNSGNRTSNIALSQARADAVKGYLVAKGIPPQQMTTT 292

Query: 155 RGFAYKYPIDTNDTKVGRQNNQRIE 179
            G     PI TNDT  GR  N+RIE
Sbjct: 293 -GVGPDQPIATNDTADGRARNRRIE 316


>gi|304312291|ref|YP_003811889.1| hypothetical protein HDN1F_26630 [gamma proteobacterium HdN1]
 gi|301798024|emb|CBL46246.1| Hypothetical protein HDN1F_26630 [gamma proteobacterium HdN1]
          Length = 224

 Score = 66.2 bits (160), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 60/99 (60%), Gaps = 1/99 (1%)

Query: 84  SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQ 143
           S+  + +K +P ++ +A +LN +P + I+I+ HTD++G    N  +S+ RA+ + + L +
Sbjct: 110 SQSNVSRKGMPFIRKVADVLNAYPRSSISIEGHTDNMGEANYNQKLSEARANSVMNALNK 169

Query: 144 RGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
            GV S+R +S  GF    P+  N +   R+ N+R+EI +
Sbjct: 170 AGVESSR-MSATGFGMSKPLVENTSSSNRRTNRRVEIVV 207


>gi|262198644|ref|YP_003269853.1| OmpA/MotB domain protein [Haliangium ochraceum DSM 14365]
 gi|262081991|gb|ACY17960.1| OmpA/MotB domain protein [Haliangium ochraceum DSM 14365]
          Length = 637

 Score = 66.2 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 32/99 (32%), Positives = 60/99 (60%), Gaps = 2/99 (2%)

Query: 88  LEKKFLPMLQLIA-TILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGV 146
           ++++  P+L  +A TI+      +I +Q HTD+ G+   NL +S ERA  +++YL+++GV
Sbjct: 537 IKRESFPILDAVAATIMGNPDIRLIEVQGHTDARGSASYNLRLSDERAKSVRAYLLKKGV 596

Query: 147 SSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPR 185
             +R +  +G+    PID+++T+     N+R+E  I  R
Sbjct: 597 EPDR-VDAKGYGETKPIDSSNTEKAHATNRRVEFLIMNR 634


>gi|319943060|ref|ZP_08017343.1| lipoprotein [Lautropia mirabilis ATCC 51599]
 gi|319743602|gb|EFV96006.1| lipoprotein [Lautropia mirabilis ATCC 51599]
          Length = 319

 Score = 66.2 bits (160), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 64/122 (52%), Gaps = 3/122 (2%)

Query: 61  TGIVVSRIGD-MITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTD 118
           TG+ V++  + ++   IP  +SF V+   +   F P+L   A  L   P+T + I  HTD
Sbjct: 115 TGVQVTQTRENLLQLDIPSDISFRVNSAAILPNFQPILDRFAQTLVANPATTVQIIGHTD 174

Query: 119 SIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRI 178
           S GT   N  +S  RA   + YL+ RGV  +R + + G   + PI  N T  GR  N+R+
Sbjct: 175 STGTDAINNPLSVNRAASARDYLVARGVQVSRIM-IDGRGSRDPIADNSTPAGRAQNRRV 233

Query: 179 EI 180
           EI
Sbjct: 234 EI 235


>gi|167625831|ref|YP_001676125.1| OmpA/MotB domain-containing protein [Shewanella halifaxensis
           HAW-EB4]
 gi|167355853|gb|ABZ78466.1| OmpA/MotB domain protein [Shewanella halifaxensis HAW-EB4]
          Length = 201

 Score = 66.2 bits (160), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 58/93 (62%), Gaps = 2/93 (2%)

Query: 87  FLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQR-G 145
           +++ ++ P +++IAT +  +P+T   I+ H    G+ ++N ++SQ RA+ + S L +R G
Sbjct: 85  YIDPQYYPQVEVIATFMRDYPNTQAVIEGHCSKTGSHEHNQVLSQNRANAVSSLLAERFG 144

Query: 146 VSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRI 178
           + S+R  +V G+++  P+D   T+   + N+R+
Sbjct: 145 IDSDRLSAV-GYSFDRPVDPTHTRAAHKVNRRV 176


>gi|294828058|ref|NP_712396.2| endoflagellar motor protein B [Leptospira interrogans serovar Lai
           str. 56601]
 gi|304570492|ref|YP_001665.2| motility protein B [Leptospira interrogans serovar Copenhageni str.
           Fiocruz L1-130]
 gi|293385905|gb|AAN49414.2| endoflagellar motor protein B [Leptospira interrogans serovar Lai
           str. 56601]
          Length = 336

 Score = 66.2 bits (160), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 43/149 (28%), Positives = 73/149 (48%), Gaps = 5/149 (3%)

Query: 42  RFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVS-EVFLEKKFLPMLQLIA 100
           R     ++ E++   +++   I + R  D +   I   +SF S    L+K+ LP L  I 
Sbjct: 188 RLSDQANELENKLTDEIKKGQIRLKRFHDRLVINIDDKISFDSGSADLKKQILPALDKIK 247

Query: 101 TILNKFPSTVIAIQSHTDSI----GTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRG 156
            IL  +P  +I I+ HTD++        +N  +S ERA  +  Y ++  +   R  S+ G
Sbjct: 248 EILGNYPGNLIIIEGHTDNVPIRTKKFSDNWQLSGERALSVLHYFLESKILDPRNFSLAG 307

Query: 157 FAYKYPIDTNDTKVGRQNNQRIEIQIFPR 185
           +    PI +NDT   R  N+R++I + PR
Sbjct: 308 YGEFQPIVSNDTPENRALNRRVDIVVVPR 336


>gi|310819615|ref|YP_003951973.1| OmpA domain-containing protein [Stigmatella aurantiaca DW4/3-1]
 gi|309392687|gb|ADO70146.1| OmpA domain protein [Stigmatella aurantiaca DW4/3-1]
          Length = 593

 Score = 66.2 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 34/92 (36%), Positives = 54/92 (58%), Gaps = 2/92 (2%)

Query: 95  MLQLIATILNKFPS-TVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFIS 153
           +L  +A I+ + P    I I+ HTD  G+   N  +SQ+RA+ ++ YL+ RGV   R + 
Sbjct: 498 LLDQVARIIIEHPELEKIWIEGHTDERGSQDYNRELSQKRAEEVRDYLVTRGVPIGRLVP 557

Query: 154 VRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPR 185
            +G+  +YP+ +NDT  GR  N+R+E    PR
Sbjct: 558 -KGYGRQYPVASNDTVEGRAANRRVEFLTTPR 588


>gi|115378003|ref|ZP_01465184.1| OmpA/MotB [Stigmatella aurantiaca DW4/3-1]
 gi|115364980|gb|EAU64034.1| OmpA/MotB [Stigmatella aurantiaca DW4/3-1]
          Length = 636

 Score = 66.2 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 34/92 (36%), Positives = 54/92 (58%), Gaps = 2/92 (2%)

Query: 95  MLQLIATILNKFPS-TVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFIS 153
           +L  +A I+ + P    I I+ HTD  G+   N  +SQ+RA+ ++ YL+ RGV   R + 
Sbjct: 541 LLDQVARIIIEHPELEKIWIEGHTDERGSQDYNRELSQKRAEEVRDYLVTRGVPIGRLVP 600

Query: 154 VRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPR 185
            +G+  +YP+ +NDT  GR  N+R+E    PR
Sbjct: 601 -KGYGRQYPVASNDTVEGRAANRRVEFLTTPR 631


>gi|146276251|ref|YP_001166410.1| OmpA/MotB domain-containing protein [Rhodobacter sphaeroides ATCC
           17025]
 gi|145554492|gb|ABP69105.1| OmpA/MotB domain protein [Rhodobacter sphaeroides ATCC 17025]
          Length = 228

 Score = 66.2 bits (160), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 43/148 (29%), Positives = 72/148 (48%), Gaps = 2/148 (1%)

Query: 38  IVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSE-VFLEKKFLPML 96
           I+    GS+LD+   + +  + ++ + V+  G  +   +P  + F ++   L       L
Sbjct: 80  ILGGAVGSALDRQAADLRNSIGNSQVSVTNTGSELVVTMPQDILFATDSANLRPDLQRDL 139

Query: 97  QLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRG 156
             +A  L ++P++ I +  HTDS G+   N  +S  RA  +   LI  GV S R  S+ G
Sbjct: 140 AAVAQNLLRYPNSTIMVVGHTDSTGSAAYNQDLSMRRAQSVAGVLIGNGVPSYRVASL-G 198

Query: 157 FAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
                PI +N T  GR  N+R++I I P
Sbjct: 199 RGEDQPIASNLTPEGRAQNRRVDIIIRP 226


>gi|84503479|ref|ZP_01001534.1| OmpA family protein [Oceanicola batsensis HTCC2597]
 gi|84388157|gb|EAQ01110.1| OmpA family protein [Oceanicola batsensis HTCC2597]
          Length = 226

 Score = 66.2 bits (160), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 43/139 (30%), Positives = 67/139 (48%), Gaps = 3/139 (2%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSE-VFLEKKFLPMLQLIATILNK 105
           LD+ E   + +L  + + +   GD +   +P  + F ++   L       L  +A  LN+
Sbjct: 88  LDRQEAALRSEL-GSNVQIVNTGDRLVVTMPQDILFATDSASLRPDLTTDLVTVARSLNE 146

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +P T + +  HTD+ G    N  +S  RA  + + LI  GVS+ R  S  G     P  T
Sbjct: 147 YPRTTVQVVGHTDNTGDAAYNQQLSARRASAVANVLINSGVSAGRIQSF-GRGEDQPRAT 205

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T  GRQ N+R++I I P
Sbjct: 206 NLTPEGRQLNRRVDIVILP 224


>gi|296272285|ref|YP_003654916.1| OmpA/MotB domain-containing protein [Arcobacter nitrofigilis DSM
           7299]
 gi|296096460|gb|ADG92410.1| OmpA/MotB domain protein [Arcobacter nitrofigilis DSM 7299]
          Length = 343

 Score = 66.2 bits (160), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 52/160 (32%), Positives = 76/160 (47%), Gaps = 10/160 (6%)

Query: 23  REKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF 82
            E KKV   K  D+D  N     SLD+  D  +      G  V ++G +    + VH   
Sbjct: 192 EEPKKVEEPKVLDSD--NDGVIDSLDQCPDTMR------GANVDKVGCIKMLDLEVHFPI 243

Query: 83  VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLI 142
            S + +++K+   ++  A  LNK P     I+ HTD  GT K NL +S+ RA+     L 
Sbjct: 244 DSSI-IDEKYKHRIKEFAEFLNKHPKLKATIEGHTDYTGTKKYNLWLSKRRANSAFEALK 302

Query: 143 QRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           +  V   R  ++ G+    PI TN TK GR  N+RIE  +
Sbjct: 303 KYDVDPARLKTI-GYGETRPIATNKTKEGRAKNRRIEATV 341


>gi|157889021|dbj|BAF80966.1| fibronectin-binding protein [Campylobacter lari]
          Length = 328

 Score = 66.2 bits (160), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 36/122 (29%), Positives = 63/122 (51%), Gaps = 2/122 (1%)

Query: 62  GIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIG 121
           G ++  IG   T  +  H  F  +  +  +F   +Q +  IL + P     ++ HTDS G
Sbjct: 206 GALLDHIGCEKTIALEGHFGF-DQTNINPEFAQKIQEVGKILEENPQYYTILEGHTDSTG 264

Query: 122 TLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQ 181
           +   N  +S ERA  +   L + GV+  + ++ +G+ ++ P  +NDTK GR  N+R+E +
Sbjct: 265 SKTYNQKLSLERAKAVAKELEKTGVAKEKIVT-KGYGFEKPKASNDTKEGRAQNRRVEAK 323

Query: 182 IF 183
            F
Sbjct: 324 FF 325


>gi|171322789|ref|ZP_02911520.1| OmpA/MotB domain protein [Burkholderia ambifaria MEX-5]
 gi|171091861|gb|EDT37347.1| OmpA/MotB domain protein [Burkholderia ambifaria MEX-5]
          Length = 230

 Score = 66.2 bits (160), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 48/73 (65%), Gaps = 1/73 (1%)

Query: 110 VIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTK 169
            + +  +TDS+G+   N+ +S+ RA  + +YL   G+S+ RF+  RG+    P+D+N+T 
Sbjct: 154 TVTVNGYTDSVGSDDYNVGLSERRASAVDAYLQSHGLSAGRFVG-RGYGKADPVDSNETA 212

Query: 170 VGRQNNQRIEIQI 182
           VGR  N+R+E+++
Sbjct: 213 VGRARNRRVEVRL 225


>gi|327404889|ref|YP_004345727.1| OmpA/MotB domain-containing protein [Fluviicola taffensis DSM
           16823]
 gi|327320397|gb|AEA44889.1| OmpA/MotB domain protein [Fluviicola taffensis DSM 16823]
          Length = 688

 Score = 66.2 bits (160), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 30/92 (32%), Positives = 58/92 (63%), Gaps = 3/92 (3%)

Query: 96  LQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVR 155
           ++ +  ++   P   I I  HTD+ G+   N  +SQ+RA+ + +YL+ +G+++NR I+ +
Sbjct: 600 MERLVQLMKDVPRLKIEISGHTDNTGSATLNETLSQQRAEAVVAYLVSKGIAANRMIA-K 658

Query: 156 GFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGN 187
           G+    PI +N+++ G+Q N+R E +I  +GN
Sbjct: 659 GYGSSQPIASNNSEDGKQQNRRTEFEI--KGN 688


>gi|325286633|ref|YP_004262423.1| OmpA/MotB domain-containing protein [Cellulophaga lytica DSM 7489]
 gi|324322087|gb|ADY29552.1| OmpA/MotB domain protein [Cellulophaga lytica DSM 7489]
          Length = 235

 Score = 66.2 bits (160), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 30/89 (33%), Positives = 50/89 (56%), Gaps = 1/89 (1%)

Query: 96  LQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVR 155
           L  +A +  ++P T I +  HTDS G    N+ +S+ RA+ + SYL  +G++++RF +  
Sbjct: 133 LDKLANVFIEYPDTNILVVGHTDSSGAADYNMTLSKNRANAVTSYLTAKGIAASRF-TTE 191

Query: 156 GFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
            F  + P   N T  GR  N+R+ + I P
Sbjct: 192 WFGEEKPTHDNSTPEGRAKNRRVNVAILP 220


>gi|149279062|ref|ZP_01885196.1| outer membrane protein, OmpA/MotB family [Pedobacter sp. BAL39]
 gi|149230341|gb|EDM35726.1| outer membrane protein, OmpA/MotB family [Pedobacter sp. BAL39]
          Length = 439

 Score = 66.2 bits (160), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 34/98 (34%), Positives = 60/98 (61%), Gaps = 3/98 (3%)

Query: 86  VFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRG 145
           V  +K +  + ++ A ++ K  S  +A   HTD+ G++  NL +S++RA+ +K+YL+ +G
Sbjct: 345 VIRQKSYATLNRVAALLIEKNFSLKLA--GHTDNTGSMALNLRLSKDRAESVKAYLVSQG 402

Query: 146 VSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
            +++R I   G+    PI TN T  GRQ N+R+E  +F
Sbjct: 403 ANASR-IEATGYGPNQPIATNKTAAGRQANRRVEFTLF 439


>gi|289548706|ref|YP_003473694.1| OmpA/MotB domain protein [Thermocrinis albus DSM 14484]
 gi|289182323|gb|ADC89567.1| OmpA/MotB domain protein [Thermocrinis albus DSM 14484]
          Length = 243

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 40/106 (37%), Positives = 60/106 (56%), Gaps = 9/106 (8%)

Query: 88  LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSI----GTLKNNLLISQERADVIKSYLIQ 143
           ++ +F P+L  IA +LN  P+ V  ++ HTD+I    G   +N  +S  RA  +  Y I 
Sbjct: 134 IKPQFYPILDKIAELLNSIPNPV-EVEGHTDNIPISTGRFPSNWELSTARASSVVRYFIA 192

Query: 144 RGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGNIK 189
           +GVS +R +   G+A   PI +N T  GR+ N+R+EI I    NIK
Sbjct: 193 KGVSPDR-LKASGYADTRPIASNATPEGREQNRRVEIVII---NIK 234


>gi|182678181|ref|YP_001832327.1| OmpA/MotB domain-containing protein [Beijerinckia indica subsp.
           indica ATCC 9039]
 gi|182634064|gb|ACB94838.1| OmpA/MotB domain protein [Beijerinckia indica subsp. indica ATCC
           9039]
          Length = 459

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 48/88 (54%), Gaps = 1/88 (1%)

Query: 95  MLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISV 154
           +L  I T +   P   I I  HTDS G    NL +S+ RA  +  YL+  G+ +++ +S 
Sbjct: 372 LLDRIVTTIGHCPEATIEISGHTDSTGNEPFNLALSERRAKAVFDYLVAAGIPADK-LSA 430

Query: 155 RGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
            G+    P+ +NDT+ GR  N+RIE  +
Sbjct: 431 TGYGSSRPVASNDTEEGRAKNRRIEFTV 458


>gi|254230148|ref|ZP_04923543.1| outer membrane protein OmpA [Vibrio sp. Ex25]
 gi|262394952|ref|YP_003286806.1| outer membrane protein A [Vibrio sp. Ex25]
 gi|151937341|gb|EDN56204.1| outer membrane protein OmpA [Vibrio sp. Ex25]
 gi|262338546|gb|ACY52341.1| outer membrane protein A precursor [Vibrio sp. Ex25]
          Length = 320

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 55/93 (59%), Gaps = 1/93 (1%)

Query: 88  LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVS 147
           L+ +    L  +   LN+ P   + +  +TD+ G    NL +S++RA+ + + L+++G+ 
Sbjct: 218 LKPESAAKLDNLVAFLNEHPQANVEVVGYTDTSGPAAYNLKVSEKRAESVANALVEKGID 277

Query: 148 SNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEI 180
           S+R I  RG     PI +NDT+ GRQ N+R+EI
Sbjct: 278 SSR-IQARGEGENNPIASNDTREGRQQNRRVEI 309


>gi|257451630|ref|ZP_05616929.1| Outer membrane porin F [Fusobacterium sp. 3_1_5R]
 gi|257466946|ref|ZP_05631257.1| Outer membrane porin F [Fusobacterium gonidiaformans ATCC 25563]
          Length = 183

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 39/119 (32%), Positives = 64/119 (53%), Gaps = 2/119 (1%)

Query: 62  GIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSI 120
           G+ + R G+ +   +P  + F  ++  ++    P L+ +A  L       I I  +TD I
Sbjct: 60  GVTIRREGNNLILSMPELILFDFNKYEVKNGIKPSLRTLANALGANADIKIKIDGYTDFI 119

Query: 121 GTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIE 179
           G+   NL +S  RA  IKSYL+ +G   N  IS+ G+  + P+ +NDT+ GR  N+R+E
Sbjct: 120 GSEGYNLELSVNRAKAIKSYLVAQGAIENN-ISIEGYGKQNPVASNDTESGRARNRRVE 177


>gi|113868899|ref|YP_727388.1| outer membrane protein peptidoglycan-associated(lipo)proteins
           [Ralstonia eutropha H16]
 gi|113527675|emb|CAJ94020.1| outer membrane protein peptidoglycan-associated(lipo)proteins
           [Ralstonia eutropha H16]
          Length = 212

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 36/110 (32%), Positives = 56/110 (50%), Gaps = 2/110 (1%)

Query: 76  IPVHVSFVSE-VFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERA 134
           IP  V+F ++   ++  F  +L  +A  L +       +  HTDS G    N+ +SQ RA
Sbjct: 101 IPSQVTFDTDSATIKPSFRSVLDQVAQTLGQHQDVSANVVGHTDSTGNPNYNMQLSQRRA 160

Query: 135 DVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
             +  YL  RGV+ NR ++  G     P+  N T+ GR  N+R+EI + P
Sbjct: 161 QSVAGYLGDRGVARNR-LTAEGRGQSQPVADNGTEAGRAQNRRVEIFLKP 209


>gi|325275242|ref|ZP_08141202.1| OmpA/MotB domain-containing protein [Pseudomonas sp. TJI-51]
 gi|324099634|gb|EGB97520.1| OmpA/MotB domain-containing protein [Pseudomonas sp. TJI-51]
          Length = 231

 Score = 65.9 bits (159), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 35/88 (39%), Positives = 50/88 (56%), Gaps = 1/88 (1%)

Query: 96  LQLIATIL-NKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISV 154
           L  IAT L  + PS  +++  HTDS+G+   N  +S+ RA  +  YL+Q GV  + F+SV
Sbjct: 142 LNTIATRLKQEAPSARLSVSGHTDSVGSDSYNQKLSERRAHSVTDYLVQSGVPRSSFVSV 201

Query: 155 RGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
            G     P+  N T  GR  N+R EI+I
Sbjct: 202 VGAGETQPVADNATAEGRAMNRRTEIKI 229


>gi|285017363|ref|YP_003375074.1| ompa family outer membrane protein precursor [Xanthomonas
           albilineans GPE PC73]
 gi|283472581|emb|CBA15086.1| putative ompa family outer membrane protein precursor [Xanthomonas
           albilineans]
          Length = 366

 Score = 65.9 bits (159), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 43/150 (28%), Positives = 67/150 (44%), Gaps = 15/150 (10%)

Query: 48  DKAEDEFQMQLQDTGIVVSRIGDMIT---CYIPVHVSFVSEVF------LEKKFLPMLQL 98
           DK +D   +   D     S+ G  +    C +PV +      F      L    + +L  
Sbjct: 214 DKDDDGDGVNNCDDKCPDSKPGQTVGPDGCPVPVSIDLKGVNFDFNKSTLRPDAIGLLNE 273

Query: 99  IATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFA 158
              ILN +P   + +  HTDSIG+ K N  +S+ RA V+  YL++ GV ++R     G+ 
Sbjct: 274 AVGILNSYPDLKVQVAGHTDSIGSDKYNQKLSERRARVVYDYLVKHGVDASRLDGPIGYG 333

Query: 159 YKYPI------DTNDTKVGRQNNQRIEIQI 182
              PI      D +D   GR  N+R E+ +
Sbjct: 334 KTRPIAPNTNPDGSDNPEGRAKNRRTELNV 363


>gi|268316295|ref|YP_003290014.1| OmpA/MotB domain-containing protein [Rhodothermus marinus DSM 4252]
 gi|262333829|gb|ACY47626.1| OmpA/MotB domain protein [Rhodothermus marinus DSM 4252]
          Length = 209

 Score = 65.9 bits (159), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 47/141 (33%), Positives = 72/141 (51%), Gaps = 4/141 (2%)

Query: 44  GSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATI 102
           G  +D+   E Q +L D  I   R+G+ I       + F      L  +    L+ +A  
Sbjct: 59  GQRMDRQAAEMQQELPDARI--ERVGEGILVTFDSGILFDFDSATLRPEAREKLRRLAES 116

Query: 103 LNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYP 162
           L K+P T + I  HTDS G  + N  +S+ RA+   ++L+Q+G+  +R I   G     P
Sbjct: 117 LKKYPETEVLIVGHTDSTGPEEYNQRLSERRAEAAAAFLMQQGIRPSR-IRTMGKGETEP 175

Query: 163 IDTNDTKVGRQNNQRIEIQIF 183
           I +N T+ GRQ N+R+EI IF
Sbjct: 176 IASNATEEGRQLNRRVEIAIF 196


>gi|118578992|ref|YP_900242.1| OmpA/MotB domain-containing protein [Pelobacter propionicus DSM
           2379]
 gi|118501702|gb|ABK98184.1| OmpA/MotB domain protein [Pelobacter propionicus DSM 2379]
          Length = 224

 Score = 65.9 bits (159), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 46/153 (30%), Positives = 76/153 (49%), Gaps = 5/153 (3%)

Query: 38  IVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPML 96
           +V    G+ +D+     +  + +  +V  R G+ +   +P  + F   +  L+      L
Sbjct: 69  VVGGGIGNYMDRQAAALKKNMPEAEVV--RDGENVYVALPSGILFDTGKDELKTSAKESL 126

Query: 97  QLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRG 156
              A  L K   T I IQ HTDS G+ K N  +SQ RA+ ++ +L   GV S+R  ++ G
Sbjct: 127 AKAAATL-KSSETNIIIQGHTDSTGSDKINQPLSQRRANQVRDFLAANGVPSSRMTAI-G 184

Query: 157 FAYKYPIDTNDTKVGRQNNQRIEIQIFPRGNIK 189
           +    P   NDT+V R  N+R++++I P   IK
Sbjct: 185 YGSSRPAVPNDTEVNRALNRRVQLEISPNEKIK 217


>gi|323525137|ref|YP_004227290.1| OmpA/MotB domain-containing protein [Burkholderia sp. CCGE1001]
 gi|323382139|gb|ADX54230.1| OmpA/MotB domain protein [Burkholderia sp. CCGE1001]
          Length = 217

 Score = 65.9 bits (159), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 36/106 (33%), Positives = 55/106 (51%), Gaps = 2/106 (1%)

Query: 76  IPVHVSFVSEVF-LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERA 134
           IP  V+F +  + ++  F P+L  +   L + P  +  +  HTDS G    N  +S  RA
Sbjct: 102 IPSSVTFDTNSYAIKPSFAPVLDQLTQTLQQNPEVIAQVVGHTDSTGQPAYNQTLSVNRA 161

Query: 135 DVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEI 180
             +  +L QRGV+  R +S +G     PI  N T+ GR  N+R+EI
Sbjct: 162 QSVVGFLEQRGVAPQR-LSAQGMGQNQPIADNSTEAGRAANRRVEI 206


>gi|313674269|ref|YP_004052265.1| ompa/motb domain protein [Marivirga tractuosa DSM 4126]
 gi|312940967|gb|ADR20157.1| OmpA/MotB domain protein [Marivirga tractuosa DSM 4126]
          Length = 526

 Score = 65.9 bits (159), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 32/87 (36%), Positives = 55/87 (63%), Gaps = 1/87 (1%)

Query: 96  LQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVR 155
           L  + T+L K P+  I +  HTD+ G+ K N+ +SQ+R+D IK YL+++G++  R  S +
Sbjct: 438 LDRVYTMLKKNPTVEIELAGHTDNTGSAKLNIELSQKRSDKIKEYLVEKGINPKRLQS-K 496

Query: 156 GFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           G+    PI +N ++  R+ N+R+E  I
Sbjct: 497 GYGGARPIASNKSEATRKLNRRVEFTI 523


>gi|194337429|ref|YP_002019223.1| OmpA/MotB domain protein [Pelodictyon phaeoclathratiforme BU-1]
 gi|194309906|gb|ACF44606.1| OmpA/MotB domain protein [Pelodictyon phaeoclathratiforme BU-1]
          Length = 337

 Score = 65.9 bits (159), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 57/88 (64%), Gaps = 2/88 (2%)

Query: 94  PMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQR-GVSSNRFI 152
           P L+ IA +LNK P+  + +  HTD++G  + N ++S+ RA+ + + L++  G+S+ R +
Sbjct: 248 PALKEIAILLNKQPTLRLHVVGHTDNVGGYEANTVLSKRRAEAVAASLVKDFGISALR-L 306

Query: 153 SVRGFAYKYPIDTNDTKVGRQNNQRIEI 180
           +  G AY  P+ +N T+ GR  N+R+E+
Sbjct: 307 TANGAAYLAPVASNSTEAGRAKNRRVEL 334


>gi|332664439|ref|YP_004447227.1| OmpA/MotB domain-containing protein [Haliscomenobacter hydrossis
           DSM 1100]
 gi|332333253|gb|AEE50354.1| OmpA/MotB domain protein [Haliscomenobacter hydrossis DSM 1100]
          Length = 228

 Score = 65.9 bits (159), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 41/143 (28%), Positives = 73/143 (51%), Gaps = 3/143 (2%)

Query: 43  FGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIAT 101
            GS +DK   + +  L  +   V R+G+ I       + F V    L+      L   A 
Sbjct: 75  IGSYMDKHARKLKEDLGKSA-EVERVGESILVTFDSGIMFDVDSYALKAATRANLDKAAE 133

Query: 102 ILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKY 161
            + ++  T I +  HTD+ G+ + N  +S+ RA  + S+L Q GV+++R ++ +GF  + 
Sbjct: 134 TMKEYDKTEIIVMGHTDATGSDEYNQKLSENRAAAVSSFLQQNGVTASR-LTKKGFGEQK 192

Query: 162 PIDTNDTKVGRQNNQRIEIQIFP 184
           P+ +N +  GR+ N+R+EI I  
Sbjct: 193 PVASNTSVSGREQNRRVEIAIVA 215


>gi|325295240|ref|YP_004281754.1| OmpA/MotB domain protein [Desulfurobacterium thermolithotrophum DSM
           11699]
 gi|325065688|gb|ADY73695.1| OmpA/MotB domain protein [Desulfurobacterium thermolithotrophum DSM
           11699]
          Length = 251

 Score = 65.9 bits (159), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 35/90 (38%), Positives = 55/90 (61%), Gaps = 1/90 (1%)

Query: 96  LQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVR 155
           L+ +A  L++ P TVI I   TDS G+   N+ +S++RA+ +K+ L+  GV   R + V 
Sbjct: 154 LRRLARTLSQNPDTVIVISGFTDSTGSFDYNVRLSEKRAESVKNELVLNGVDPTRIL-VF 212

Query: 156 GFAYKYPIDTNDTKVGRQNNQRIEIQIFPR 185
           G   K PI  N+T  GR  N+R+EI ++P+
Sbjct: 213 GCGPKKPIAPNNTPEGRALNRRVEILVYPK 242


>gi|319955316|ref|YP_004166583.1| ompa/motb domain protein [Cellulophaga algicola DSM 14237]
 gi|319423976|gb|ADV51085.1| OmpA/MotB domain protein [Cellulophaga algicola DSM 14237]
          Length = 238

 Score = 65.9 bits (159), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 41/151 (27%), Positives = 78/151 (51%), Gaps = 6/151 (3%)

Query: 43  FGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYI--PVHVSF-VSEVFLEKKFLPMLQLI 99
            G+ +DK  +  + ++   G  V+R+G+ I         V F  ++  ++     +L  +
Sbjct: 84  IGNRMDKQAERIEEEIP--GAEVTRVGEGINVVFNEDAGVYFDTNKSVVKGTSATILDRL 141

Query: 100 ATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAY 159
             IL ++P + I ++ HTDS G    N+ +S++RA+ + SYL   G+SSNR ++ + +  
Sbjct: 142 VGILKEYPDSNILVEGHTDSAGPADYNMNLSKQRAESVTSYLNTHGISSNR-LTTKWYGE 200

Query: 160 KYPIDTNDTKVGRQNNQRIEIQIFPRGNIKK 190
             P   N T  G+  N+R+E+ I     +K+
Sbjct: 201 TQPKSDNSTTEGKAKNRRVEMVIVASDELKQ 231


>gi|146298460|ref|YP_001193051.1| OmpA/MotB domain-containing protein [Flavobacterium johnsoniae
           UW101]
 gi|146152878|gb|ABQ03732.1| OmpA/MotB domain protein [Flavobacterium johnsoniae UW101]
          Length = 487

 Score = 65.9 bits (159), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 54/93 (58%), Gaps = 1/93 (1%)

Query: 89  EKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSS 148
           +K+    L  I  IL  +P+   +I+ HTD+ G+ K N  +SQ+RA+ + + L++RGV+ 
Sbjct: 386 DKETPARLDAIKEILKNYPNAKFSIEGHTDNTGSAKINDKLSQDRANAVLNALVERGVNP 445

Query: 149 NRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQ 181
              +  +GF    P+ +N T  G+  N+R EI+
Sbjct: 446 EN-LEAKGFGSSQPVASNKTAAGKAQNRRTEIK 477


>gi|118578882|ref|YP_900132.1| OmpA/MotB domain-containing protein [Pelobacter propionicus DSM
           2379]
 gi|118501592|gb|ABK98074.1| OmpA/MotB domain protein [Pelobacter propionicus DSM 2379]
          Length = 417

 Score = 65.9 bits (159), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 32/87 (36%), Positives = 51/87 (58%)

Query: 96  LQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVR 155
           L+ +A  L +FP+   AI+ HTD++G    N+ +SQ RA+ ++SYLI+    +   IS +
Sbjct: 326 LKRVADFLAEFPTAKGAIEGHTDNVGGKAYNMKLSQRRANSVRSYLIKTFNVAPERISAK 385

Query: 156 GFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           G     P+ +N T  GR+ N+RIE   
Sbjct: 386 GHGLTKPVASNKTADGRKQNRRIEANF 412


>gi|146283087|ref|YP_001173240.1| OmpA family protein [Pseudomonas stutzeri A1501]
 gi|145571292|gb|ABP80398.1| OmpA family protein [Pseudomonas stutzeri A1501]
 gi|327481439|gb|AEA84749.1| OmpA family protein [Pseudomonas stutzeri DSM 4166]
          Length = 260

 Score = 65.9 bits (159), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 37/134 (27%), Positives = 71/134 (52%), Gaps = 10/134 (7%)

Query: 49  KAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPS 108
           K +++ Q +  + G +V+  GD++  Y            L+   +  +Q +A  LN  P 
Sbjct: 123 KLQEDMQAKQTERGTLVT-FGDVLFDY--------DRAELKPGGMRSVQKLADFLNDNPE 173

Query: 109 TVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDT 168
             + ++ +TDS G+ + N  +S+ RAD ++  L++ GV   R +S +G+  +YP+ +N  
Sbjct: 174 RKVIVEGYTDSTGSAEYNQRLSERRADAVRMALVKMGVDPQRIVS-QGYGKEYPVASNSD 232

Query: 169 KVGRQNNQRIEIQI 182
             GR  N+R+E+ I
Sbjct: 233 SAGRAMNRRVEVTI 246


>gi|254510741|ref|ZP_05122808.1| OmpA domain protein [Rhodobacteraceae bacterium KLH11]
 gi|221534452|gb|EEE37440.1| OmpA domain protein [Rhodobacteraceae bacterium KLH11]
          Length = 300

 Score = 65.9 bits (159), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 56/97 (57%), Gaps = 2/97 (2%)

Query: 84  SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQ 143
            EV L +     L L+A  L   P T +A+  HTD  G L+ N+ +S +RA+ +++ LI+
Sbjct: 199 GEVALGEGPFASLTLLADYLADNPGTRLALVGHTDDTGDLQANIAVSTKRAEAVRARLIE 258

Query: 144 R-GVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIE 179
             GV+++R I  +G  Y  PI +N T  GR  N+R+E
Sbjct: 259 TYGVAADR-IEAQGVGYLAPITSNATPAGRDINRRVE 294


>gi|197116705|ref|YP_002137132.1| OmpA family outer membrane protein [Geobacter bemidjiensis Bem]
 gi|197086065|gb|ACH37336.1| OmpA family outer membrane protein [Geobacter bemidjiensis Bem]
          Length = 169

 Score = 65.9 bits (159), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 48/87 (55%)

Query: 96  LQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVR 155
           +  IA I+  +P   + +  HTD++G  + N  +SQ+RAD +  YL+ +     + +S +
Sbjct: 80  MTAIAAIMTDYPGFHVQVDGHTDNVGKPEANQKLSQDRADAVVKYLVDKKAVDAKRLSAK 139

Query: 156 GFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           GF    PI  N TK G+  N+R++  +
Sbjct: 140 GFGDSKPIADNKTKAGQAKNRRVDFTV 166


>gi|162451840|ref|YP_001614207.1| outer membrane protein [Sorangium cellulosum 'So ce 56']
 gi|161162422|emb|CAN93727.1| outer membrane protein [Sorangium cellulosum 'So ce 56']
          Length = 628

 Score = 65.5 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 28/76 (36%), Positives = 48/76 (63%), Gaps = 1/76 (1%)

Query: 110 VIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTK 169
           ++ +Q HTD  GT + NL +SQ+RAD + S+L+  GV   + ++ +G+ ++ P+  N  K
Sbjct: 550 LVEVQGHTDDNGTEEYNLRLSQQRADAVLSWLVAAGVPREKLVA-KGYGFEQPVGDNRVK 608

Query: 170 VGRQNNQRIEIQIFPR 185
            GRQ N+R++  I  R
Sbjct: 609 TGRQKNRRVQFVIVKR 624


>gi|315225528|ref|ZP_07867338.1| OmpA-OmpF porin family protein [Capnocytophaga ochracea F0287]
 gi|314944472|gb|EFS96511.1| OmpA-OmpF porin family protein [Capnocytophaga ochracea F0287]
          Length = 456

 Score = 65.5 bits (158), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 55/88 (62%), Gaps = 1/88 (1%)

Query: 95  MLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISV 154
           +L  I  +LN++ +   +I+ +TD  G    N  +S++RA  +K+YLI++G+   R ++ 
Sbjct: 368 VLNQIVDVLNQYKNAKFSIEGYTDISGKRDKNQKLSEDRAYSVKAYLIEKGIDEGR-LTA 426

Query: 155 RGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           +GF    PI +N TK GR+ N+R+EI +
Sbjct: 427 KGFGPDKPIASNKTKKGRELNRRVEINL 454


>gi|157960193|ref|YP_001500227.1| OmpA/MotB domain-containing protein [Shewanella pealeana ATCC
           700345]
 gi|157845193|gb|ABV85692.1| OmpA/MotB domain protein [Shewanella pealeana ATCC 700345]
          Length = 201

 Score = 65.5 bits (158), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 57/93 (61%), Gaps = 2/93 (2%)

Query: 87  FLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQR-G 145
           +++ ++ P +++IA+ + KFP+T   I+ H    G+ ++N ++SQ RA+ + S L +R G
Sbjct: 85  YIDPQYYPQVEVIASFMQKFPNTQAVIEGHCSKTGSHQHNQVLSQNRANAVSSLLAERFG 144

Query: 146 VSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRI 178
           + S R  +V G+++  PID   T    + N+R+
Sbjct: 145 IDSGRLSAV-GYSFDRPIDPTHTASAHKINRRV 176


>gi|91225860|ref|ZP_01260829.1| outer membrane protein OmpA [Vibrio alginolyticus 12G01]
 gi|269965437|ref|ZP_06179556.1| outer membrane protein OmpA [Vibrio alginolyticus 40B]
 gi|91189510|gb|EAS75786.1| outer membrane protein OmpA [Vibrio alginolyticus 12G01]
 gi|269829916|gb|EEZ84146.1| outer membrane protein OmpA [Vibrio alginolyticus 40B]
          Length = 320

 Score = 65.5 bits (158), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 55/93 (59%), Gaps = 1/93 (1%)

Query: 88  LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVS 147
           L+ +    L  +   LN+ P   + +  +TD+ G    NL +S++RA+ + + L+++G+ 
Sbjct: 218 LKPESAAKLDNLVAFLNEHPQANVEVVGYTDTSGPAAYNLKVSEKRAESVANALVEKGID 277

Query: 148 SNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEI 180
           S+R I  RG     PI +NDT+ GRQ N+R+E+
Sbjct: 278 SSR-IQARGEGENNPIASNDTREGRQQNRRVEV 309


>gi|256421238|ref|YP_003121891.1| OmpA/MotB domain protein [Chitinophaga pinensis DSM 2588]
 gi|256036146|gb|ACU59690.1| OmpA/MotB domain protein [Chitinophaga pinensis DSM 2588]
          Length = 594

 Score = 65.5 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 35/108 (32%), Positives = 56/108 (51%), Gaps = 7/108 (6%)

Query: 84  SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQ 143
           +E +L+    P L  +  +L K+P  VI + +HTDS G+   N  +S  RA     YL+ 
Sbjct: 487 NESYLQPASFPSLDRLVAMLKKYPKIVIELSAHTDSKGSNDLNEKLSDARAKSCVDYLVS 546

Query: 144 RGVSSNRFISVRGFAYKYPI------DTNDTKVGRQNNQRIEIQIFPR 185
           +G+ S R +  +G+A  +P+      D +D   GR  N+R E +I  R
Sbjct: 547 QGIESTR-LQAKGYAASHPVAPNTNKDGSDNPEGRARNRRTEFKILSR 593


>gi|189475078|gb|ACE00213.1| OmpA [Vibrio alginolyticus]
          Length = 320

 Score = 65.5 bits (158), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 55/93 (59%), Gaps = 1/93 (1%)

Query: 88  LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVS 147
           L+ +    L  +   LN+ P   + +  +TD+ G    NL +S++RA+ + + L+++G+ 
Sbjct: 218 LKPESAAKLDNLVAFLNEHPQANVEVVGYTDTSGPAAYNLKVSEKRAESVANALVEKGID 277

Query: 148 SNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEI 180
           S+R I  RG     PI +NDT+ GRQ N+R+E+
Sbjct: 278 SSR-IQARGEGENNPIASNDTREGRQQNRRVEV 309


>gi|159025748|emb|CAO02048.1| outer membrane protein A [Bordetella holmesii]
          Length = 163

 Score = 65.5 bits (158), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 46/74 (62%), Gaps = 2/74 (2%)

Query: 109 TVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDT 168
           T+IA+  HTDSIGT   NL +S  RA  +K+YL+ +G+  NR I   G     PI TN T
Sbjct: 89  TIIAV-GHTDSIGTEAYNLKLSDRRAASVKAYLVSKGIDPNR-IYTEGKGEAQPIATNKT 146

Query: 169 KVGRQNNQRIEIQI 182
             GR  N+R+EI+I
Sbjct: 147 AEGRARNRRVEIEI 160


>gi|310817592|ref|YP_003949950.1| OmpA domain-containing protein [Stigmatella aurantiaca DW4/3-1]
 gi|309390664|gb|ADO68123.1| OmpA domain protein [Stigmatella aurantiaca DW4/3-1]
          Length = 640

 Score = 65.5 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 29/93 (31%), Positives = 57/93 (61%), Gaps = 2/93 (2%)

Query: 88  LEKKFLPMLQLIATILNKFPST-VIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGV 146
           ++++   +L  +A +L + P    I ++ HTD++G  + NL +SQ+RA+ ++ YL ++GV
Sbjct: 538 IQRRSFKLLDQVAKLLREHPEIESITVEGHTDNVGKPEANLRLSQQRAEAVRDYLARKGV 597

Query: 147 SSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIE 179
           +  R +  +G+  + PI  N T  GR  N+R++
Sbjct: 598 APQR-LEAKGYGQERPIAPNTTSKGRATNRRVD 629


>gi|237747593|ref|ZP_04578073.1| outer membrane protein A [Oxalobacter formigenes OXCC13]
 gi|229378955|gb|EEO29046.1| outer membrane protein A [Oxalobacter formigenes OXCC13]
          Length = 207

 Score = 65.5 bits (158), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 50/80 (62%), Gaps = 1/80 (1%)

Query: 103 LNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYP 162
           L+   + VI    HTD IGT K N  +S+ RA+ +K+YL+ +GV +N+ I   G   K P
Sbjct: 121 LSGMDTEVIVAVGHTDWIGTDKYNQKLSERRANAVKAYLVSKGVPANK-IFTEGKGKKQP 179

Query: 163 IDTNDTKVGRQNNQRIEIQI 182
           I +N T+ GR  N+R+E+++
Sbjct: 180 IASNKTREGRAKNRRVEVEV 199


>gi|159025750|emb|CAO02049.1| outer membrane protein A [Bordetella holmesii]
          Length = 177

 Score = 65.5 bits (158), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 46/74 (62%), Gaps = 2/74 (2%)

Query: 109 TVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDT 168
           T+IA+  HTDSIGT   NL +S  RA  +K+YL+ +G+  NR I   G     PI TN T
Sbjct: 100 TIIAV-GHTDSIGTEAYNLKLSDRRAASVKAYLVSKGIDPNR-IYTEGKGEAQPIATNKT 157

Query: 169 KVGRQNNQRIEIQI 182
             GR  N+R+EI+I
Sbjct: 158 AEGRARNRRVEIEI 171


>gi|115373816|ref|ZP_01461109.1| thrombospondin type 3 repeat family [Stigmatella aurantiaca
           DW4/3-1]
 gi|115369215|gb|EAU68157.1| thrombospondin type 3 repeat family [Stigmatella aurantiaca
           DW4/3-1]
          Length = 669

 Score = 65.5 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 29/93 (31%), Positives = 57/93 (61%), Gaps = 2/93 (2%)

Query: 88  LEKKFLPMLQLIATILNKFPST-VIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGV 146
           ++++   +L  +A +L + P    I ++ HTD++G  + NL +SQ+RA+ ++ YL ++GV
Sbjct: 567 IQRRSFKLLDQVAKLLREHPEIESITVEGHTDNVGKPEANLRLSQQRAEAVRDYLARKGV 626

Query: 147 SSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIE 179
           +  R +  +G+  + PI  N T  GR  N+R++
Sbjct: 627 APQR-LEAKGYGQERPIAPNTTSKGRATNRRVD 658


>gi|312884285|ref|ZP_07743994.1| hypothetical protein VIBC2010_10946 [Vibrio caribbenthicus ATCC
           BAA-2122]
 gi|309368058|gb|EFP95601.1| hypothetical protein VIBC2010_10946 [Vibrio caribbenthicus ATCC
           BAA-2122]
          Length = 125

 Score = 65.5 bits (158), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 32/87 (36%), Positives = 50/87 (57%), Gaps = 1/87 (1%)

Query: 96  LQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVR 155
           L  +A  LN++P++ +AI  +TDS G    NL +S+ RA  +K YLI  G+   R ++  
Sbjct: 35  LDNLANFLNEYPTSRVAITGYTDSSGPAAYNLKLSEMRAQAVKDYLISAGIEEAR-LTAT 93

Query: 156 GFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           G     P+  N T  GR+ N+R+E+ I
Sbjct: 94  GLGENNPVADNCTHEGREKNRRVEVVI 120


>gi|260429336|ref|ZP_05783313.1| OmpA domain protein [Citreicella sp. SE45]
 gi|260419959|gb|EEX13212.1| OmpA domain protein [Citreicella sp. SE45]
          Length = 304

 Score = 65.5 bits (158), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 31/89 (34%), Positives = 52/89 (58%), Gaps = 1/89 (1%)

Query: 96  LQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVR 155
           L+ +A  L   PS  + +  HTD++G+L  N  +S++RA   +SYL  RG+ + + +  +
Sbjct: 215 LEELAAFLTADPSRRVLLVGHTDAVGSLAANTELSRKRAAAAESYLRARGIPAGQ-LGAQ 273

Query: 156 GFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           G  Y  P+ +N T  GR+ N+RIE  + P
Sbjct: 274 GAGYLSPVASNLTPEGREENRRIEAILLP 302


>gi|253701505|ref|YP_003022694.1| OmpA/MotB domain protein [Geobacter sp. M21]
 gi|251776355|gb|ACT18936.1| OmpA/MotB domain protein [Geobacter sp. M21]
          Length = 466

 Score = 65.5 bits (158), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 29/98 (29%), Positives = 58/98 (59%), Gaps = 2/98 (2%)

Query: 83  VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLI 142
           + +  +  ++   +  +   + K+P+T   I+ HTD++G+  +N  +SQ RA+ + ++L+
Sbjct: 237 IDKAIIRPEYKEEIAQVGNFMKKYPTTTAVIEGHTDNVGSYNHNQDLSQRRAEAVVNHLV 296

Query: 143 -QRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIE 179
            Q G+  +R +S +G+ +  PI  N T  G+Q N+RIE
Sbjct: 297 EQYGIERSR-LSAKGYGFTRPIADNATDEGKQKNRRIE 333



 Score = 52.4 bits (124), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 49/81 (60%), Gaps = 2/81 (2%)

Query: 99  IATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQR-GVSSNRFISVRGF 157
           +A  + ++ +T   I+ HTD+ G+ + N+ +SQ+RA  + ++L+   G+  +R +S +G+
Sbjct: 377 VADYMKRYNTTTAVIEGHTDNTGSPEKNMKLSQQRAQNVVNHLVDNFGIERSR-LSAKGY 435

Query: 158 AYKYPIDTNDTKVGRQNNQRI 178
                I  N+T  GRQ N+RI
Sbjct: 436 GATRRISYNNTPEGRQKNRRI 456


>gi|183222506|ref|YP_001840502.1| hypothetical protein LEPBI_I3161 [Leptospira biflexa serovar Patoc
           strain 'Patoc 1 (Paris)']
 gi|189912543|ref|YP_001964098.1| OmpA-family protein [Leptospira biflexa serovar Patoc strain 'Patoc
           1 (Ames)']
 gi|167777219|gb|ABZ95520.1| OmpA-family protein [Leptospira biflexa serovar Patoc strain 'Patoc
           1 (Ames)']
 gi|167780928|gb|ABZ99226.1| Conserved hypothetical protein [Leptospira biflexa serovar Patoc
           strain 'Patoc 1 (Paris)']
          Length = 475

 Score = 65.5 bits (158), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 31/84 (36%), Positives = 49/84 (58%)

Query: 99  IATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFA 158
           IA IL K+P   I +  HTD+IG  + N  +S+ERA  +   L+       + IS RG+A
Sbjct: 389 IAEILKKYPDREIRVSGHTDNIGKKEYNQKLSEERAKSVLHSLVDNHKMDEKHISFRGYA 448

Query: 159 YKYPIDTNDTKVGRQNNQRIEIQI 182
            ++P+  ND++  R  N+R+EI +
Sbjct: 449 DEFPVAPNDSEENRHKNRRVEITL 472


>gi|229588852|ref|YP_002870971.1| hypothetical protein PFLU1321 [Pseudomonas fluorescens SBW25]
 gi|229360718|emb|CAY47576.1| putative outer membrane protein [Pseudomonas fluorescens SBW25]
          Length = 231

 Score = 65.5 bits (158), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 35/88 (39%), Positives = 49/88 (55%), Gaps = 1/88 (1%)

Query: 96  LQLIATIL-NKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISV 154
           L  +AT L  + PS  + +  HTDS+G    N  +S++RA  +  YLI  GV  + F+SV
Sbjct: 142 LDTVATRLKQEAPSAQLRVSGHTDSVGKDAYNQRLSEKRAHSVTDYLIGAGVPRSNFVSV 201

Query: 155 RGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
            G    +P+  N T  GR  N+R EIQI
Sbjct: 202 TGAGESHPVADNKTAEGRALNRRTEIQI 229


>gi|206579667|ref|YP_002238891.1| OmpA domain protein [Klebsiella pneumoniae 342]
 gi|206568725|gb|ACI10501.1| OmpA domain protein [Klebsiella pneumoniae 342]
          Length = 567

 Score = 65.5 bits (158), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 29/79 (36%), Positives = 47/79 (59%)

Query: 107 PSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTN 166
           P  +I +  HTDS+G  K N L+S +RA+ ++ ++   G   +   +V+G+    PI TN
Sbjct: 464 PGWLIVVAGHTDSVGEEKANQLLSLKRAESVRDWMRDTGDVPDSCFAVQGYGESRPIATN 523

Query: 167 DTKVGRQNNQRIEIQIFPR 185
           DT  GR  N+R+EI + P+
Sbjct: 524 DTPEGRALNRRVEISLVPQ 542


>gi|325983492|ref|YP_004295894.1| OmpA/MotB domain-containing protein [Nitrosomonas sp. AL212]
 gi|325533011|gb|ADZ27732.1| OmpA/MotB domain protein [Nitrosomonas sp. AL212]
          Length = 227

 Score = 65.5 bits (158), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 44/140 (31%), Positives = 68/140 (48%), Gaps = 3/140 (2%)

Query: 43  FGSSLDKAEDEFQMQLQDTGIVVSRIGD-MITCYIPVHVSF-VSEVFLEKKFLPMLQLIA 100
           +   +++ + E +     TG+ V++  D  +   IP  +SF      ++  F P+L   A
Sbjct: 71  WSQRMEEQKREMETATAGTGVQVTQTEDNRLKLNIPSDISFDTGRADIKPGFRPILDNFA 130

Query: 101 TILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYK 160
           T L     T + I  HTDS G+   N  +S  RA   + YL+ RGVS  R I + G   +
Sbjct: 131 TTLISNEGTAVKIIGHTDSTGSDAINNPLSVNRAASTRDYLVSRGVSIKR-IQIDGRGSR 189

Query: 161 YPIDTNDTKVGRQNNQRIEI 180
            P+  NDT   R  N+R+EI
Sbjct: 190 EPMAENDTPENRAENRRVEI 209


>gi|163856192|ref|YP_001630490.1| outer membrane protein A precursor [Bordetella petrii DSM 12804]
 gi|163259920|emb|CAP42221.1| outer membrane protein A precursor [Bordetella petrii]
          Length = 193

 Score = 65.5 bits (158), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 34/74 (45%), Positives = 48/74 (64%), Gaps = 2/74 (2%)

Query: 109 TVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDT 168
           T+IA+  HTDSIGT K N  +S+ RA  +KSYL+ +GV  NR I   G     P+ +N T
Sbjct: 117 TIIAV-GHTDSIGTEKYNQGLSERRAASVKSYLVSKGVDPNR-IYTEGKGELQPVASNKT 174

Query: 169 KVGRQNNQRIEIQI 182
           + GR  N+R+EI++
Sbjct: 175 REGRAQNRRVEIEV 188


>gi|126734944|ref|ZP_01750690.1| OmpA family domain protein [Roseobacter sp. CCS2]
 gi|126715499|gb|EBA12364.1| OmpA family domain protein [Roseobacter sp. CCS2]
          Length = 220

 Score = 65.5 bits (158), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 73/141 (51%), Gaps = 3/141 (2%)

Query: 45  SSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSE-VFLEKKFLPMLQLIATIL 103
           +SLD+  ++ + QL++  + VS  G  +   +   + F +    L       L+++A  L
Sbjct: 81  NSLDRQAEDLRRQLRND-VGVSNNGRDLRVVLSEDLLFATNSTQLSGTAQRELRIVANSL 139

Query: 104 NKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPI 163
            ++P + + +  HTD++G    N  +S+ RA  + S L+  GVS NR  ++ G     P+
Sbjct: 140 QQYPDSTVNVIGHTDNVGEASFNQGLSERRASAVSSVLVGGGVSRNRIRTI-GAGENNPV 198

Query: 164 DTNDTKVGRQNNQRIEIQIFP 184
            +N    GRQ N+R+EI I P
Sbjct: 199 ASNLNAAGRQANRRVEIVITP 219


>gi|146298022|ref|YP_001192613.1| OmpA/MotB domain-containing protein [Flavobacterium johnsoniae
           UW101]
 gi|146152440|gb|ABQ03294.1| OmpA/MotB domain protein [Flavobacterium johnsoniae UW101]
          Length = 231

 Score = 65.5 bits (158), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 45/141 (31%), Positives = 71/141 (50%), Gaps = 5/141 (3%)

Query: 44  GSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVH-VSF-VSEVFLEKKFLPMLQLIAT 101
           G+ +DK   E    L   G  V R+G+ I   +  + V F  ++  L       L  +  
Sbjct: 78  GNKMDKQAREIDQALP--GASVERVGEGIHLTLNENSVRFDTNKSTLTPTAKANLDKLVP 135

Query: 102 ILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKY 161
           + N++  T I I  +TD+ G  + NL +S +RA  +++YL+ +G+ S+RF    G     
Sbjct: 136 VFNEYGDTDIQIFGYTDNTGKPEYNLTLSGQRAASVQAYLVSKGLKSSRF-KTSGLGIAD 194

Query: 162 PIDTNDTKVGRQNNQRIEIQI 182
           PI TNDT  GR  N+R+E  I
Sbjct: 195 PIATNDTPEGRAQNRRVEFSI 215


>gi|108757927|ref|YP_633347.1| OmpA domain-containing protein [Myxococcus xanthus DK 1622]
 gi|108461807|gb|ABF86992.1| OmpA domain protein [Myxococcus xanthus DK 1622]
          Length = 476

 Score = 65.5 bits (158), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 52/94 (55%), Gaps = 2/94 (2%)

Query: 90  KKFLPMLQLIATILNKFPS-TVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSS 148
           K+   +L  +A  L   P    I I+ HTDS+G   +NL +SQ RAD + + L++RG+  
Sbjct: 382 KQSTAVLDDVAQALRDAPWIKRIRIEGHTDSMGNDASNLRLSQRRADAVMAQLLRRGIDP 441

Query: 149 NRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
            R  +V GF    PI  N TK GR  N+R E ++
Sbjct: 442 GRIQAV-GFGETQPIAPNSTKTGRAMNRRTEFKV 474


>gi|261210838|ref|ZP_05925129.1| outer membrane protein A precursor [Vibrio sp. RC341]
 gi|260840088|gb|EEX66683.1| outer membrane protein A precursor [Vibrio sp. RC341]
          Length = 309

 Score = 65.5 bits (158), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 32/83 (38%), Positives = 49/83 (59%), Gaps = 1/83 (1%)

Query: 102 ILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKY 161
           +L K P   + I  HTDS+G+ K N  +S+ RA  +  Y I  G+S +R I+  G     
Sbjct: 228 VLKKDPKLKVNIVGHTDSLGSDKYNQWMSERRAKTVADYFIANGISPSR-ITALGRGESE 286

Query: 162 PIDTNDTKVGRQNNQRIEIQIFP 184
           PI  N++++GR  N+R+EI I+P
Sbjct: 287 PIANNNSELGRAQNRRVEINIYP 309


>gi|238894412|ref|YP_002919146.1| putative outer membrane protein [Klebsiella pneumoniae NTUH-K2044]
 gi|238546728|dbj|BAH63079.1| putative outer membrane protein [Klebsiella pneumoniae subsp.
           pneumoniae NTUH-K2044]
          Length = 568

 Score = 65.5 bits (158), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 29/79 (36%), Positives = 47/79 (59%)

Query: 107 PSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTN 166
           P  +I +  HTDS+G  K N L+S +RA+ ++ ++   G   +   +V+G+    PI TN
Sbjct: 465 PGWLIVVAGHTDSVGEEKANQLLSLKRAESVRDWMRDTGDVPDSCFAVQGYGESRPIATN 524

Query: 167 DTKVGRQNNQRIEIQIFPR 185
           DT  GR  N+R+EI + P+
Sbjct: 525 DTPEGRALNRRVEISLVPQ 543


>gi|197116786|ref|YP_002137213.1| OmpA family outer membrane protein [Geobacter bemidjiensis Bem]
 gi|197086146|gb|ACH37417.1| OmpA family outer membrane protein [Geobacter bemidjiensis Bem]
          Length = 459

 Score = 65.5 bits (158), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 31/82 (37%), Positives = 49/82 (59%), Gaps = 2/82 (2%)

Query: 99  IATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQR-GVSSNRFISVRGF 157
           +   + ++P+T   I+ HTD++G  + NL +S+ RA  +  YL+   G+  +R +  RGF
Sbjct: 246 VGKFMKQYPTTTAVIEGHTDNVGDPQYNLDLSKRRAQAVVDYLVDNYGIERSR-LEARGF 304

Query: 158 AYKYPIDTNDTKVGRQNNQRIE 179
               PI TN+T  GRQ N+RIE
Sbjct: 305 GMARPIATNNTDEGRQANRRIE 326



 Score = 61.2 bits (147), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 48/85 (56%), Gaps = 2/85 (2%)

Query: 99  IATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQR-GVSSNRFISVRGF 157
           +   +NK+P+T   I+ HTD++G    N+ +SQ RA+    YL+Q  G+  +R +S +G+
Sbjct: 370 VGEYMNKYPTTTAVIEGHTDNVGGSDYNMKLSQRRAENAVQYLVQNFGIDKSR-LSAKGY 428

Query: 158 AYKYPIDTNDTKVGRQNNQRIEIQI 182
            Y   I  N T  GR  N+RI   I
Sbjct: 429 GYTRRIAYNSTPEGRAKNRRINAVI 453


>gi|290509857|ref|ZP_06549228.1| outer membrane protein [Klebsiella sp. 1_1_55]
 gi|289779251|gb|EFD87248.1| outer membrane protein [Klebsiella sp. 1_1_55]
          Length = 568

 Score = 65.5 bits (158), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 29/79 (36%), Positives = 47/79 (59%)

Query: 107 PSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTN 166
           P  +I +  HTDS+G  K N L+S +RA+ ++ ++   G   +   +V+G+    PI TN
Sbjct: 465 PGWLIVVAGHTDSVGEEKANQLLSLKRAESVRDWMRDTGDVPDSCFAVQGYGESRPIATN 524

Query: 167 DTKVGRQNNQRIEIQIFPR 185
           DT  GR  N+R+EI + P+
Sbjct: 525 DTPEGRALNRRVEISLVPQ 543


>gi|288935830|ref|YP_003439889.1| OmpA/MotB domain protein [Klebsiella variicola At-22]
 gi|288890539|gb|ADC58857.1| OmpA/MotB domain protein [Klebsiella variicola At-22]
          Length = 568

 Score = 65.5 bits (158), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 29/79 (36%), Positives = 47/79 (59%)

Query: 107 PSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTN 166
           P  +I +  HTDS+G  K N L+S +RA+ ++ ++   G   +   +V+G+    PI TN
Sbjct: 465 PGWLIVVAGHTDSVGEEKANQLLSLKRAESVRDWMRDTGDVPDSCFAVQGYGESRPIATN 524

Query: 167 DTKVGRQNNQRIEIQIFPR 185
           DT  GR  N+R+EI + P+
Sbjct: 525 DTPEGRALNRRVEISLVPQ 543


>gi|288942206|ref|YP_003444446.1| OmpA/MotB domain-containing protein [Allochromatium vinosum DSM
           180]
 gi|288897578|gb|ADC63414.1| OmpA/MotB domain protein [Allochromatium vinosum DSM 180]
          Length = 225

 Score = 65.5 bits (158), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 53/97 (54%), Gaps = 1/97 (1%)

Query: 88  LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVS 147
           ++  F   L+ I+ I+ K+  T +A+  HTDS G    N  +S+ RA  +  YL + GV 
Sbjct: 126 IQPGFYSTLEKISAIVRKYGKTQLAVSGHTDSTGAAAYNQTLSERRAASVGYYLERSGVL 185

Query: 148 SNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
             R  S  G+    PI +N T+ GR+ N+R++I I P
Sbjct: 186 PQRIYSA-GYGMNQPIASNATEDGRRLNRRVDILIMP 221


>gi|253701760|ref|YP_003022949.1| OmpA/MotB domain protein [Geobacter sp. M21]
 gi|251776610|gb|ACT19191.1| OmpA/MotB domain protein [Geobacter sp. M21]
          Length = 486

 Score = 65.5 bits (158), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 60/100 (60%), Gaps = 5/100 (5%)

Query: 88  LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVS 147
           +  K+L  ++ IA +L   P +   ++ HTD+ G L++NL +S  RA+ +K  L++ GV 
Sbjct: 387 VSPKYLGQIKKIADLLKANPGSTALVEGHTDNTGALRDNLKLSLRRAENLKRALVRYGVD 446

Query: 148 SNRFISVRGFAYKYPIDTNDTKVGRQNNQR----IEIQIF 183
             R ++V+G     P+ +N T+ GRQ N+R    +++QI+
Sbjct: 447 P-RLLAVKGEGSLQPVASNATEQGRQKNRRAVTKVQVQIY 485


>gi|225075662|ref|ZP_03718861.1| hypothetical protein NEIFLAOT_00678 [Neisseria flavescens
           NRL30031/H210]
 gi|224953084|gb|EEG34293.1| hypothetical protein NEIFLAOT_00678 [Neisseria flavescens
           NRL30031/H210]
          Length = 219

 Score = 65.5 bits (158), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 44/135 (32%), Positives = 66/135 (48%), Gaps = 2/135 (1%)

Query: 39  VNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVS-EVFLEKKFLPMLQ 97
           V    G  +D  E + +  L +T I V R G+ I   +P +V+F +    L       L 
Sbjct: 85  VGAGIGGYMDYQEKKLRQSLANTNIEVERQGNQIKLVMPENVTFATGSAALSGHAQSALS 144

Query: 98  LIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGF 157
             A  L ++P T + I  HTD+ G    N  +S+ RA+ +  +L  RGVSS R +S  G+
Sbjct: 145 AAAQTLVQYPDTTLTINGHTDNTGNDAINEPLSRNRAESVAIFLQSRGVSSTR-LSTFGY 203

Query: 158 AYKYPIDTNDTKVGR 172
             + PI +N T  GR
Sbjct: 204 GSRQPIASNATVEGR 218


>gi|152969879|ref|YP_001334988.1| putative outer membrane protein [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|150954728|gb|ABR76758.1| putative outer membrane protein [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
          Length = 568

 Score = 65.5 bits (158), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 29/79 (36%), Positives = 47/79 (59%)

Query: 107 PSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTN 166
           P  +I +  HTDS+G  K N L+S +RA+ ++ ++   G   +   +V+G+    PI TN
Sbjct: 465 PGWLIVVAGHTDSVGEEKANQLLSLKRAESVRDWMRDTGDVPDSCFAVQGYGESRPIATN 524

Query: 167 DTKVGRQNNQRIEIQIFPR 185
           DT  GR  N+R+EI + P+
Sbjct: 525 DTPEGRALNRRVEISLVPQ 543


>gi|162453582|ref|YP_001615949.1| outer membrane protein [Sorangium cellulosum 'So ce 56']
 gi|161164164|emb|CAN95469.1| probable outer membrane protein [Sorangium cellulosum 'So ce 56']
          Length = 323

 Score = 65.5 bits (158), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 35/98 (35%), Positives = 54/98 (55%), Gaps = 5/98 (5%)

Query: 91  KFLPM----LQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGV 146
           + LP+    L  +A  L    S  I I+ HTDS G+ + N  +S ERAD +K++LI  G+
Sbjct: 223 ELLPIAKEKLSQVAATLKDQGSPPIRIEGHTDSTGSAQANRKLSLERADAVKAHLITAGL 282

Query: 147 SSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
             ++  +V G     P+  N +  GR NN+R+EI + P
Sbjct: 283 PGDKIATV-GHGPDRPVADNSSTEGRANNRRVEIIVNP 319


>gi|159025752|emb|CAO02050.1| outer membrane protein A [Bordetella trematum]
          Length = 165

 Score = 65.5 bits (158), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 34/74 (45%), Positives = 47/74 (63%), Gaps = 2/74 (2%)

Query: 109 TVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDT 168
           T+IA+  HTDSIGT   N+ +S  RAD +K+YL+ +G+  NR I   G     PI +N T
Sbjct: 88  TIIAV-GHTDSIGTEAYNMKLSVRRADAVKAYLVGQGIDPNR-IYTEGKGEAQPIASNKT 145

Query: 169 KVGRQNNQRIEIQI 182
             GR  N+R+EI+I
Sbjct: 146 AEGRARNRRVEIEI 159


>gi|330014716|ref|ZP_08307964.1| OmpA family protein [Klebsiella sp. MS 92-3]
 gi|328532776|gb|EGF59559.1| OmpA family protein [Klebsiella sp. MS 92-3]
          Length = 568

 Score = 65.5 bits (158), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 29/79 (36%), Positives = 47/79 (59%)

Query: 107 PSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTN 166
           P  +I +  HTDS+G  K N L+S +RA+ ++ ++   G   +   +V+G+    PI TN
Sbjct: 465 PGWLIVVAGHTDSVGEEKANQLLSLKRAESVRDWMRDTGDVPDSCFAVQGYGESRPIATN 524

Query: 167 DTKVGRQNNQRIEIQIFPR 185
           DT  GR  N+R+EI + P+
Sbjct: 525 DTPEGRALNRRVEISLVPQ 543


>gi|255531842|ref|YP_003092214.1| OmpA/MotB domain-containing protein [Pedobacter heparinus DSM 2366]
 gi|255344826|gb|ACU04152.1| OmpA/MotB domain protein [Pedobacter heparinus DSM 2366]
          Length = 445

 Score = 65.1 bits (157), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 58/94 (61%), Gaps = 3/94 (3%)

Query: 90  KKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSN 149
           K +  + ++ A ++ K  S  +A   HTD+ G++  NL +S+ERA+ IK+YL+ +G +++
Sbjct: 355 KSYATLNKVAALLIEKNFSLKLA--GHTDNTGSMALNLRLSKERAEAIKAYLVSQGANAS 412

Query: 150 RFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
           R I   G+    PI +N T  GRQ N+R+E  ++
Sbjct: 413 R-IEATGYGPNQPIASNKTAEGRQKNRRVEFTLY 445


>gi|320158865|ref|YP_004191243.1| outer membrane protein A [Vibrio vulnificus MO6-24/O]
 gi|319934177|gb|ADV89040.1| outer membrane protein A precursor [Vibrio vulnificus MO6-24/O]
          Length = 357

 Score = 65.1 bits (157), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 33/87 (37%), Positives = 50/87 (57%), Gaps = 1/87 (1%)

Query: 96  LQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVR 155
           L  +A +L K+P     I  HTDS G+ K N  IS++RA  +  YL+++GV + + + V 
Sbjct: 259 LTPLAEVLIKYPDAEAEIVGHTDSTGSEKVNQRISEQRAQAVADYLVEQGVKAEQ-LKVS 317

Query: 156 GFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           G     PI +N T  GR  N+R+E+ I
Sbjct: 318 GAGESQPIASNKTAEGRAQNRRVEVTI 344


>gi|162449773|ref|YP_001612140.1| outer membrane protein [Sorangium cellulosum 'So ce 56']
 gi|161160355|emb|CAN91660.1| outer membrane protein [Sorangium cellulosum 'So ce 56']
          Length = 601

 Score = 65.1 bits (157), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 33/99 (33%), Positives = 55/99 (55%), Gaps = 2/99 (2%)

Query: 88  LEKKFLPMLQLIATILNKFPSTV-IAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGV 146
           +E +   +L  +A +L + P    +A+  HTD+ G  + NL +SQ RA  + ++L   G+
Sbjct: 490 IEPESFELLSEVAAVLEEHPEIARVAVDGHTDNQGAAQANLSLSQRRALAVVAWLTAHGI 549

Query: 147 SSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPR 185
            + R +  RGF  + P+  N T+ GR  N+R+E QI  R
Sbjct: 550 DARR-LEARGFGARRPLADNRTRDGRAKNRRVEFQIRKR 587


>gi|261414988|ref|YP_003248671.1| OmpA/MotB domain protein [Fibrobacter succinogenes subsp.
           succinogenes S85]
 gi|261371444|gb|ACX74189.1| OmpA/MotB domain protein [Fibrobacter succinogenes subsp.
           succinogenes S85]
 gi|302326246|gb|ADL25447.1| ompA family protein [Fibrobacter succinogenes subsp. succinogenes
           S85]
          Length = 756

 Score = 65.1 bits (157), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 37/128 (28%), Positives = 64/128 (50%), Gaps = 2/128 (1%)

Query: 56  MQLQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQS 115
           +Q+   G  + R  D+      +   F S   L+  + P L  I  +L K P   + +Q 
Sbjct: 523 IQVNKRGCPLRRKEDLDYLKKGIQFEFDSAKLLKSSY-PTLDDIIALLEKIPEVKLEVQG 581

Query: 116 HTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNN 175
           HTD +GT   N  +S++RA  +  Y   +G++++R  ++ GF  + P+  N T  GR  N
Sbjct: 582 HTDIVGTEDYNQKLSEDRAHSVTDYFQSKGIAADRLRAI-GFGTRMPLADNVTDEGRAKN 640

Query: 176 QRIEIQIF 183
           +R+E+  F
Sbjct: 641 RRVELIPF 648


>gi|104780438|ref|YP_606936.1| OmpA family outer membrane protein [Pseudomonas entomophila L48]
 gi|95109425|emb|CAK14126.1| putative outer membrane protein, OmpA family [Pseudomonas
           entomophila L48]
          Length = 230

 Score = 65.1 bits (157), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 36/88 (40%), Positives = 50/88 (56%), Gaps = 1/88 (1%)

Query: 96  LQLIATILNK-FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISV 154
           L  IAT L K  PS  +++  HTDS+G+ K N  +S+ RA  +  YL++ GV    F+SV
Sbjct: 141 LNTIATRLKKEAPSARLSVTGHTDSVGSDKYNQKLSEARARSVVEYLVESGVPRASFVSV 200

Query: 155 RGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
            G     P+  N T  GR  N+R EI+I
Sbjct: 201 VGAGETQPVADNATADGRAMNRRTEIKI 228


>gi|307718975|ref|YP_003874507.1| hypothetical protein STHERM_c12930 [Spirochaeta thermophila DSM
           6192]
 gi|306532700|gb|ADN02234.1| hypothetical protein STHERM_c12930 [Spirochaeta thermophila DSM
           6192]
          Length = 395

 Score = 65.1 bits (157), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 50/88 (56%)

Query: 96  LQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVR 155
           L+ IA IL+++P   + ++ HT   GT +  L +S ERA  +  +L++ GV     I +R
Sbjct: 306 LRKIAQILSRYPERDLLVEGHTALAGTPEGRLALSIERAKAVADFLMKLGVRRPEQIVIR 365

Query: 156 GFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
           G+    PI  N T+ GR  N+R+EI I 
Sbjct: 366 GYGATRPIADNTTEEGRSRNRRVEITIL 393


>gi|119357472|ref|YP_912116.1| OmpA/MotB domain-containing protein [Chlorobium phaeobacteroides
           DSM 266]
 gi|119354821|gb|ABL65692.1| OmpA/MotB domain protein [Chlorobium phaeobacteroides DSM 266]
          Length = 229

 Score = 65.1 bits (157), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 44/147 (29%), Positives = 77/147 (52%), Gaps = 8/147 (5%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF---VSEVFLEKKFLPMLQLIATIL 103
           +DK   E    ++  G  V RIG+ I       + F    S +    ++   ++ +A IL
Sbjct: 79  MDKQAAEIDRNVE--GAEVERIGEGIRVVFDSGILFNTGSSAITSTSRY--NIEKLAGIL 134

Query: 104 NKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPI 163
            K+  T + I+ HTDS+G+   N  +S+ RA  + + L   GVSS+R  ++ G+    PI
Sbjct: 135 AKYDDTNLIIEGHTDSVGSDSMNQTLSENRAQSVANLLKAYGVSSSRLSAI-GYGESRPI 193

Query: 164 DTNDTKVGRQNNQRIEIQIFPRGNIKK 190
            +N+T+ GR+ N+R+E+ I     +K+
Sbjct: 194 ASNETESGRRLNRRVEVLITANNELKR 220


>gi|347161|gb|AAC36903.1| protein F [Pseudomonas tolaasii]
          Length = 317

 Score = 65.1 bits (157), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 48/81 (59%), Gaps = 1/81 (1%)

Query: 99  IATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFA 158
           +A  + ++P T   ++ HTDS+G    N  +SQ RAD +K  L++ G++ NR  SV G+ 
Sbjct: 236 LADFMKQYPQTTTVVEGHTDSVGPDAYNQKLSQRRADAVKQVLVKDGIAPNRVSSV-GYG 294

Query: 159 YKYPIDTNDTKVGRQNNQRIE 179
              P+  N T+ GR  N+R+E
Sbjct: 295 KSRPVADNATEAGRAINRRVE 315


>gi|297537693|ref|YP_003673462.1| OmpA/MotB domain-containing protein [Methylotenera sp. 301]
 gi|297257040|gb|ADI28885.1| OmpA/MotB domain protein [Methylotenera sp. 301]
          Length = 224

 Score = 65.1 bits (157), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 43/138 (31%), Positives = 73/138 (52%), Gaps = 7/138 (5%)

Query: 49  KAEDEFQMQLQD----TGIVVSRIGD-MITCYIPVHVSF-VSEVFLEKKFLPMLQLIATI 102
           K ++E + Q+++    TG+ V++  D  +   IP  +SF V    ++  F  +L   A  
Sbjct: 73  KRQEEQKRQMEEATAGTGVAVTQTADNRLKLDIPSDISFAVGRADVQPNFRAILDTFANG 132

Query: 103 LNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYP 162
           L   P++ + I  HTDS G+   N  +S  RA  ++ YL  + V+SNR I++ G   + P
Sbjct: 133 LVTNPNSNVTIIGHTDSTGSDAVNNPLSLNRAASVRDYLTSKRVASNR-ITIDGRGSREP 191

Query: 163 IDTNDTKVGRQNNQRIEI 180
           +  NDT   +  N+R+EI
Sbjct: 192 LVANDTAANKAKNRRVEI 209


>gi|120556561|ref|YP_960912.1| OmpA/MotB domain-containing protein [Marinobacter aquaeolei VT8]
 gi|120326410|gb|ABM20725.1| OmpA/MotB domain protein [Marinobacter aquaeolei VT8]
          Length = 401

 Score = 65.1 bits (157), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 50/155 (32%), Positives = 73/155 (47%), Gaps = 13/155 (8%)

Query: 39  VNKRFGSSLDKAED---EFQMQLQDT--GIVVSRIG-DMITCY---IPVHVSF-VSEVFL 88
           VN R G  LD   D     Q Q  DT  G  V   G + IT     I + V F  +   +
Sbjct: 245 VNSR-GCELDSDNDGVVNSQDQCPDTTAGATVDETGCEGITETVETIELRVQFPTNSSVI 303

Query: 89  EKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQR-GVS 147
           +  +   ++ +A  + ++P T + I  HTDS G    N  +SQ RA+ +   L    GV 
Sbjct: 304 DNAYDNEIRRVADFMEEYPETTVEIAGHTDSAGEAGYNQFLSQRRAEAVAGRLTGPLGVD 363

Query: 148 SNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
            +R +S  G+    P+ TNDT  GR  N+R+E +I
Sbjct: 364 PDR-VSAVGYGEAEPVATNDTPAGRAQNRRVEARI 397


>gi|149916697|ref|ZP_01905199.1| OmpA domain protein [Plesiocystis pacifica SIR-1]
 gi|149822414|gb|EDM81803.1| OmpA domain protein [Plesiocystis pacifica SIR-1]
          Length = 520

 Score = 65.1 bits (157), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 55/105 (52%), Gaps = 1/105 (0%)

Query: 78  VHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVI 137
           +   + S    E K   +L     +L ++P   I +  HTD+ GT + N  +S +RAD +
Sbjct: 401 IEFEYNSATIREGKSKEVLDAAIKVLEEYPEIRIKVVGHTDNQGTPEYNKKLSTDRADAV 460

Query: 138 KSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           K YL + G++ +R I   G     P+ TN+T+ GR  N+R E +I
Sbjct: 461 KQYLAEGGIAEDR-IETFGAGQSDPLTTNETEEGRAKNRRTEFEI 504


>gi|300714997|ref|YP_003739800.1| outer membrane protein [Erwinia billingiae Eb661]
 gi|299060833|emb|CAX57940.1| Outer membrane protein [Erwinia billingiae Eb661]
          Length = 564

 Score = 65.1 bits (157), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 45/81 (55%)

Query: 107 PSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTN 166
           P  +I +  HTDS G +  N  +S  RAD ++ +++     S    +V+GF    PI TN
Sbjct: 461 PGWLIVVAGHTDSTGNVLANQQLSLTRADALRDWMLSTSDVSPTCFAVQGFGASRPIATN 520

Query: 167 DTKVGRQNNQRIEIQIFPRGN 187
           DT  GR  N+R+EI + P+ +
Sbjct: 521 DTPAGRALNRRVEISLVPQAD 541


>gi|254428955|ref|ZP_05042662.1| Thrombospondin type 3 repeat family [Alcanivorax sp. DG881]
 gi|196195124|gb|EDX90083.1| Thrombospondin type 3 repeat family [Alcanivorax sp. DG881]
          Length = 384

 Score = 65.1 bits (157), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 32/87 (36%), Positives = 53/87 (60%), Gaps = 2/87 (2%)

Query: 94  PMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQR-GVSSNRFI 152
           P L+ +A  + ++PS  + ++ HTDS G+   N  +SQ+RAD +K+ L+    VS++R  
Sbjct: 286 PSLENLAEGMRQYPSANLVLEGHTDSTGSAAYNKKLSQQRADAVKTVLVDHYNVSADRIT 345

Query: 153 SVRGFAYKYPIDTNDTKVGRQNNQRIE 179
           +V G+  + PI  N T  GR  N+R+E
Sbjct: 346 TV-GYGEEKPIADNKTSEGRAENRRVE 371


>gi|299134013|ref|ZP_07027206.1| OmpA/MotB domain protein [Afipia sp. 1NLS2]
 gi|298590760|gb|EFI50962.1| OmpA/MotB domain protein [Afipia sp. 1NLS2]
          Length = 464

 Score = 65.1 bits (157), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 34/83 (40%), Positives = 50/83 (60%), Gaps = 2/83 (2%)

Query: 97  QLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRG 156
           +LI  +L + P++ I I+ HTDS G  + NL +S  RA  +  Y I+ GV   R IS  G
Sbjct: 380 RLIEAVL-RCPTSQIEIEGHTDSNGEKEANLALSMRRAQAVADYFIKAGVPKER-ISAVG 437

Query: 157 FAYKYPIDTNDTKVGRQNNQRIE 179
           F  + P+ +NDT+ G+  N+RIE
Sbjct: 438 FGSERPVASNDTEEGKAQNRRIE 460


>gi|157377275|ref|YP_001475875.1| OmpA/MotB domain-containing protein [Shewanella sediminis HAW-EB3]
 gi|157319649|gb|ABV38747.1| OmpA/MotB domain protein [Shewanella sediminis HAW-EB3]
          Length = 201

 Score = 65.1 bits (157), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 24/93 (25%), Positives = 59/93 (63%), Gaps = 2/93 (2%)

Query: 87  FLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQR-G 145
           +++ ++   +++IAT +  +P+TV+ I+ H    G+  +NL +SQ RA+ + + L ++ G
Sbjct: 85  YIDPQYYDQIEVIATFMTDYPNTVVTIEGHCSKTGSYDHNLTLSQNRANAVTTTLTEQFG 144

Query: 146 VSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRI 178
           ++ +R  ++ G+++  P+D ++T +    N+R+
Sbjct: 145 INPDRLTAI-GYSFDRPVDMSETSIAHTRNRRV 176


>gi|116748592|ref|YP_845279.1| OmpA/MotB domain-containing protein [Syntrophobacter fumaroxidans
           MPOB]
 gi|116697656|gb|ABK16844.1| OmpA/MotB domain protein [Syntrophobacter fumaroxidans MPOB]
          Length = 182

 Score = 65.1 bits (157), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 42/143 (29%), Positives = 68/143 (47%), Gaps = 3/143 (2%)

Query: 44  GSSLDKAEDEF-QMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPM-LQLIAT 101
           G  +++ E E  Q   +  G  + R  D +       V F  +    K   P  +  +A 
Sbjct: 40  GGYIERQEAELVQRMTRADGTSIQREQDKLCITFNCGVLFPDDSTELKPDAPARIAPVAE 99

Query: 102 ILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKY 161
           +L K+P+T I +   TD  G+ K +  I++ RA  ++  L+ +G+   R I  RGF    
Sbjct: 100 VLAKYPATSIKVDGFTDRTGSEKYDHEITESRATAVRDVLVGKGIDPAR-IRARGFGDSK 158

Query: 162 PIDTNDTKVGRQNNQRIEIQIFP 184
           P+ TN T  GR+ N+R+ I I P
Sbjct: 159 PLTTNATDEGRRTNRRVTITIAP 181


>gi|51702435|gb|AAU08790.1| OmpA [Bordetella ansorpii]
          Length = 178

 Score = 65.1 bits (157), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 56/89 (62%), Gaps = 3/89 (3%)

Query: 95  MLQLIATILNKFP-STVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFIS 153
           +L  +A+ +N     T+IA+  HTDSIG+   N  +S+ RA  +KSYL+ +G+ +NR I 
Sbjct: 87  LLDQVASQVNTINLETLIAV-GHTDSIGSDAYNQKLSERRAASVKSYLVSKGIDANR-IY 144

Query: 154 VRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
             G   K P+ +N T+ GR  N+R+EI+I
Sbjct: 145 TEGKGEKQPVASNSTREGRAKNRRVEIEI 173


>gi|332284746|ref|YP_004416657.1| outer membrane protein A precursor [Pusillimonas sp. T7-7]
 gi|330428699|gb|AEC20033.1| outer membrane protein A precursor [Pusillimonas sp. T7-7]
          Length = 192

 Score = 65.1 bits (157), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 34/74 (45%), Positives = 50/74 (67%), Gaps = 2/74 (2%)

Query: 109 TVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDT 168
           T+IA   HTDSIGT + N  +SQ RA+ +K YL+ +GV+++R I V G     P+ +N T
Sbjct: 116 TLIAT-GHTDSIGTEQYNQGLSQRRANSVKDYLVSKGVAADR-IYVEGKGETSPVASNST 173

Query: 169 KVGRQNNQRIEIQI 182
           + GR  N+R+EI+I
Sbjct: 174 REGRAQNRRVEIEI 187


>gi|347155|gb|AAC36900.1| protein F [Pseudomonas fluorescens]
          Length = 317

 Score = 65.1 bits (157), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 48/81 (59%), Gaps = 1/81 (1%)

Query: 99  IATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFA 158
           +A  + ++P T   ++ HTDS+G    N  +SQ RAD +K  L++ G++ NR  SV G+ 
Sbjct: 236 LADFMKQYPQTTTVVEGHTDSVGPDAYNQKLSQRRADAVKQVLVKDGIAPNRVSSV-GYG 294

Query: 159 YKYPIDTNDTKVGRQNNQRIE 179
              P+  N T+ GR  N+R+E
Sbjct: 295 KSRPVADNATEAGRAINRRVE 315


>gi|327480660|gb|AEA83970.1| outer membrane protein OprF precursor [Pseudomonas stutzeri DSM
           4166]
          Length = 299

 Score = 65.1 bits (157), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 53/85 (62%), Gaps = 2/85 (2%)

Query: 99  IATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLI-QRGVSSNRFISVRGF 157
           +A  + ++P T   ++ HTDS+GT + N  +S+ RA+ +++ L+ + GV  NR  SV G+
Sbjct: 211 LADFMQQYPQTTTVVEGHTDSVGTDQYNQRLSERRAEAVRNVLVNEYGVQGNRVNSV-GY 269

Query: 158 AYKYPIDTNDTKVGRQNNQRIEIQI 182
               P+  N T+ GRQ N+R+E ++
Sbjct: 270 GESRPVADNSTEEGRQINRRVEAEV 294


>gi|254477082|ref|ZP_05090468.1| OmpA/MotB [Ruegeria sp. R11]
 gi|214031325|gb|EEB72160.1| OmpA/MotB [Ruegeria sp. R11]
          Length = 331

 Score = 65.1 bits (157), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 45/75 (60%)

Query: 111 IAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKV 170
           I +  HTD++G+L  N+ IS+ RAD ++  L++        I+V G  Y  P+ +N T  
Sbjct: 257 ILLVGHTDTVGSLDQNIAISERRADAVRRRLLEDSTVDRARIAVAGAGYMAPLTSNQTPA 316

Query: 171 GRQNNQRIEIQIFPR 185
           GR+ N+R+E+ + PR
Sbjct: 317 GREANRRVEVVLIPR 331


>gi|146282405|ref|YP_001172558.1| outer membrane protein OprF precursor [Pseudomonas stutzeri A1501]
 gi|145570610|gb|ABP79716.1| outer membrane protein OprF precursor [Pseudomonas stutzeri A1501]
          Length = 315

 Score = 65.1 bits (157), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 53/85 (62%), Gaps = 2/85 (2%)

Query: 99  IATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLI-QRGVSSNRFISVRGF 157
           +A  + ++P T   ++ HTDS+GT + N  +S+ RA+ +++ L+ + GV  NR  SV G+
Sbjct: 227 LADFMQQYPQTTTVVEGHTDSVGTDQYNQRLSERRAEAVRNVLVNEYGVQGNRVNSV-GY 285

Query: 158 AYKYPIDTNDTKVGRQNNQRIEIQI 182
               P+  N T+ GRQ N+R+E ++
Sbjct: 286 GESRPVADNSTEEGRQINRRVEAEV 310


>gi|330959642|gb|EGH59902.1| hypothetical protein PMA4326_13904 [Pseudomonas syringae pv.
           maculicola str. ES4326]
          Length = 220

 Score = 65.1 bits (157), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 38/113 (33%), Positives = 57/113 (50%), Gaps = 2/113 (1%)

Query: 71  MITCYIPVHVSFVS-EVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLI 129
           M+T   P  ++F +    L+      L  +A  L      ++ I  HTDS G+ + N L+
Sbjct: 106 MMTVQAPSDIAFATGSADLQPAAFQGLSAVANALKDQKDLMLNITGHTDSTGSRQFNNLL 165

Query: 130 SQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           S  RA  +  YL   GV + + I+VRG     P+ T+ T  GR  N+R+EIQI
Sbjct: 166 SYARAQAVAQYLYAAGVPA-QVIAVRGVGPSMPVATDATSQGRAQNRRVEIQI 217


>gi|188995861|ref|YP_001930113.1| immunoreactive 23 kDa antigen [Porphyromonas gingivalis ATCC 33277]
 gi|188595541|dbj|BAG34516.1| immunoreactive 23 kDa antigen [Porphyromonas gingivalis ATCC 33277]
          Length = 223

 Score = 65.1 bits (157), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 44/143 (30%), Positives = 66/143 (46%), Gaps = 2/143 (1%)

Query: 43  FGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVS-EVFLEKKFLPMLQLIAT 101
            G  +DK + E +  + D  I     G+ I       + F +    L       L   A 
Sbjct: 68  IGKKMDKQKKELEAAVPDATIQTVNDGEAILVTFDSGILFATNSSTLSPNSRTALTKFAA 127

Query: 102 ILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKY 161
            +NK P T I I  HTD+ G+ K N  +S+ RA  + S+L  +GVS +R ++  G     
Sbjct: 128 NMNKNPDTDIRIVGHTDNTGSDKINDPLSERRAASVYSFLNSQGVSMSR-MAAEGRGSHE 186

Query: 162 PIDTNDTKVGRQNNQRIEIQIFP 184
           P+  N T  GR  N+R+E+ I P
Sbjct: 187 PVADNSTVAGRSANRRVEVYILP 209


>gi|262368251|ref|ZP_06061580.1| inner membrane lipoprotein yiaD [Acinetobacter johnsonii SH046]
 gi|262315929|gb|EEY96967.1| inner membrane lipoprotein yiaD [Acinetobacter johnsonii SH046]
          Length = 254

 Score = 65.1 bits (157), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 51/89 (57%), Gaps = 1/89 (1%)

Query: 95  MLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISV 154
           +L  +A  LNK     + I  HTDS G +  NL +S+ERA  +K+YLI + +++ R +SV
Sbjct: 167 ILDEMAVALNKVGGKKVKIIGHTDSSGDVAKNLALSKERAVAVKNYLINKSIAAER-LSV 225

Query: 155 RGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
            G     P+  N T  GR+ N+RIE  + 
Sbjct: 226 EGLGSNKPVADNATADGRKKNRRIEFDVI 254


>gi|149908775|ref|ZP_01897435.1| hypothetical protein PE36_21279 [Moritella sp. PE36]
 gi|149808049|gb|EDM67990.1| hypothetical protein PE36_21279 [Moritella sp. PE36]
          Length = 284

 Score = 64.7 bits (156), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 30/77 (38%), Positives = 51/77 (66%), Gaps = 1/77 (1%)

Query: 109 TVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDT 168
           T + I  H++SIG   NNLL+SQ+RAD +  YL++ G+S+ + + VR    +YP+ ++ T
Sbjct: 206 TKVLIDGHSNSIGNTVNNLLLSQQRADDVYMYLMEAGIST-KLMEVRSHGDRYPLKSDRT 264

Query: 169 KVGRQNNQRIEIQIFPR 185
             GR+ N+R+ ++I  R
Sbjct: 265 ASGREKNRRVNLRIIRR 281


>gi|146300076|ref|YP_001194667.1| OmpA/MotB domain-containing protein [Flavobacterium johnsoniae
           UW101]
 gi|146154494|gb|ABQ05348.1| OmpA/MotB domain protein [Flavobacterium johnsoniae UW101]
          Length = 727

 Score = 64.7 bits (156), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 32/85 (37%), Positives = 48/85 (56%), Gaps = 1/85 (1%)

Query: 96  LQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVR 155
           L  I  IL  +P+   AI  HTD++G  K N  +S++RA V+   LI++GV+     S +
Sbjct: 638 LDAIKEILKNYPNAKFAINGHTDNVGNAKVNQKLSEQRAKVVMDLLIEKGVNPANLTS-K 696

Query: 156 GFAYKYPIDTNDTKVGRQNNQRIEI 180
           G+    P+ +N T  GR  N+R EI
Sbjct: 697 GYGASKPVKSNKTASGRAENRRTEI 721


>gi|34541639|ref|NP_906118.1| lipoprotein PG3 [Porphyromonas gingivalis W83]
 gi|5081699|gb|AAD39495.1|AF145799_1 immunogenic 23 kDa lipoprotein PG3 [Porphyromonas gingivalis]
 gi|34397957|gb|AAQ67017.1| lipoprotein PG3 [Porphyromonas gingivalis W83]
          Length = 223

 Score = 64.7 bits (156), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 44/143 (30%), Positives = 66/143 (46%), Gaps = 2/143 (1%)

Query: 43  FGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVS-EVFLEKKFLPMLQLIAT 101
            G  +DK + E +  + D  I     G+ I       + F +    L       L   A 
Sbjct: 68  IGKKMDKQKKELEAAVPDATIQTVNDGEAILVTFDSGILFATNSSTLSPNSRTALTKFAA 127

Query: 102 ILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKY 161
            +NK P T I I  HTD+ G+ K N  +S+ RA  + S+L  +GVS +R ++  G     
Sbjct: 128 NMNKNPDTDIRIVGHTDNTGSDKINDPLSERRAASVYSFLNSQGVSMSR-MAAEGRGSHE 186

Query: 162 PIDTNDTKVGRQNNQRIEIQIFP 184
           P+  N T  GR  N+R+E+ I P
Sbjct: 187 PVADNSTVAGRSANRRVEVYILP 209


>gi|88857596|ref|ZP_01132239.1| probable outer membrane protein [Pseudoalteromonas tunicata D2]
 gi|88820793|gb|EAR30605.1| probable outer membrane protein [Pseudoalteromonas tunicata D2]
          Length = 293

 Score = 64.7 bits (156), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 38/85 (44%), Positives = 50/85 (58%), Gaps = 1/85 (1%)

Query: 96  LQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVR 155
           L  +AT LN      I I+ HTD+IG+ K NLL+SQ RAD IK YLI +GV+  R I   
Sbjct: 203 LAKLATFLNTNIDRNITIEGHTDNIGSKKFNLLLSQRRADSIKDYLIGQGVARGR-IQTS 261

Query: 156 GFAYKYPIDTNDTKVGRQNNQRIEI 180
           G     P+  N T   R+ N+R+E+
Sbjct: 262 GKGISLPVIDNTTADHREQNRRVEV 286


>gi|325524318|gb|EGD02423.1| OOP family OmpA-OmpF porin [Burkholderia sp. TJI49]
          Length = 254

 Score = 64.7 bits (156), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 49/88 (55%), Gaps = 1/88 (1%)

Query: 95  MLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISV 154
           +L  +A  L K P+  + I  HTD+ G   +N+ +SQ RAD +K YLI + ++  +  + 
Sbjct: 166 ILDQMAAALAKMPNRTVDIIGHTDNSGNRTSNIALSQARADAVKGYLITKSIAPQQMTTT 225

Query: 155 RGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
            G     PI  NDT  GR  N+RIE ++
Sbjct: 226 -GVGPDQPIAPNDTAEGRARNRRIEFRV 252


>gi|170696413|ref|ZP_02887541.1| OmpA/MotB domain protein [Burkholderia graminis C4D1M]
 gi|170138674|gb|EDT06874.1| OmpA/MotB domain protein [Burkholderia graminis C4D1M]
          Length = 322

 Score = 64.7 bits (156), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 33/83 (39%), Positives = 49/83 (59%), Gaps = 2/83 (2%)

Query: 97  QLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRG 156
           Q+ A +L K  +  +AI  HTD+ G   +N+ +SQ RAD +K YL+ +G+   + +S  G
Sbjct: 237 QMAAAML-KMATKTVAIIGHTDNSGNRTSNIALSQARADAVKGYLVAKGIPPQQ-MSTTG 294

Query: 157 FAYKYPIDTNDTKVGRQNNQRIE 179
                PI +NDT  GR  N+RIE
Sbjct: 295 VGPDQPIASNDTADGRARNRRIE 317


>gi|66967954|gb|AAY59422.1| outer membrane protein A [Allochromatium vinosum]
          Length = 225

 Score = 64.7 bits (156), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 34/93 (36%), Positives = 51/93 (54%), Gaps = 1/93 (1%)

Query: 92  FLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRF 151
           F   L+ I+ I+ K+  T +A+  HTDS G    N  +S+ RA  +  YL + GV   R 
Sbjct: 130 FYSTLEKISAIVRKYGKTQLAVSGHTDSTGAAAYNQTLSERRAASVGYYLERSGVLPQRI 189

Query: 152 ISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
            S  G+    PI +N T+ GR+ N+R++I I P
Sbjct: 190 YSA-GYGMNQPIASNATEDGRRLNRRVDILIMP 221


>gi|284032832|ref|YP_003382763.1| OmpA/MotB domain-containing protein [Kribbella flavida DSM 17836]
 gi|283812125|gb|ADB33964.1| OmpA/MotB domain protein [Kribbella flavida DSM 17836]
          Length = 327

 Score = 64.7 bits (156), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 30/84 (35%), Positives = 51/84 (60%), Gaps = 1/84 (1%)

Query: 99  IATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFA 158
           +A +L    +  + +  HTD++G    +L +SQ RAD +K+ L++ GV + R IS RG+ 
Sbjct: 244 VAALLRTCGTARVELAGHTDNLGDPSTSLPLSQRRADAVKATLVRLGVPAGRIIS-RGYG 302

Query: 159 YKYPIDTNDTKVGRQNNQRIEIQI 182
              P+ +N T  GR  N+R+EI++
Sbjct: 303 EFEPVASNRTSAGRIANRRVEIRV 326


>gi|288940353|ref|YP_003442593.1| OmpA/MotB domain-containing protein [Allochromatium vinosum DSM
           180]
 gi|288895725|gb|ADC61561.1| OmpA/MotB domain protein [Allochromatium vinosum DSM 180]
          Length = 608

 Score = 64.7 bits (156), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 34/93 (36%), Positives = 50/93 (53%), Gaps = 1/93 (1%)

Query: 93  LPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFI 152
           L  L+ IA +L   P     I+ HTDS+G+   N  +S +RA+ ++  L++RGV   R +
Sbjct: 516 LASLERIAELLKAHPELTARIEGHTDSLGSAALNQSLSLQRAEAVRQALVERGVDGGR-L 574

Query: 153 SVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPR 185
           S  G     PI  N T  GR  N+R+E+ I  R
Sbjct: 575 SAEGLGPTRPIADNATAEGRGKNRRVEVYILDR 607


>gi|257463423|ref|ZP_05627818.1| Outer membrane porin F [Fusobacterium sp. D12]
 gi|317060987|ref|ZP_07925472.1| outer membrane porin F [Fusobacterium sp. D12]
 gi|313686663|gb|EFS23498.1| outer membrane porin F [Fusobacterium sp. D12]
          Length = 193

 Score = 64.7 bits (156), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 50/186 (26%), Positives = 87/186 (46%), Gaps = 10/186 (5%)

Query: 1   MIKELGLSMFIMT-TISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQ--MQ 57
           M K LG+++ + +  ++ CG  S    +    + N    +       +D A+   +  + 
Sbjct: 11  MKKYLGMTVLLASFVLAACGKTSNTSVRDLSTEGNQNFAI-----EDIDTAKKPLEDIIV 65

Query: 58  LQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFL-PMLQLIATILNKFPSTVIAIQSH 116
               G+ + R G+ +   +P  + F  + +  K  + P L+ +A  L       I I  +
Sbjct: 66  FNQDGVTIRREGNNLILSMPELILFDFDKYEVKDGIKPSLRTLANALGANSDIKIKIDGY 125

Query: 117 TDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQ 176
           TD IG+   NL +S  RA  IKSYL+  G   N  IS+ G+  + P+ +N T+ GR  N+
Sbjct: 126 TDFIGSEGYNLELSVNRAKAIKSYLVNHGAIENN-ISIEGYGKQNPVASNATESGRARNR 184

Query: 177 RIEIQI 182
           R+E  I
Sbjct: 185 RVEFII 190


>gi|110637965|ref|YP_678172.1| OmpA family outer membrane protein [Cytophaga hutchinsonii ATCC
           33406]
 gi|110280646|gb|ABG58832.1| outer membrane protein, OmpA family [Cytophaga hutchinsonii ATCC
           33406]
          Length = 641

 Score = 64.7 bits (156), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 39/101 (38%), Positives = 56/101 (55%), Gaps = 1/101 (0%)

Query: 83  VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLI 142
           V++  L K+    L  +  IL+K P   I +  HTDS G  + NL +S  RA  +K YLI
Sbjct: 540 VNKSTLRKESETELDKLFDILSKNPKIKIEVAGHTDSDGDTQANLTLSDARAHTVKDYLI 599

Query: 143 QRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
            +G+S++R I V G     P+  NDT   +Q N+R EI+I 
Sbjct: 600 GKGISADRIIYV-GHGEGKPVVPNDTPENKQLNRRTEIKIL 639


>gi|85858730|ref|YP_460932.1| outer membrane porin protein [Syntrophus aciditrophicus SB]
 gi|85721821|gb|ABC76764.1| outer membrane porin protein [Syntrophus aciditrophicus SB]
          Length = 435

 Score = 64.7 bits (156), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 59/103 (57%), Gaps = 3/103 (2%)

Query: 78  VHVSFVSEVF-LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADV 136
           +H+ F S+ + +E K+   +Q +A  +   P     +  HTDS  +   N  +SQ RA+ 
Sbjct: 329 LHILFASDKYNIEPKYDSEIQKVADYMKANPDVTAVVAGHTDSTHSNAYNKKLSQNRANA 388

Query: 137 IKSYLIQR-GVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRI 178
           +K+ L+++ G+ ++R  +V G+    PI TN TK GRQ N+R+
Sbjct: 389 VKTALVEKYGIDASRIEAV-GYGEDKPIATNKTKAGRQKNRRV 430


>gi|256820114|ref|YP_003141393.1| OmpA/MotB domain-containing protein [Capnocytophaga ochracea DSM
           7271]
 gi|256581697|gb|ACU92832.1| OmpA/MotB domain protein [Capnocytophaga ochracea DSM 7271]
          Length = 456

 Score = 64.7 bits (156), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 54/88 (61%), Gaps = 1/88 (1%)

Query: 95  MLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISV 154
           +L  I  +LN++ +   +I+ +TD  G    N  +S+ RA  +K+YLI++G+   R ++ 
Sbjct: 368 VLNQIVDVLNQYKNAKFSIEGYTDISGKRDKNQKLSENRAYSVKAYLIEKGIDEGR-LTA 426

Query: 155 RGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           +GF    PI +N TK GR+ N+R+EI +
Sbjct: 427 KGFGPDKPIASNKTKKGRELNRRVEINL 454


>gi|148652893|ref|YP_001279986.1| OmpA/MotB domain-containing protein [Psychrobacter sp. PRwf-1]
 gi|148571977|gb|ABQ94036.1| OmpA/MotB domain protein [Psychrobacter sp. PRwf-1]
          Length = 314

 Score = 64.7 bits (156), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 49/84 (58%), Gaps = 2/84 (2%)

Query: 96  LQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQR-GVSSNRFISV 154
           L  +A  +NK+PST+  I+ HTD   +   NL +SQ RAD +++  I    + SNR  ++
Sbjct: 225 LSEVADFMNKYPSTIATIEGHTDDRASDSYNLALSQRRADAVRNVFIHEFDIDSNRLKAI 284

Query: 155 RGFAYKYPIDTNDTKVGRQNNQRI 178
            G+    P  TNDT  GRQ N+R+
Sbjct: 285 -GYGESKPRATNDTAEGRQLNRRV 307


>gi|254465245|ref|ZP_05078656.1| OmpA/MotB [Rhodobacterales bacterium Y4I]
 gi|206686153|gb|EDZ46635.1| OmpA/MotB [Rhodobacterales bacterium Y4I]
          Length = 219

 Score = 64.7 bits (156), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 38/144 (26%), Positives = 72/144 (50%), Gaps = 2/144 (1%)

Query: 43  FGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSE-VFLEKKFLPMLQLIAT 101
            G+ LD  E E +  L +  I +   GD +    P  ++F ++   +       L+ +A 
Sbjct: 75  IGNQLDAQERELRQTLANDSITIVNTGDRLILSFPNDLTFATDSAAVAPAVQADLRRVAD 134

Query: 102 ILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKY 161
            L ++P++ I +  HTDS G    N  +S+ RA+ + S++   GV  +R + + G     
Sbjct: 135 SLVRYPNSAIQVIGHTDSDGDAGYNQGLSERRANAVASHIQAGGVPYHR-MRIIGRGESQ 193

Query: 162 PIDTNDTKVGRQNNQRIEIQIFPR 185
           P+ +N T  G+  N+R+E+ + P+
Sbjct: 194 PVASNLTPEGKARNRRVEVVVIPQ 217


>gi|254302748|ref|ZP_04970106.1| outer membrane protein OmpF [Fusobacterium nucleatum subsp.
           polymorphum ATCC 10953]
 gi|148322940|gb|EDK88190.1| outer membrane protein OmpF [Fusobacterium nucleatum subsp.
           polymorphum ATCC 10953]
          Length = 182

 Score = 64.7 bits (156), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 44/131 (33%), Positives = 68/131 (51%), Gaps = 5/131 (3%)

Query: 58  LQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFL-PMLQLIATILNKFPSTVIAIQSH 116
             + G+ + R G+ +   +P  + F  + +  K  + P L  +A  L +     I I  +
Sbjct: 55  FNEEGVTIRREGNNLILSMPELILFDFDKYAVKDGIKPSLSTLAKALGENKDIHIKIDGY 114

Query: 117 TDSIGTLKNNLLISQERADVIKSYLIQRG-VSSNRFISVRGFAYKYPIDTNDTKVGRQNN 175
           TD IGT   NL +S +RA  IK +LI +G + SN  IS+ G+  + P  TN T+ GR  N
Sbjct: 115 TDFIGTEAYNLDLSVKRARAIKDFLISKGAIGSN--ISIEGYGEQNPAATNQTEAGRSKN 172

Query: 176 QRIEIQIFPRG 186
           +R+E  I  RG
Sbjct: 173 RRVEF-IISRG 182


>gi|110640101|ref|YP_680311.1| outer membrane protein [Cytophaga hutchinsonii ATCC 33406]
 gi|110282782|gb|ABG60968.1| possible outer membrane protein [Cytophaga hutchinsonii ATCC 33406]
          Length = 670

 Score = 64.7 bits (156), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 31/90 (34%), Positives = 52/90 (57%), Gaps = 1/90 (1%)

Query: 94  PMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFIS 153
           P L  +  +L   P+  I +  HTD+ G    NL +S++R + +K+YL+ +G+ + R I+
Sbjct: 582 PELDRMVEVLKTNPTVRIELDGHTDNQGDAALNLALSEKRVETVKAYLVSKGIDNKR-IT 640

Query: 154 VRGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
            R F    PI  N+T+  R+ N+R+EI I 
Sbjct: 641 TRAFGGTKPIAPNNTEENRKKNRRVEIIIL 670


>gi|154247748|ref|YP_001418706.1| OmpA/MotB domain-containing protein [Xanthobacter autotrophicus
           Py2]
 gi|154161833|gb|ABS69049.1| OmpA/MotB domain protein [Xanthobacter autotrophicus Py2]
          Length = 729

 Score = 64.7 bits (156), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 30/92 (32%), Positives = 55/92 (59%), Gaps = 1/92 (1%)

Query: 95  MLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISV 154
           ++  +A  L + P+ ++ I  HTD +G  + N  +S+ RA+ + +YL+  GV+++R +S 
Sbjct: 638 LIDRLAVALKRCPTAMVRILGHTDGVGDAEFNKRLSEARANAVLAYLVTAGVTADR-LSA 696

Query: 155 RGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRG 186
            GF    P+  NDT+ G+  N+RIE ++  R 
Sbjct: 697 AGFGAGQPLAPNDTEAGKALNRRIEFEVKERA 728


>gi|326316785|ref|YP_004234457.1| OmpA/MotB domain-containing protein [Acidovorax avenae subsp.
           avenae ATCC 19860]
 gi|323373621|gb|ADX45890.1| OmpA/MotB domain protein [Acidovorax avenae subsp. avenae ATCC
           19860]
          Length = 219

 Score = 64.7 bits (156), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 51/85 (60%), Gaps = 2/85 (2%)

Query: 98  LIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGF 157
           L++ + N     +IA+  HTDSIGT   N  +S  RA+ +K+YL+ +G+  NR +   G 
Sbjct: 131 LVSKVKNVNLEVIIAV-GHTDSIGTDAYNQKLSVRRAEAVKAYLVSKGIEKNR-VYTEGK 188

Query: 158 AYKYPIDTNDTKVGRQNNQRIEIQI 182
             K PI  N TK GR  N+R+EI++
Sbjct: 189 GEKQPIADNKTKEGRAKNRRVEIEV 213


>gi|120611935|ref|YP_971613.1| OmpA/MotB domain-containing protein [Acidovorax citrulli AAC00-1]
 gi|120590399|gb|ABM33839.1| OmpA/MotB domain protein [Acidovorax citrulli AAC00-1]
          Length = 219

 Score = 64.7 bits (156), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 51/85 (60%), Gaps = 2/85 (2%)

Query: 98  LIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGF 157
           L++ + N     +IA+  HTDSIGT   N  +S  RA+ +K+YL+ +G+  NR +   G 
Sbjct: 131 LVSKVKNVNLEVIIAV-GHTDSIGTDAYNQKLSVRRAEAVKAYLVSKGIEKNR-VYTEGK 188

Query: 158 AYKYPIDTNDTKVGRQNNQRIEIQI 182
             K PI  N TK GR  N+R+EI++
Sbjct: 189 GEKQPIADNKTKEGRAKNRRVEIEV 213


>gi|91976354|ref|YP_569013.1| OmpA/MotB [Rhodopseudomonas palustris BisB5]
 gi|91682810|gb|ABE39112.1| OmpA/MotB [Rhodopseudomonas palustris BisB5]
          Length = 434

 Score = 64.7 bits (156), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 52/95 (54%), Gaps = 1/95 (1%)

Query: 88  LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVS 147
           +E+  LP+L+ +A ++   P+  I +  HTD+ G    N  +S+ RA+ +   L + G+ 
Sbjct: 340 IEQASLPVLKQLAAVIAHCPAAQIEVAGHTDANGKKAANEALSKRRAEAVADSLTKAGIG 399

Query: 148 SNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           S + I+V G+    P+  NDT   R  N+RIE  +
Sbjct: 400 SAKLIAV-GYGSAKPLGPNDTAEARAKNRRIEFAV 433


>gi|26987857|ref|NP_743282.1| OmpA/MotB domain protein [Pseudomonas putida KT2440]
 gi|148546400|ref|YP_001266502.1| OmpA/MotB domain-containing protein [Pseudomonas putida F1]
 gi|24982560|gb|AAN66746.1|AE016303_1 OmpA family protein [Pseudomonas putida KT2440]
 gi|148510458|gb|ABQ77318.1| OmpA/MotB domain protein [Pseudomonas putida F1]
 gi|313497483|gb|ADR58849.1| OmpA/MotB domain protein [Pseudomonas putida BIRD-1]
          Length = 230

 Score = 64.3 bits (155), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 34/88 (38%), Positives = 50/88 (56%), Gaps = 1/88 (1%)

Query: 96  LQLIATIL-NKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISV 154
           L  IAT L  + PS  +++  HTDS+G+   N  +S+ RA  +  YL++ GV  + F+SV
Sbjct: 141 LNTIATRLKQEAPSARLSVSGHTDSVGSDSYNQKLSERRAHSVTDYLVESGVPRSSFVSV 200

Query: 155 RGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
            G     P+  N T  GR  N+R EI+I
Sbjct: 201 VGAGETQPVADNATAEGRAMNRRTEIKI 228


>gi|302381938|ref|YP_003817761.1| OmpA/MotB domain protein [Brevundimonas subvibrioides ATCC 15264]
 gi|302192566|gb|ADL00138.1| OmpA/MotB domain protein [Brevundimonas subvibrioides ATCC 15264]
          Length = 356

 Score = 64.3 bits (155), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 41/126 (32%), Positives = 63/126 (50%), Gaps = 11/126 (8%)

Query: 60  DTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTV-IAIQSHTD 118
           D G VV+  GD+   +         +  +     P L  +A ++     T  IAI+ HTD
Sbjct: 218 DRGTVVALSGDVTFDF--------DQATIRPDARPTLDRLAELIQATGGTGRIAIEGHTD 269

Query: 119 SIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRI 178
           S GT   N  +S+ RA+ +K+YL+ RG S +R  ++ G     P   ND   GR+ N+R+
Sbjct: 270 SEGTDAYNHDLSERRAEAVKAYLVPRGTSGDRLEAM-GIGEARPAVANDDDAGRRRNRRV 328

Query: 179 EIQIFP 184
           E+ I P
Sbjct: 329 EV-ILP 333


>gi|4580974|gb|AAD24561.1|AF117969_1 OprF [Pseudomonas fluorescens]
          Length = 326

 Score = 64.3 bits (155), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 29/84 (34%), Positives = 50/84 (59%), Gaps = 1/84 (1%)

Query: 99  IATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFA 158
           +A  + ++P+T + +  HTDS+G    N  +SQ RAD +K  L++ GV+ +R  +V G+ 
Sbjct: 239 LADFMAQYPATNVEVAGHTDSVGPDAYNQKLSQRRADAVKQVLVKDGVAPSRITAV-GYG 297

Query: 159 YKYPIDTNDTKVGRQNNQRIEIQI 182
              P+  N T+ GR  N+R+E  +
Sbjct: 298 ESRPVADNATEAGRAVNRRVEASV 321


>gi|229592015|ref|YP_002874134.1| putative outer membrane porin A protein [Pseudomonas fluorescens
           SBW25]
 gi|229363881|emb|CAY51363.1| putative outer membrane porin A protein [Pseudomonas fluorescens
           SBW25]
          Length = 326

 Score = 64.3 bits (155), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 29/84 (34%), Positives = 50/84 (59%), Gaps = 1/84 (1%)

Query: 99  IATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFA 158
           +A  + ++P+T + +  HTDS+G    N  +SQ RAD +K  L++ GV+ +R  +V G+ 
Sbjct: 239 LADFMAQYPATNVEVAGHTDSVGPDAYNQKLSQRRADAVKQVLVKDGVAPSRITAV-GYG 297

Query: 159 YKYPIDTNDTKVGRQNNQRIEIQI 182
              P+  N T+ GR  N+R+E  +
Sbjct: 298 ESRPVADNATEAGRAVNRRVEASV 321


>gi|146337865|ref|YP_001202913.1| hypothetical protein BRADO0750 [Bradyrhizobium sp. ORS278]
 gi|146190671|emb|CAL74675.1| hypothetical protein; putative Outer membrane protein containing
           OmpA/MotB domain [Bradyrhizobium sp. ORS278]
          Length = 429

 Score = 64.3 bits (155), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 61/109 (55%), Gaps = 3/109 (2%)

Query: 74  CYIPVH-VSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQ 131
           C++P++ V F  ++  L+ +  P+L  +A ++   P     I+ HTD++G    N+ +S 
Sbjct: 315 CHLPLYGVLFDFNKASLKPESEPLLTKVAALVTARPDLNAEIEGHTDNVGGDDYNMRLSD 374

Query: 132 ERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEI 180
            RA  ++++L Q GV++ R  S  G+    P+  N T  GR  N+R+EI
Sbjct: 375 ARAASVRTWLTQHGVAAARLTS-HGYGKTRPVADNGTDQGRALNRRVEI 422


>gi|114767081|ref|ZP_01445964.1| OmpA domain protein [Pelagibaca bermudensis HTCC2601]
 gi|114540734|gb|EAU43800.1| OmpA domain protein [Roseovarius sp. HTCC2601]
          Length = 310

 Score = 64.3 bits (155), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 31/89 (34%), Positives = 51/89 (57%), Gaps = 1/89 (1%)

Query: 96  LQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVR 155
           L  IA  L + P   +    HTD+ G+L+ N+ +S+ RAD    Y+  +GV++ +  S  
Sbjct: 221 LDAIAAYLAETPDRRVLFVGHTDATGSLEANIAVSRARADAAMDYVRGKGVAAAQLGS-E 279

Query: 156 GFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           G  Y  P+ +N T+VGR+ N+R+E  + P
Sbjct: 280 GAGYLAPVASNLTEVGREENRRVEAILLP 308


>gi|220905238|ref|YP_002480550.1| OmpA/MotB domain-containing protein [Desulfovibrio desulfuricans
           subsp. desulfuricans str. ATCC 27774]
 gi|219869537|gb|ACL49872.1| OmpA/MotB domain protein [Desulfovibrio desulfuricans subsp.
           desulfuricans str. ATCC 27774]
          Length = 331

 Score = 64.3 bits (155), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 43/139 (30%), Positives = 77/139 (55%), Gaps = 16/139 (11%)

Query: 45  SSLDKAEDEFQMQL--QDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATI 102
           ++ D A + F + +  QD  ++V R          VH +F S   L+ K + +L   A +
Sbjct: 203 ATSDAALERFVLSVFCQDEDVIVLR---------GVHFAFNSYA-LDGKAMGILNEAAGL 252

Query: 103 LNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISV-RGFAYKY 161
           +   P+  + +   TD IG+   N+ +SQERA+ +K+YL+++G+ ++R  ++ RG ++KY
Sbjct: 253 IKANPNKRVVLAGWTDWIGSDAYNMKLSQERANSVKNYLVKQGIPASRMTAIGRGKSFKY 312

Query: 162 PIDTNDTKVGRQNNQRIEI 180
               N+T  GR  N+R EI
Sbjct: 313 ---NNETAEGRAMNRRTEI 328


>gi|302326566|gb|ADL25767.1| OmpA family protein [Fibrobacter succinogenes subsp. succinogenes
           S85]
          Length = 215

 Score = 64.3 bits (155), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 61/103 (59%), Gaps = 1/103 (0%)

Query: 83  VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLI 142
           V    L+   +  L  IA IL+ +    ++I+ +TD+ G+ + N+ +SQ+RA+ +  +L+
Sbjct: 109 VGRATLKTDLMTSLAKIAGILSVYQQFDVSIEGNTDNTGSEEFNMTLSQQRAENVMKFLV 168

Query: 143 QRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPR 185
           ++G++  R ++ +G     PI  N TK GRQ N+R+++ I  R
Sbjct: 169 EQGIAETR-LTAKGLGMTMPIADNSTKEGRQKNRRVDLVITDR 210


>gi|116330986|ref|YP_800704.1| endoflagellar motor protein [Leptospira borgpetersenii serovar
           Hardjo-bovis JB197]
 gi|116124675|gb|ABJ75946.1| Endoflagellar motor protein [Leptospira borgpetersenii serovar
           Hardjo-bovis JB197]
          Length = 340

 Score = 64.3 bits (155), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 42/149 (28%), Positives = 73/149 (48%), Gaps = 5/149 (3%)

Query: 42  RFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVS-EVFLEKKFLPMLQLIA 100
           R     ++ E++   +++   I + R  + +   I   +SF S    L+K+ LP L  I 
Sbjct: 192 RLADQANELENKLGDEIKKGQIRLKRFHNRLVINIDDRISFDSGSAELKKQILPALDKIK 251

Query: 101 TILNKFPSTVIAIQSHTDSIG----TLKNNLLISQERADVIKSYLIQRGVSSNRFISVRG 156
            IL  +P  +I I+ HTD++        +N  +S ERA  +  Y ++  +   R  S+ G
Sbjct: 252 EILGNYPGNLIIIEGHTDNVPIRTRKFSDNWQLSGERALSVLHYFLESKILDPRNFSLAG 311

Query: 157 FAYKYPIDTNDTKVGRQNNQRIEIQIFPR 185
           +    PI +NDT   R  N+R++I + PR
Sbjct: 312 YGEFQPIVSNDTPENRALNRRVDIVVVPR 340


>gi|284039059|ref|YP_003388989.1| OmpA/MotB domain protein [Spirosoma linguale DSM 74]
 gi|283818352|gb|ADB40190.1| OmpA/MotB domain protein [Spirosoma linguale DSM 74]
          Length = 427

 Score = 64.3 bits (155), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 60/100 (60%), Gaps = 1/100 (1%)

Query: 83  VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLI 142
           VS+  L+ +  P L  + T++   P+  I ++ HTD++G    N+ +S+ R + +K YL+
Sbjct: 326 VSKYDLKPESYPELDRLVTVMRSNPTMQIRLEGHTDTVGEFDANVELSRNRVNEVKRYLV 385

Query: 143 QRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
            +G+S++R  +V G+    PI+TN +   R  N+R+E+ I
Sbjct: 386 DKGISASRIETV-GYGPSRPINTNKSLKERPENRRVEMVI 424


>gi|115523809|ref|YP_780720.1| OmpA/MotB domain-containing protein [Rhodopseudomonas palustris
           BisA53]
 gi|115517756|gb|ABJ05740.1| OmpA/MotB domain protein [Rhodopseudomonas palustris BisA53]
          Length = 446

 Score = 64.3 bits (155), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 53/94 (56%), Gaps = 3/94 (3%)

Query: 88  LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQR--G 145
           + K+ LP+L+ +  IL + P+  I +  HTD  G    N  +S+ RA+ + + L +   G
Sbjct: 350 ISKESLPVLEKLGAILVQCPAVTIEVAGHTDGGGKKAKNQALSERRAEAVVASLTKAKIG 409

Query: 146 VSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIE 179
           V S +  +V G+    PI +NDT  GR NN+RIE
Sbjct: 410 VGSAKLTAV-GYGSAKPIASNDTPEGRANNRRIE 442


>gi|148287120|emb|CAK36854.1| outer membrane protein A [Bordetella ansorpii]
          Length = 181

 Score = 64.3 bits (155), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 55/89 (61%), Gaps = 3/89 (3%)

Query: 95  MLQLIATILNKFP-STVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFIS 153
           +L  +A+ +N     T+IA+  HTDSIG+   N  +S+ RA  +KSYL+ +G+  NR I 
Sbjct: 90  LLDQVASQVNTINLETLIAV-GHTDSIGSDAYNQKLSERRAASVKSYLVSKGIDPNR-IY 147

Query: 154 VRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
             G   K P+ +N T+ GR  N+R+EI+I
Sbjct: 148 TEGKGEKQPVASNSTREGRAKNRRVEIEI 176


>gi|187919624|ref|YP_001888655.1| OmpA/MotB domain-containing protein [Burkholderia phytofirmans
           PsJN]
 gi|187718062|gb|ACD19285.1| OmpA/MotB domain protein [Burkholderia phytofirmans PsJN]
          Length = 320

 Score = 64.3 bits (155), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 32/85 (37%), Positives = 49/85 (57%), Gaps = 1/85 (1%)

Query: 95  MLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISV 154
           +L  +A  + K  +  +AI  HTD+ G   +N+ +SQ RAD +K YL+ +G+   + +S 
Sbjct: 232 ILDQMAAAMVKMTTKTVAIIGHTDNSGNRTSNIALSQARADAVKGYLVAKGIPPQQ-LST 290

Query: 155 RGFAYKYPIDTNDTKVGRQNNQRIE 179
            G     PI +NDT  GR  N+RIE
Sbjct: 291 TGVGPDQPIASNDTTDGRARNRRIE 315


>gi|116328262|ref|YP_797982.1| endoflagellar motor protein [Leptospira borgpetersenii serovar
           Hardjo-bovis L550]
 gi|116121006|gb|ABJ79049.1| Endoflagellar motor protein [Leptospira borgpetersenii serovar
           Hardjo-bovis L550]
          Length = 340

 Score = 64.3 bits (155), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 42/149 (28%), Positives = 73/149 (48%), Gaps = 5/149 (3%)

Query: 42  RFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVS-EVFLEKKFLPMLQLIA 100
           R     ++ E++   +++   I + R  + +   I   +SF S    L+K+ LP L  I 
Sbjct: 192 RLADQANELENKLGDEIKKGQIRLKRFHNRLVINIDDRISFDSGSAELKKQILPALDKIK 251

Query: 101 TILNKFPSTVIAIQSHTDSIG----TLKNNLLISQERADVIKSYLIQRGVSSNRFISVRG 156
            IL  +P  +I I+ HTD++        +N  +S ERA  +  Y ++  +   R  S+ G
Sbjct: 252 EILGNYPGNLIIIEGHTDNVPIRTRKFSDNWQLSGERALSVLHYFLESKILDPRNFSLAG 311

Query: 157 FAYKYPIDTNDTKVGRQNNQRIEIQIFPR 185
           +    PI +NDT   R  N+R++I + PR
Sbjct: 312 YGEFQPIVSNDTPENRALNRRVDIVVVPR 340


>gi|49079216|gb|AAT49867.1| PA1041 [synthetic construct]
          Length = 211

 Score = 64.3 bits (155), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 48/83 (57%)

Query: 104 NKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPI 163
            +  ST ++I  HTDS+G+   N  +S+ RA+ + +YLI  GV S+  + V+G     P+
Sbjct: 129 GEAASTRLSITGHTDSVGSDAYNQKLSERRANAVANYLIDAGVPSSIIVGVQGLGESQPV 188

Query: 164 DTNDTKVGRQNNQRIEIQIFPRG 186
             N T+ GR  N+R+EI I   G
Sbjct: 189 ADNKTREGRAENRRVEILIKREG 211


>gi|312962474|ref|ZP_07776965.1| Outer membrane porin F [Pseudomonas fluorescens WH6]
 gi|311283401|gb|EFQ61991.1| Outer membrane porin F [Pseudomonas fluorescens WH6]
          Length = 326

 Score = 64.3 bits (155), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 29/84 (34%), Positives = 50/84 (59%), Gaps = 1/84 (1%)

Query: 99  IATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFA 158
           +A  + ++P+T + +  HTDS+G    N  +SQ RAD +K  L++ GV+ +R  +V G+ 
Sbjct: 239 LADFMAQYPATNVEVAGHTDSVGPDAYNQKLSQRRADAVKQVLVKDGVAPSRVTAV-GYG 297

Query: 159 YKYPIDTNDTKVGRQNNQRIEIQI 182
              P+  N T+ GR  N+R+E  +
Sbjct: 298 ESRPVADNATEAGRAVNRRVEASV 321


>gi|218961893|ref|YP_001741668.1| hypothetical protein; putative signal peptide [Candidatus
           Cloacamonas acidaminovorans]
 gi|167730550|emb|CAO81462.1| hypothetical protein; putative signal peptide [Candidatus
           Cloacamonas acidaminovorans]
          Length = 911

 Score = 64.3 bits (155), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 55/96 (57%), Gaps = 1/96 (1%)

Query: 88  LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVS 147
           L  K L +L+ I   + +  +  I +  HTD+IG+ + N  +S+ RA  +  YLI+ G+ 
Sbjct: 697 LTPKSLEILKPILATMKENETLEIELSGHTDNIGSKQYNRKLSEARAKAVADYLIKNGID 756

Query: 148 SNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
             R  +V G+ +  PI +NDT  GRQ N+R E++I 
Sbjct: 757 PKRIKTV-GYGFDKPIASNDTPEGRQRNRRTEMKIL 791


>gi|124003367|ref|ZP_01688217.1| outer membrane protein [Microscilla marina ATCC 23134]
 gi|123991465|gb|EAY30896.1| outer membrane protein [Microscilla marina ATCC 23134]
          Length = 116

 Score = 64.3 bits (155), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 49/88 (55%), Gaps = 1/88 (1%)

Query: 96  LQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVR 155
           L  +   L + P     I  HTD+IG    N  +SQ+RA+ ++ YL+  GV ++R +  +
Sbjct: 25  LDNLVKFLKENPEISGEISGHTDNIGDKARNRELSQQRANSVRDYLVSHGVDASRLV-YK 83

Query: 156 GFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
           G+    P  TNDT+ GR  N+RIE +I 
Sbjct: 84  GYGDSKPAATNDTEEGRAKNRRIEFKIL 111


>gi|323345464|ref|ZP_08085687.1| lipoprotein PG3 [Prevotella oralis ATCC 33269]
 gi|323093578|gb|EFZ36156.1| lipoprotein PG3 [Prevotella oralis ATCC 33269]
          Length = 229

 Score = 64.3 bits (155), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 52/89 (58%)

Query: 96  LQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVR 155
           L   +T+L K     + I  HTDS G    N+ +S +RA  + +YL   GVS+++F +V 
Sbjct: 127 LAKFSTVLKKNADCYVDIYGHTDSTGNDGINIPLSNQRAQSVVAYLENCGVSASQFKNVV 186

Query: 156 GFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           G     P+ +NDTK GRQ N+R+E+ ++ 
Sbjct: 187 GKGSSDPVASNDTKSGRQLNRRVEVYMYA 215


>gi|120435967|ref|YP_861653.1| OmpA/MotB family outer membrane protein [Gramella forsetii KT0803]
 gi|117578117|emb|CAL66586.1| OmpA/MotB family outer membrane protein [Gramella forsetii KT0803]
          Length = 235

 Score = 64.3 bits (155), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 67/139 (48%), Gaps = 4/139 (2%)

Query: 55  QMQLQDTGIVVSRIGDMITCYI--PVHVSFVSEVF-LEKKFLPMLQLIATILNKFPSTVI 111
           Q++ +  G  V R+G+ I         V F +E + +  K    L  +A I  ++P + +
Sbjct: 85  QIEEEIPGAEVERVGEGINVTFDESSGVYFDTEKYNINAKSQTTLNKLADIFKEYPQSNV 144

Query: 112 AIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVG 171
            ++ HTD  G+   NL +S+ RA  +  YL+  G+   RF + + +    P   N T  G
Sbjct: 145 LVEGHTDDTGSDSYNLTLSKNRAQAVTGYLVDNGIDRGRF-TTKWYGESQPKYDNTTADG 203

Query: 172 RQNNQRIEIQIFPRGNIKK 190
           R  N+R+E+ I     +K+
Sbjct: 204 RSKNRRVELAIVANEELKE 222


>gi|325300740|ref|YP_004260656.1| OmpA/MotB domain-containing protein [Bacteroides salanitronis DSM
           18170]
 gi|324320293|gb|ADY38183.1| OmpA/MotB domain protein [Bacteroides salanitronis DSM 18170]
          Length = 209

 Score = 64.3 bits (155), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 54/93 (58%), Gaps = 1/93 (1%)

Query: 88  LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVS 147
           L K    +L  +  I+N+ P+T I +  HTD+IG    N+L+SQ RA  + +YL   G+ 
Sbjct: 112 LNKNAKSILDEMIGIINEIPNTKIKVIGHTDNIGEKGYNILLSQNRAAAVGNYLRNAGIE 171

Query: 148 SNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEI 180
           + + I+  G  +  P+ +N T+ GR  N+R+EI
Sbjct: 172 T-KNITEEGKGFDEPVSSNKTEAGRAKNRRVEI 203


>gi|15596238|ref|NP_249732.1| outer membrane protein precursor [Pseudomonas aeruginosa PAO1]
 gi|116048969|ref|YP_792229.1| hypothetical protein PA14_50880 [Pseudomonas aeruginosa UCBPP-PA14]
 gi|152988234|ref|YP_001349691.1| hypothetical protein PSPA7_4338 [Pseudomonas aeruginosa PA7]
 gi|218892997|ref|YP_002441866.1| putative outer membrane protein precursor [Pseudomonas aeruginosa
           LESB58]
 gi|254234177|ref|ZP_04927500.1| hypothetical protein PACG_00011 [Pseudomonas aeruginosa C3719]
 gi|254239398|ref|ZP_04932720.1| hypothetical protein PA2G_00011 [Pseudomonas aeruginosa 2192]
 gi|296390597|ref|ZP_06880072.1| putative outer membrane protein precursor [Pseudomonas aeruginosa
           PAb1]
 gi|313105992|ref|ZP_07792253.1| putative outer membrane protein precursor [Pseudomonas aeruginosa
           39016]
 gi|9946954|gb|AAG04430.1|AE004536_9 probable outer membrane protein precursor [Pseudomonas aeruginosa
           PAO1]
 gi|115584190|gb|ABJ10205.1| probable outer membrane protein precursor [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|126166108|gb|EAZ51619.1| hypothetical protein PACG_00011 [Pseudomonas aeruginosa C3719]
 gi|126192776|gb|EAZ56839.1| hypothetical protein PA2G_00011 [Pseudomonas aeruginosa 2192]
 gi|150963392|gb|ABR85417.1| probable outer membrane protein [Pseudomonas aeruginosa PA7]
 gi|218773225|emb|CAW29037.1| probable outer membrane protein precursor [Pseudomonas aeruginosa
           LESB58]
 gi|310878755|gb|EFQ37349.1| putative outer membrane protein precursor [Pseudomonas aeruginosa
           39016]
          Length = 210

 Score = 64.3 bits (155), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 30/79 (37%), Positives = 47/79 (59%)

Query: 104 NKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPI 163
            +  ST ++I  HTDS+G+   N  +S+ RA+ + +YLI  GV S+  + V+G     P+
Sbjct: 129 GEAASTRLSITGHTDSVGSDAYNQKLSERRANAVANYLIDAGVPSSIIVGVQGLGESQPV 188

Query: 164 DTNDTKVGRQNNQRIEIQI 182
             N T+ GR  N+R+EI I
Sbjct: 189 ADNKTREGRAENRRVEILI 207


>gi|237756911|ref|ZP_04585384.1| putative OmpA/MotB domain protein [Sulfurihydrogenibium
           yellowstonense SS-5]
 gi|237690932|gb|EEP60067.1| putative OmpA/MotB domain protein [Sulfurihydrogenibium
           yellowstonense SS-5]
          Length = 260

 Score = 64.3 bits (155), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 38/107 (35%), Positives = 62/107 (57%), Gaps = 2/107 (1%)

Query: 77  PVHVSFVSEVF-LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERAD 135
           PV + F S    ++K++LP L ++A  L   P   + I+ +TD+IG+ K N  ++ +RA+
Sbjct: 150 PVRIHFYSNSSKIKKEYLPYLNVVAKYLKTHPDVKVKIKGYTDNIGSKKYNDKLALKRAE 209

Query: 136 VIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
            +K YLI+ GVS NR I + G      I +N+ ++ R  N+R E  I
Sbjct: 210 AVKQYLIKLGVSPNR-IMIDGVGKSEYIVSNNNELDRFTNRRAEFYI 255


>gi|223039024|ref|ZP_03609315.1| outer membrane fibronectin-binding protein [Campylobacter rectus
           RM3267]
 gi|222879663|gb|EEF14753.1| outer membrane fibronectin-binding protein [Campylobacter rectus
           RM3267]
          Length = 293

 Score = 64.3 bits (155), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 37/124 (29%), Positives = 68/124 (54%), Gaps = 3/124 (2%)

Query: 61  TGIVVSRIG-DMITCYIPVHVSFVSEVF-LEKKFLPMLQLIATILNKFPSTVIAIQSHTD 118
            G+VV   G + +     + V+F  + + +  K+L  ++ +A  + + P   I +  HTD
Sbjct: 169 AGVVVDETGCEKVIFLRDLDVNFAFDSYKITPKYLEEIKKVAMFMGENPGYRIVLSGHTD 228

Query: 119 SIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRI 178
           S+GT   N  +S++RA+ +   L + GVS+++  ++ G+    PI TN TK GR  N+R+
Sbjct: 229 SVGTEAYNQKLSEKRANAVAKALEELGVSADKITAI-GYGELKPIATNKTKEGRAENRRV 287

Query: 179 EIQI 182
           E + 
Sbjct: 288 EARF 291


>gi|157889006|dbj|BAF80954.1| fibronectin-binding protein [Campylobacter lari]
          Length = 328

 Score = 64.3 bits (155), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 35/122 (28%), Positives = 63/122 (51%), Gaps = 2/122 (1%)

Query: 62  GIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIG 121
           G ++  IG   T  +  +  F  ++ +  +F   +Q +  +L + P     ++ HTDS G
Sbjct: 206 GALLDHIGCEKTIALEGYFGF-DQISINPEFAQKIQEVGKVLEENPQYYTILEGHTDSTG 264

Query: 122 TLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQ 181
           +   N  +S ERA  +   L + GV+  + I+ +G+ +  P  +NDTK GR  N+R+E +
Sbjct: 265 SKVYNQKLSLERAKAVAKELEKSGVAKEK-IAAKGYGFDKPKASNDTKEGRAQNRRVEAK 323

Query: 182 IF 183
            F
Sbjct: 324 FF 325


>gi|146344294|ref|YP_001202150.1| hypothetical protein pQBR0404 [Pseudomonas fluorescens SBW25]
 gi|146188106|emb|CAM96436.1| hypothetical protein pQBR0404 [Pseudomonas fluorescens SBW25]
          Length = 220

 Score = 64.3 bits (155), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 38/113 (33%), Positives = 56/113 (49%), Gaps = 2/113 (1%)

Query: 71  MITCYIPVHVSFV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLI 129
           M+T   P  ++F  +   L+      L  IAT L       + I  HTD  G+ + N ++
Sbjct: 106 MMTIEAPADIAFATASADLQPAAFQGLSAIATALKDQKDLRLEITGHTDGTGSRQFNNVL 165

Query: 130 SQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           S  RA  +  YL   GV + + I+VRG     P+ T+ T  GR  N+R+EIQI
Sbjct: 166 SYARAQAVAQYLYAAGVPA-QVIAVRGVGPSMPVATDATTQGRAQNRRVEIQI 217


>gi|221209294|ref|ZP_03582275.1| OmpA/MotB domain protein [Burkholderia multivorans CGD1]
 gi|221169982|gb|EEE02448.1| OmpA/MotB domain protein [Burkholderia multivorans CGD1]
          Length = 220

 Score = 64.3 bits (155), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 34/111 (30%), Positives = 57/111 (51%), Gaps = 8/111 (7%)

Query: 79  HVSFVSEVFLEKKFLPMLQLIATILNKF-------PSTVIAIQSHTDSIGTLKNNLLISQ 131
           HVS   +         +       L+K          T +++  +TDS+G+  +NL +S+
Sbjct: 109 HVSLAGDALFASGLATLTPAARASLDKLLNAYGDRSYTQVSVTGYTDSVGSDASNLALSK 168

Query: 132 ERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
            RA+ + +YL QRG+++ R ++V G     PI TN T  GR  N+R+EI +
Sbjct: 169 RRAEAVAAYLQQRGLNA-RTLTVTGRGSADPIATNATAEGRATNRRVEISL 218


>gi|330815362|ref|YP_004359067.1| OmpA/MotB [Burkholderia gladioli BSR3]
 gi|327367755|gb|AEA59111.1| OmpA/MotB [Burkholderia gladioli BSR3]
          Length = 345

 Score = 64.3 bits (155), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 51/88 (57%), Gaps = 1/88 (1%)

Query: 95  MLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISV 154
           +L  +A  ++K  +  + I  HTD+ G    N+ +SQ RAD +K YL+ +G++S +  + 
Sbjct: 257 ILDQMADAMSKLANRQVTIIGHTDNSGNRATNISLSQARADAVKGYLVAKGIASQQLTTT 316

Query: 155 RGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
            G     PI +NDT  GR  N+RIE ++
Sbjct: 317 -GVGPDQPIASNDTADGRARNRRIEFRV 343


>gi|4580970|gb|AAD24557.1|AF117965_1 OprF [Pseudomonas marginalis pv. marginalis]
          Length = 321

 Score = 64.3 bits (155), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 29/84 (34%), Positives = 50/84 (59%), Gaps = 1/84 (1%)

Query: 99  IATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFA 158
           +A  + ++P+T + +  HTDS+G    N  +SQ RAD +K  L++ GV+ +R  +V G+ 
Sbjct: 239 LADFMAQYPATNVEVAGHTDSVGPDAYNQKLSQRRADAVKQVLVKDGVAPSRVTAV-GYG 297

Query: 159 YKYPIDTNDTKVGRQNNQRIEIQI 182
              P+  N T+ GR  N+R+E  +
Sbjct: 298 ESRPVADNATEAGRAVNRRVEAAV 321


>gi|316935074|ref|YP_004110056.1| OmpA/MotB domain-containing protein [Rhodopseudomonas palustris
           DX-1]
 gi|315602788|gb|ADU45323.1| OmpA/MotB domain protein [Rhodopseudomonas palustris DX-1]
          Length = 446

 Score = 64.3 bits (155), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 29/92 (31%), Positives = 52/92 (56%), Gaps = 1/92 (1%)

Query: 88  LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVS 147
           ++K   P+L  +A  + + P+  I +  +TD+ G    NL +S+ RA+ + + L + G+ 
Sbjct: 352 IDKASQPLLGKLAAAIKQCPAVTIEVAGYTDAAGKKSTNLALSKRRAEAVVASLTKAGIG 411

Query: 148 SNRFISVRGFAYKYPIDTNDTKVGRQNNQRIE 179
           S + ++  G+    PI +NDT  GR  N+RIE
Sbjct: 412 SVKLVA-EGYGSAKPIASNDTAEGRAQNRRIE 442


>gi|213054486|gb|ACJ39422.1| PomB2 [Aeromonas hydrophila]
          Length = 297

 Score = 64.3 bits (155), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 42/138 (30%), Positives = 69/138 (50%), Gaps = 8/138 (5%)

Query: 52  DEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTV 110
           ++ + Q+QD  I V  +G  I   I    +F     FL+ +F P+++ +AT+L   P   
Sbjct: 146 EQMKAQIQDGAIEVEALGQQIIIRIREKAAFPAGSAFLQPQFWPVVRKVATLLKDVPGE- 204

Query: 111 IAIQSHTDSIGT----LKNNLLISQERADVIKSYLIQ-RGVSSNRFISVRGFAYKYPIDT 165
           I I  HTD + T     ++N  +S +RA  +   +I+  G    R + V+G A   P+  
Sbjct: 205 ITISGHTDDVATEDELFQSNWELSSQRAVAVAHQMIKVPGFDGGRLV-VQGMADSQPLVP 263

Query: 166 NDTKVGRQNNQRIEIQIF 183
           N T   R+ N+R+EI I 
Sbjct: 264 NTTPENRRMNRRVEISIM 281


>gi|149377921|ref|ZP_01895649.1| Outer membrane protein and related peptidoglycan-associated
           (lipo)protein [Marinobacter algicola DG893]
 gi|149357811|gb|EDM46305.1| Outer membrane protein and related peptidoglycan-associated
           (lipo)protein [Marinobacter algicola DG893]
          Length = 402

 Score = 64.3 bits (155), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 33/108 (30%), Positives = 58/108 (53%), Gaps = 7/108 (6%)

Query: 76  IPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERAD 135
            P + S +   F  +     ++ +A  + ++P T + I  H+DSIG  + N  +SQ RA+
Sbjct: 297 FPTNSSVIGNAFDNE-----IRRVANFMLEYPETNVEIAGHSDSIGEAEYNRFLSQRRAE 351

Query: 136 VIKSYLIQR-GVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
            + + L    G+S +R  +V G+    P+ +NDT  GR  N+R+E +I
Sbjct: 352 AVATRLTDALGISEDRVNAV-GYGESEPVASNDTAAGRAENRRVEARI 398


>gi|170724840|ref|YP_001758866.1| OmpA/MotB domain-containing protein [Shewanella woodyi ATCC 51908]
 gi|169810187|gb|ACA84771.1| OmpA/MotB domain protein [Shewanella woodyi ATCC 51908]
          Length = 201

 Score = 64.3 bits (155), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 26/93 (27%), Positives = 58/93 (62%), Gaps = 2/93 (2%)

Query: 87  FLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQR-G 145
           +++  +   +++IAT + +FP+T + I+ H    G+ ++NL +SQ RA+ + + L +R G
Sbjct: 85  YIDPMYYDQVEIIATFMRQFPNTKVTIEGHCSKTGSYEHNLALSQNRANAVTTALSERFG 144

Query: 146 VSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRI 178
           +  +R  ++ G+++  PID ++T +    N+R+
Sbjct: 145 IEPDRLTAI-GYSFDRPIDLSETAMAHTRNRRV 176


>gi|304309686|ref|YP_003809284.1| outer membrane porin f precursor [gamma proteobacterium HdN1]
 gi|301795419|emb|CBL43617.1| outer membrane porin f precursor [gamma proteobacterium HdN1]
          Length = 353

 Score = 64.3 bits (155), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 31/89 (34%), Positives = 51/89 (57%), Gaps = 2/89 (2%)

Query: 91  KFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQR-GVSSN 149
           ++   +Q IA  + K+P   + I+ HTD+ G    N  +S  RA+ ++  L+ R GV++N
Sbjct: 254 RYHAEVQKIADFMKKYPDLTVTIEGHTDNTGGAALNERLSSARANSVREELVNRFGVAAN 313

Query: 150 RFISVRGFAYKYPIDTNDTKVGRQNNQRI 178
           R  SV G+    P+ +N T  GRQ N+R+
Sbjct: 314 RVTSV-GYGPSRPVASNATAAGRQENRRV 341


>gi|226229138|ref|YP_002763244.1| hypothetical protein GAU_3732 [Gemmatimonas aurantiaca T-27]
 gi|226092329|dbj|BAH40774.1| hypothetical protein [Gemmatimonas aurantiaca T-27]
          Length = 457

 Score = 64.3 bits (155), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 50/88 (56%), Gaps = 2/88 (2%)

Query: 94  PMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQR-GVSSNRFI 152
           P L+ IA +L++     + I+ HTD++G    NL +SQ RAD ++S L+   G+   R +
Sbjct: 368 PTLKEIAAMLSEHADLQLIIEGHTDNVGAAPANLALSQRRADAVRSALVSDYGIDGGR-L 426

Query: 153 SVRGFAYKYPIDTNDTKVGRQNNQRIEI 180
           + +G     P   N T  GRQ N+R+E+
Sbjct: 427 TAKGLGQTVPATANTTPEGRQQNRRVEL 454


>gi|108757918|ref|YP_632429.1| OmpA domain-containing protein [Myxococcus xanthus DK 1622]
 gi|108461798|gb|ABF86983.1| OmpA domain protein [Myxococcus xanthus DK 1622]
          Length = 620

 Score = 64.3 bits (155), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 31/89 (34%), Positives = 54/89 (60%), Gaps = 2/89 (2%)

Query: 95  MLQLIATILNKFPSTV-IAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFIS 153
           +L+ +A  L   P  + + ++ HTD  G    NL +SQ RA  + ++L++ G+++ R  +
Sbjct: 520 LLRQVAATLKANPRILMVRVEGHTDDQGNDMKNLDLSQRRARNVVAFLVKEGIAAQRLDA 579

Query: 154 VRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           V G+    P+DTN+T  GR+NN+R+E  I
Sbjct: 580 V-GYGEAKPVDTNETAKGRENNRRVEFNI 607


>gi|15835503|ref|NP_297262.1| peptidoglycan associated lipoprotein, putative [Chlamydia muridarum
           Nigg]
 gi|7190917|gb|AAF39684.1| peptidoglycan associated lipoprotein, putative [Chlamydia muridarum
           Nigg]
          Length = 202

 Score = 63.9 bits (154), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 52/93 (55%), Gaps = 1/93 (1%)

Query: 93  LPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFI 152
           L +L  +   L K P T + I+ HTD  G    NL +   RA+ +K YLI++G++S+R  
Sbjct: 111 LTILASLVRHLRKSPKTTLYIEGHTDERGAAAYNLALGARRANAVKQYLIKQGIASDRLF 170

Query: 153 SVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPR 185
           ++  +  ++P+ +   ++  Q N+R E +I  R
Sbjct: 171 TI-SYGKEHPVHSGHNELAWQQNRRTEFKIHAR 202


>gi|221201698|ref|ZP_03574736.1| OmpA/MotB domain protein [Burkholderia multivorans CGD2M]
 gi|221207227|ref|ZP_03580237.1| OmpA/MotB domain protein [Burkholderia multivorans CGD2]
 gi|221172815|gb|EEE05252.1| OmpA/MotB domain protein [Burkholderia multivorans CGD2]
 gi|221178514|gb|EEE10923.1| OmpA/MotB domain protein [Burkholderia multivorans CGD2M]
          Length = 310

 Score = 63.9 bits (154), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 33/88 (37%), Positives = 49/88 (55%), Gaps = 1/88 (1%)

Query: 95  MLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISV 154
           +L  +A  L K  +  + I  HTD+ G   +N+ +SQ RAD +K YLI +G+S  +  + 
Sbjct: 222 ILDQMAAALAKLQNRTVDIIGHTDNSGNRTSNIALSQARADAVKGYLITKGISPQQMTTT 281

Query: 155 RGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
            G     PI  NDT  GR  N+RIE ++
Sbjct: 282 -GVGPDQPIAPNDTADGRARNRRIEFRV 308


>gi|156072340|gb|ABU45492.1| OmpA family protein [Fibrobacter succinogenes subsp. succinogenes
           S85]
 gi|302328072|gb|ADL27273.1| OmpA family protein [Fibrobacter succinogenes subsp. succinogenes
           S85]
          Length = 511

 Score = 63.9 bits (154), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 55/94 (58%), Gaps = 4/94 (4%)

Query: 96  LQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVR 155
           L  +  I+  FP     I  HTD+IG    N+ +S +RA+ +K++L+++G++ +R ++ +
Sbjct: 422 LMKVVDIMETFPEATFEIVGHTDNIGNKDKNMTLSADRANAVKNFLVEKGIAESR-MTTQ 480

Query: 156 GFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGNIK 189
           G     P+ +N T  GR  N+RIE   F R +IK
Sbjct: 481 GMGDTKPVASNKTPEGRAQNRRIE---FIRTDIK 511


>gi|108763188|ref|YP_632960.1| OmpA domain-containing protein [Myxococcus xanthus DK 1622]
 gi|108467068|gb|ABF92253.1| OmpA domain protein [Myxococcus xanthus DK 1622]
          Length = 615

 Score = 63.9 bits (154), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 30/97 (30%), Positives = 59/97 (60%), Gaps = 2/97 (2%)

Query: 84  SEVFLEKKFLPMLQLIATILNKFPST-VIAIQSHTDSIGTLKNNLLISQERADVIKSYLI 142
           ++  ++K+   +L  +A ++ + P   ++ + +HTD  G   +N  +SQ RA+ ++ YLI
Sbjct: 504 TQARIQKRSYELLDWVARVIREHPEIPLVVVGAHTDDRGFPDDNRRLSQGRAEAVRQYLI 563

Query: 143 QRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIE 179
            R ++  R  ++ G+  + PID+N T  GR+NN+R+E
Sbjct: 564 GRDIAPERLKAL-GYGQERPIDSNATSNGRENNRRVE 599


>gi|312130019|ref|YP_003997359.1| ompa/motb domain protein [Leadbetterella byssophila DSM 17132]
 gi|311906565|gb|ADQ17006.1| OmpA/MotB domain protein [Leadbetterella byssophila DSM 17132]
          Length = 412

 Score = 63.9 bits (154), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 49/76 (64%), Gaps = 1/76 (1%)

Query: 107 PSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTN 166
           P+  I I+ HTD+ G  + NL +S +RA  ++ YLI++G+ ++R I  +G+    P+  N
Sbjct: 334 PTYKIQIEGHTDNQGDARANLQLSNDRAYNVRQYLIEQGIETSR-IKFKGYGSSKPVSPN 392

Query: 167 DTKVGRQNNQRIEIQI 182
           DT+  R+ N+R+E QI
Sbjct: 393 DTEENRRKNRRVEYQI 408


>gi|167035288|ref|YP_001670519.1| OmpA/MotB domain-containing protein [Pseudomonas putida GB-1]
 gi|166861776|gb|ABZ00184.1| OmpA/MotB domain protein [Pseudomonas putida GB-1]
          Length = 230

 Score = 63.9 bits (154), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 34/88 (38%), Positives = 49/88 (55%), Gaps = 1/88 (1%)

Query: 96  LQLIATIL-NKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISV 154
           L  IAT L  + PS  +++  HTDS+G+   N  +S+ RA  +  YL++ GV    F+SV
Sbjct: 141 LNTIATRLKQEAPSARLSVSGHTDSVGSDSYNQKLSERRAHSVTDYLVESGVPRRSFVSV 200

Query: 155 RGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
            G     P+  N T  GR  N+R EI+I
Sbjct: 201 VGAGETQPVADNATAEGRAMNRRTEIKI 228


>gi|332519230|ref|ZP_08395697.1| OmpA/MotB domain protein [Lacinutrix algicola 5H-3-7-4]
 gi|332045078|gb|EGI81271.1| OmpA/MotB domain protein [Lacinutrix algicola 5H-3-7-4]
          Length = 235

 Score = 63.9 bits (154), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 29/83 (34%), Positives = 49/83 (59%), Gaps = 1/83 (1%)

Query: 102 ILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKY 161
           +  ++P T I +  HTDS+G+  +N+ +S+ RA  + +YL  +G+S+ R ++   F    
Sbjct: 139 VFREYPDTNILVVGHTDSVGSEDSNMTLSKNRAYAVTNYLTNQGISNAR-VTTNWFGEGQ 197

Query: 162 PIDTNDTKVGRQNNQRIEIQIFP 184
           P + N TK GR  N+R+ I I P
Sbjct: 198 PTNDNSTKEGRAKNRRVNIAIVP 220


>gi|215433411|gb|ACJ66671.1| OmpA domain protein [Myxococcus fulvus HW-1]
          Length = 615

 Score = 63.9 bits (154), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 30/97 (30%), Positives = 58/97 (59%), Gaps = 2/97 (2%)

Query: 84  SEVFLEKKFLPMLQLIATILNKFPST-VIAIQSHTDSIGTLKNNLLISQERADVIKSYLI 142
           ++  ++K+   +L  +A ++ + P   ++ + +HTD  G    N  +SQ RA+ ++ YLI
Sbjct: 504 TQARIQKRSFELLDWVARVIREHPEIPLVVVGAHTDDRGFPDANRRLSQARAEAVRQYLI 563

Query: 143 QRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIE 179
            R ++  R  ++ G+  + PID+N T  GR+NN+R+E
Sbjct: 564 GRDIAPERLKAL-GYGQERPIDSNATSNGRENNRRVE 599


>gi|315186462|gb|EFU20222.1| OmpA/MotB domain protein [Spirochaeta thermophila DSM 6578]
          Length = 395

 Score = 63.9 bits (154), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 50/88 (56%)

Query: 96  LQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVR 155
           L+ IA IL+++P   + ++ HT   GT +  L +S ERA  +  +L++ GV     I ++
Sbjct: 306 LRKIAQILSRYPERDLLVEGHTALAGTPEGRLALSIERAKAVADFLMKLGVRRPEQIVIQ 365

Query: 156 GFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
           G+    PI  N T+ GR  N+R+EI I 
Sbjct: 366 GYGATRPIADNATEAGRSRNRRVEITIL 393


>gi|4580969|gb|AAD24556.1|AF117964_1 OprF [Pseudomonas fuscovaginae]
          Length = 326

 Score = 63.9 bits (154), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 30/84 (35%), Positives = 48/84 (57%), Gaps = 1/84 (1%)

Query: 99  IATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFA 158
           +A  + ++P T   +  HTDS+GT   N  +SQ RAD +K  L++ G++ NR  SV  + 
Sbjct: 239 LADFMKQYPQTTTVVSGHTDSVGTDAYNQKLSQRRADAVKQVLVKDGIAPNRIQSVV-YG 297

Query: 159 YKYPIDTNDTKVGRQNNQRIEIQI 182
              P+  N T+ GR  N+R+E  +
Sbjct: 298 KTRPVADNATEAGRAINRRVEASV 321


>gi|114776523|ref|ZP_01451568.1| putative lipoprotein [Mariprofundus ferrooxydans PV-1]
 gi|114553353|gb|EAU55751.1| putative lipoprotein [Mariprofundus ferrooxydans PV-1]
          Length = 223

 Score = 63.9 bits (154), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 49/84 (58%), Gaps = 1/84 (1%)

Query: 99  IATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFA 158
           +AT+L ++  T + I  HTDS GT   N  +S+ RA  + SY+I +GVS++R I+  G  
Sbjct: 135 VATLLKRYKKTRLTITGHTDSTGTALFNQSLSERRALAVASYMISKGVSADR-IASSGMG 193

Query: 159 YKYPIDTNDTKVGRQNNQRIEIQI 182
              P   ND+   R  N+R+EI I
Sbjct: 194 ESSPAYPNDSAANRAKNRRVEILI 217


>gi|262066274|ref|ZP_06025886.1| fibronectin-binding protein [Fusobacterium periodonticum ATCC
           33693]
 gi|291380021|gb|EFE87539.1| fibronectin-binding protein [Fusobacterium periodonticum ATCC
           33693]
          Length = 75

 Score = 63.9 bits (154), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 49/75 (65%)

Query: 111 IAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKV 170
           + ++ HTDSIG+ + N+ +S+ RA+ +K+ LI+ G++  R + +     +YP+ TN+T  
Sbjct: 1   VTLEGHTDSIGSNQYNIGLSRRRAEAVKAKLIEFGLAEERIVGIEAKGEEYPVATNETPE 60

Query: 171 GRQNNQRIEIQIFPR 185
           GR  N+R+E ++  R
Sbjct: 61  GRLQNRRVEFRLVQR 75


>gi|167838085|ref|ZP_02464944.1| ompA family protein [Burkholderia thailandensis MSMB43]
          Length = 243

 Score = 63.9 bits (154), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 49/85 (57%), Gaps = 1/85 (1%)

Query: 95  MLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISV 154
           +L  +A  L K  +  + I  HTD+ G   +N+ +SQ RAD +K YL+ +G++S +  + 
Sbjct: 155 ILDQMAAALAKMSNRTVEIIGHTDNSGNRTSNIALSQARADAVKGYLVAKGIASQQLTTT 214

Query: 155 RGFAYKYPIDTNDTKVGRQNNQRIE 179
            G     PI +ND+  GR  N+RIE
Sbjct: 215 -GVGPDQPIASNDSADGRARNRRIE 238


>gi|84394243|ref|ZP_00992970.1| Outer membrane protein [Vibrio splendidus 12B01]
 gi|84375118|gb|EAP92038.1| Outer membrane protein [Vibrio splendidus 12B01]
          Length = 356

 Score = 63.9 bits (154), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 55/91 (60%), Gaps = 5/91 (5%)

Query: 92  FLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRF 151
            +P+++    +L   P + +A+  HTDS G  + NL+IS++RA  + +Y+ ++G+ ++R 
Sbjct: 251 LMPLVE----VLKAHPQSSVAVVGHTDSTGAAEYNLMISKKRAAAVAAYIEEQGIEADR- 305

Query: 152 ISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           I+  G   + PI +N T  GR  N+R++  I
Sbjct: 306 ITASGEGEENPIASNATAEGRAQNRRVDATI 336


>gi|261417272|ref|YP_003250955.1| OmpA/MotB domain protein [Fibrobacter succinogenes subsp.
           succinogenes S85]
 gi|261373728|gb|ACX76473.1| OmpA/MotB domain protein [Fibrobacter succinogenes subsp.
           succinogenes S85]
          Length = 294

 Score = 63.9 bits (154), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 61/103 (59%), Gaps = 1/103 (0%)

Query: 83  VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLI 142
           V    L+   +  L  IA IL+ +    ++I+ +TD+ G+ + N+ +SQ+RA+ +  +L+
Sbjct: 188 VGRATLKTDLMTSLAKIAGILSVYQQFDVSIEGNTDNTGSEEFNMTLSQQRAENVMKFLV 247

Query: 143 QRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPR 185
           ++G++  R ++ +G     PI  N TK GRQ N+R+++ I  R
Sbjct: 248 EQGIAETR-LTAKGLGMTMPIADNSTKEGRQKNRRVDLVITDR 289


>gi|149928286|ref|ZP_01916529.1| OmpA/MotB [Limnobacter sp. MED105]
 gi|149823015|gb|EDM82257.1| OmpA/MotB [Limnobacter sp. MED105]
          Length = 218

 Score = 63.9 bits (154), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 31/74 (41%), Positives = 49/74 (66%), Gaps = 2/74 (2%)

Query: 108 STVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTND 167
           ++VIAI  HTDSIG+   N  +S+ RA  +K Y++ +GVS++R I ++G     P+  N 
Sbjct: 138 NSVIAI-GHTDSIGSDAYNQKLSERRAQAVKDYMVSKGVSADR-IQIKGMGESQPVADNK 195

Query: 168 TKVGRQNNQRIEIQ 181
           T+ GR  N+R+EI+
Sbjct: 196 TREGRAKNRRVEIE 209


>gi|134283190|ref|ZP_01769891.1| ompA family protein [Burkholderia pseudomallei 305]
 gi|134245385|gb|EBA45478.1| ompA family protein [Burkholderia pseudomallei 305]
          Length = 312

 Score = 63.9 bits (154), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 32/85 (37%), Positives = 48/85 (56%), Gaps = 1/85 (1%)

Query: 95  MLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISV 154
           +L  +A  L K  S  + I  HTD+ G   +N+ +SQ RAD +K YL+ +G++S +  + 
Sbjct: 224 ILDQMAGALAKMSSRTVEIIGHTDNSGNRTSNIALSQARADAVKGYLVTKGIASQQLTTT 283

Query: 155 RGFAYKYPIDTNDTKVGRQNNQRIE 179
            G     PI  ND+  GR  N+RIE
Sbjct: 284 -GVGPDQPIAPNDSADGRARNRRIE 307


>gi|237740698|ref|ZP_04571179.1| outer membrane porin F [Fusobacterium sp. 2_1_31]
 gi|229422715|gb|EEO37762.1| outer membrane porin F [Fusobacterium sp. 2_1_31]
          Length = 340

 Score = 63.9 bits (154), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 32/90 (35%), Positives = 60/90 (66%), Gaps = 3/90 (3%)

Query: 95  MLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISV 154
           +L+ +AT+L +       I  +TDS G+ ++N ++S++RA+ +K++L+ +GV++   I+ 
Sbjct: 252 VLKNLATVLKEMNVKNFEIDGYTDSDGSDEHNQVLSEKRANSVKNFLVSQGVTAE--ITT 309

Query: 155 RGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           +G+    P+ +NDT  GRQ N+R+EI I P
Sbjct: 310 KGYGESKPVASNDTAEGRQKNRRVEI-IIP 338


>gi|288550313|ref|ZP_05969946.2| membrane protein OmpA-family [Enterobacter cancerogenus ATCC 35316]
 gi|288315417|gb|EFC54355.1| membrane protein OmpA-family [Enterobacter cancerogenus ATCC 35316]
          Length = 563

 Score = 63.9 bits (154), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 47/81 (58%)

Query: 107 PSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTN 166
           P  +I +  HTDS G  K+N ++S +RA+ ++ ++   G       +V+G+    P+ TN
Sbjct: 459 PGWLIVVAGHTDSTGDDKSNQVLSLKRAESVRDWMRDTGDVPESCFAVQGYGESRPVATN 518

Query: 167 DTKVGRQNNQRIEIQIFPRGN 187
           DT  GR  N+R+EI + P+ N
Sbjct: 519 DTPEGRALNRRVEISLVPQAN 539


>gi|5081415|gb|AAD39370.1|AF117975_1 outer membrane protein OprF [Pseudomonas stutzeri ZoBell]
          Length = 321

 Score = 63.9 bits (154), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 30/82 (36%), Positives = 51/82 (62%), Gaps = 2/82 (2%)

Query: 99  IATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLI-QRGVSSNRFISVRGF 157
           +A  + ++P T   ++ HTDS+GT + N  +S+ RA+ +++ L+ + GV  NR  SV G+
Sbjct: 240 LADFMQQYPQTTTTVEGHTDSVGTDQYNQRLSERRAEAVRNVLVNEHGVQGNRVNSV-GY 298

Query: 158 AYKYPIDTNDTKVGRQNNQRIE 179
               P+  N T+ GRQ N+R+E
Sbjct: 299 GESRPVADNSTEEGRQINRRVE 320


>gi|53723969|ref|YP_104341.1| OmpA domain-containing protein [Burkholderia mallei ATCC 23344]
 gi|67640679|ref|ZP_00439477.1| OmpA family protein [Burkholderia mallei GB8 horse 4]
 gi|121600594|ref|YP_991404.1| ompA family protein [Burkholderia mallei SAVP1]
 gi|124386056|ref|YP_001027695.1| ompA family protein [Burkholderia mallei NCTC 10229]
 gi|126450255|ref|YP_001082667.1| ompA family protein [Burkholderia mallei NCTC 10247]
 gi|167001412|ref|ZP_02267211.1| ompA family protein [Burkholderia mallei PRL-20]
 gi|167908671|ref|ZP_02495876.1| ompA family protein [Burkholderia pseudomallei NCTC 13177]
 gi|217424718|ref|ZP_03456215.1| ompA family protein [Burkholderia pseudomallei 576]
 gi|237814018|ref|YP_002898469.1| OmpA family protein [Burkholderia pseudomallei MSHR346]
 gi|254174698|ref|ZP_04881359.1| ompA family protein [Burkholderia mallei ATCC 10399]
 gi|254201416|ref|ZP_04907780.1| ompA family protein [Burkholderia mallei FMH]
 gi|254206758|ref|ZP_04913109.1| ompA family protein [Burkholderia mallei JHU]
 gi|254357247|ref|ZP_04973521.1| ompA family protein [Burkholderia mallei 2002721280]
 gi|52427392|gb|AAU47985.1| OmpA domain protein [Burkholderia mallei ATCC 23344]
 gi|121229404|gb|ABM51922.1| ompA family protein [Burkholderia mallei SAVP1]
 gi|124294076|gb|ABN03345.1| ompA family protein [Burkholderia mallei NCTC 10229]
 gi|126243125|gb|ABO06218.1| ompA family protein [Burkholderia mallei NCTC 10247]
 gi|147747310|gb|EDK54386.1| ompA family protein [Burkholderia mallei FMH]
 gi|147752300|gb|EDK59366.1| ompA family protein [Burkholderia mallei JHU]
 gi|148026311|gb|EDK84396.1| ompA family protein [Burkholderia mallei 2002721280]
 gi|160695743|gb|EDP85713.1| ompA family protein [Burkholderia mallei ATCC 10399]
 gi|217392174|gb|EEC32199.1| ompA family protein [Burkholderia pseudomallei 576]
 gi|237502962|gb|ACQ95280.1| OmpA family protein [Burkholderia pseudomallei MSHR346]
 gi|238521446|gb|EEP84897.1| OmpA family protein [Burkholderia mallei GB8 horse 4]
 gi|243062825|gb|EES45011.1| ompA family protein [Burkholderia mallei PRL-20]
          Length = 310

 Score = 63.9 bits (154), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 32/85 (37%), Positives = 48/85 (56%), Gaps = 1/85 (1%)

Query: 95  MLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISV 154
           +L  +A  L K  S  + I  HTD+ G   +N+ +SQ RAD +K YL+ +G++S +  + 
Sbjct: 222 ILDQMAGALAKMSSRTVEIIGHTDNSGNRTSNIALSQARADAVKGYLVTKGIASQQLTTT 281

Query: 155 RGFAYKYPIDTNDTKVGRQNNQRIE 179
            G     PI  ND+  GR  N+RIE
Sbjct: 282 -GVGPDQPIAPNDSADGRARNRRIE 305


>gi|308273873|emb|CBX30473.1| hypothetical protein N47_K27130 [uncultured Desulfobacterium sp.]
 gi|308275118|emb|CBX31717.1| hypothetical protein N47_E52290 [uncultured Desulfobacterium sp.]
          Length = 355

 Score = 63.9 bits (154), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 59/113 (52%), Gaps = 2/113 (1%)

Query: 70  DMITCYIPVHVSFVSEVF-LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLL 128
           D   C+I   V F +  + +  K+ P+L  + +++ K P   + +Q HTDS GT K N  
Sbjct: 241 DCRGCWILQGVYFDTAKWNILSKYFPILDNVVSVIKKNPDMKLEVQGHTDSRGTAKYNRK 300

Query: 129 ISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQ 181
           +S+ RA  +  Y + +GV  +  ++ +GF +  P   ND       N+R+E++
Sbjct: 301 LSENRAKSVVEYFVSKGVDRS-ILTAKGFGFTVPAAPNDNAEDMAKNRRVELK 352


>gi|167912756|ref|ZP_02499847.1| ompA family protein [Burkholderia pseudomallei 112]
          Length = 248

 Score = 63.9 bits (154), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 32/85 (37%), Positives = 48/85 (56%), Gaps = 1/85 (1%)

Query: 95  MLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISV 154
           +L  +A  L K  S  + I  HTD+ G   +N+ +SQ RAD +K YL+ +G++S +  + 
Sbjct: 160 ILDQMAGALAKMSSRTVEIIGHTDNSGNRTSNIALSQARADAVKGYLVTKGIASQQLTTT 219

Query: 155 RGFAYKYPIDTNDTKVGRQNNQRIE 179
            G     PI  ND+  GR  N+RIE
Sbjct: 220 -GVGPDQPIAPNDSADGRARNRRIE 243


>gi|270285686|ref|ZP_06195080.1| peptidoglycan associated lipoprotein, putative [Chlamydia muridarum
           Nigg]
 gi|270289694|ref|ZP_06195996.1| peptidoglycan associated lipoprotein, putative [Chlamydia muridarum
           Weiss]
 gi|301337081|ref|ZP_07225283.1| peptidoglycan-associated lipoprotein [Chlamydia muridarum
           MopnTet14]
          Length = 188

 Score = 63.9 bits (154), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 52/93 (55%), Gaps = 1/93 (1%)

Query: 93  LPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFI 152
           L +L  +   L K P T + I+ HTD  G    NL +   RA+ +K YLI++G++S+R  
Sbjct: 97  LTILASLVRHLRKSPKTTLYIEGHTDERGAAAYNLALGARRANAVKQYLIKQGIASDRLF 156

Query: 153 SVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPR 185
           ++  +  ++P+ +   ++  Q N+R E +I  R
Sbjct: 157 TI-SYGKEHPVHSGHNELAWQQNRRTEFKIHAR 188


>gi|261416280|ref|YP_003249963.1| OmpA/MotB domain protein [Fibrobacter succinogenes subsp.
           succinogenes S85]
 gi|261372736|gb|ACX75481.1| OmpA/MotB domain protein [Fibrobacter succinogenes subsp.
           succinogenes S85]
          Length = 485

 Score = 63.9 bits (154), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 55/94 (58%), Gaps = 4/94 (4%)

Query: 96  LQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVR 155
           L  +  I+  FP     I  HTD+IG    N+ +S +RA+ +K++L+++G++ +R ++ +
Sbjct: 396 LMKVVDIMETFPEATFEIVGHTDNIGNKDKNMTLSADRANAVKNFLVEKGIAESR-MTTQ 454

Query: 156 GFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGNIK 189
           G     P+ +N T  GR  N+RIE   F R +IK
Sbjct: 455 GMGDTKPVASNKTPEGRAQNRRIE---FIRTDIK 485


>gi|167826034|ref|ZP_02457505.1| ompA family protein [Burkholderia pseudomallei 9]
          Length = 247

 Score = 63.9 bits (154), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 32/85 (37%), Positives = 48/85 (56%), Gaps = 1/85 (1%)

Query: 95  MLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISV 154
           +L  +A  L K  S  + I  HTD+ G   +N+ +SQ RAD +K YL+ +G++S +  + 
Sbjct: 159 ILDQMAGALAKMSSRTVEIIGHTDNSGNRTSNIALSQARADAVKGYLVTKGIASQQLTTT 218

Query: 155 RGFAYKYPIDTNDTKVGRQNNQRIE 179
            G     PI  ND+  GR  N+RIE
Sbjct: 219 -GVGPDQPIAPNDSADGRARNRRIE 242


>gi|76809643|ref|YP_335000.1| OmpA family domain-containing protein [Burkholderia pseudomallei
           1710b]
 gi|226198194|ref|ZP_03793765.1| ompA family protein [Burkholderia pseudomallei Pakistan 9]
 gi|254190435|ref|ZP_04896943.1| ompA family protein [Burkholderia pseudomallei Pasteur 52237]
 gi|254259878|ref|ZP_04950932.1| ompA family protein [Burkholderia pseudomallei 1710a]
 gi|254300689|ref|ZP_04968134.1| ompA family protein [Burkholderia pseudomallei 406e]
 gi|76579096|gb|ABA48571.1| OmpA family domain protein [Burkholderia pseudomallei 1710b]
 gi|157810473|gb|EDO87643.1| ompA family protein [Burkholderia pseudomallei 406e]
 gi|157938111|gb|EDO93781.1| ompA family protein [Burkholderia pseudomallei Pasteur 52237]
 gi|225929714|gb|EEH25730.1| ompA family protein [Burkholderia pseudomallei Pakistan 9]
 gi|254218567|gb|EET07951.1| ompA family protein [Burkholderia pseudomallei 1710a]
          Length = 310

 Score = 63.9 bits (154), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 32/85 (37%), Positives = 48/85 (56%), Gaps = 1/85 (1%)

Query: 95  MLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISV 154
           +L  +A  L K  S  + I  HTD+ G   +N+ +SQ RAD +K YL+ +G++S +  + 
Sbjct: 222 ILDQMAGALAKMSSRTVEIIGHTDNSGNRTSNIALSQARADAVKGYLVTKGIASQQLTTT 281

Query: 155 RGFAYKYPIDTNDTKVGRQNNQRIE 179
            G     PI  ND+  GR  N+RIE
Sbjct: 282 -GVGPDQPIAPNDSADGRARNRRIE 305


>gi|162448339|ref|YP_001610706.1| outer membrane porin precursor [Sorangium cellulosum 'So ce 56']
 gi|161158921|emb|CAN90226.1| outer membrane porin precursor [Sorangium cellulosum 'So ce 56']
          Length = 608

 Score = 63.9 bits (154), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 31/92 (33%), Positives = 53/92 (57%), Gaps = 2/92 (2%)

Query: 95  MLQLIATILNKFPSTV-IAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFIS 153
           +L  +A +L   P  + I +Q HTD  GT + N  +SQ RA+ +   L++RG+++ R + 
Sbjct: 513 LLDEVAGVLKDHPEILKIEVQGHTDDRGTRQFNTKLSQARAESVLKALVERGIAAQR-LQ 571

Query: 154 VRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPR 185
            +G+    PI  N T+ GRQ N+R++  I  +
Sbjct: 572 AKGYGPDVPIAENKTEAGRQKNRRVQFNIIEK 603


>gi|107100485|ref|ZP_01364403.1| hypothetical protein PaerPA_01001510 [Pseudomonas aeruginosa PACS2]
          Length = 188

 Score = 63.9 bits (154), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 30/79 (37%), Positives = 47/79 (59%)

Query: 104 NKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPI 163
            +  ST ++I  HTDS+G+   N  +S+ RA+ + +YLI  GV S+  + V+G     P+
Sbjct: 107 GEAASTRLSITGHTDSVGSDAYNQKLSERRANAVANYLIDAGVPSSIIVGVQGLGESQPV 166

Query: 164 DTNDTKVGRQNNQRIEIQI 182
             N T+ GR  N+R+EI I
Sbjct: 167 ADNKTREGRAENRRVEILI 185


>gi|322418016|ref|YP_004197239.1| OmpA/MotB domain-containing protein [Geobacter sp. M18]
 gi|320124403|gb|ADW11963.1| OmpA/MotB domain protein [Geobacter sp. M18]
          Length = 459

 Score = 63.9 bits (154), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 49/85 (57%), Gaps = 2/85 (2%)

Query: 96  LQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQR-GVSSNRFISV 154
           + ++   + K+P+T   I+ HTD++G  + NL +S+ RA  +  YL+   G+  +R +  
Sbjct: 243 IAVVCDFMKKYPTTTAVIEGHTDNVGAPEYNLDLSKRRAQAVVDYLVTDCGIDRSR-LEA 301

Query: 155 RGFAYKYPIDTNDTKVGRQNNQRIE 179
           RGF    P+  N T  GRQ N+RIE
Sbjct: 302 RGFGMARPVAPNTTDEGRQANRRIE 326



 Score = 57.8 bits (138), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 48/81 (59%), Gaps = 2/81 (2%)

Query: 99  IATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQR-GVSSNRFISVRGF 157
           +A  + ++P+T   I+ HTD++G  + N+ +S+ERA+    YL+   G+  +R +S +G+
Sbjct: 370 VADYMKQYPTTTAVIEGHTDNVGGYEYNMKLSRERAESAVRYLVDNFGIEKSR-LSAKGY 428

Query: 158 AYKYPIDTNDTKVGRQNNQRI 178
            Y   +  N T  GR  N+RI
Sbjct: 429 GYTRRVAYNRTAEGRAKNRRI 449


>gi|227538150|ref|ZP_03968199.1| possible outer membrane protein [Sphingobacterium spiritivorum ATCC
           33300]
 gi|227241993|gb|EEI92008.1| possible outer membrane protein [Sphingobacterium spiritivorum ATCC
           33300]
          Length = 628

 Score = 63.9 bits (154), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 32/87 (36%), Positives = 50/87 (57%), Gaps = 1/87 (1%)

Query: 96  LQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVR 155
           L  +   L + P   I I  HTD+ G  + N  +S  RA  + +YLI RG+S+NR ++ +
Sbjct: 541 LNTLVLFLQENPLIRIEIGGHTDNTGNDQLNKTLSDNRAKAVVTYLIARGISANRLLA-K 599

Query: 156 GFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           G+    P+ TNDT+ G+  N+R E +I
Sbjct: 600 GYGSNQPLATNDTETGKALNRRTEFKI 626


>gi|297568668|ref|YP_003690012.1| OmpA/MotB domain protein [Desulfurivibrio alkaliphilus AHT2]
 gi|296924583|gb|ADH85393.1| OmpA/MotB domain protein [Desulfurivibrio alkaliphilus AHT2]
          Length = 288

 Score = 63.9 bits (154), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 32/85 (37%), Positives = 50/85 (58%), Gaps = 1/85 (1%)

Query: 96  LQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVR 155
           LQ I T+L+  P   + IQ HTDS G+   NL +SQ RA+ + +YL+  G+  +R  S +
Sbjct: 201 LQGIVTLLHDHPDLRLEIQGHTDSDGSAAYNLQLSQRRAESVLNYLLLFGIDPSRLKS-K 259

Query: 156 GFAYKYPIDTNDTKVGRQNNQRIEI 180
           G+    P+  NDT   +  N+R+E+
Sbjct: 260 GYGETMPVAPNDTAENKAKNRRVEL 284


>gi|167721446|ref|ZP_02404682.1| ompA family protein [Burkholderia pseudomallei DM98]
          Length = 243

 Score = 63.9 bits (154), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 32/85 (37%), Positives = 48/85 (56%), Gaps = 1/85 (1%)

Query: 95  MLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISV 154
           +L  +A  L K  S  + I  HTD+ G   +N+ +SQ RAD +K YL+ +G++S +  + 
Sbjct: 155 ILDQMAGALAKMSSRTVEIIGHTDNSGNRTSNIALSQARADAVKGYLVTKGIASQQLTTT 214

Query: 155 RGFAYKYPIDTNDTKVGRQNNQRIE 179
            G     PI  ND+  GR  N+RIE
Sbjct: 215 -GVGPDQPIAPNDSADGRARNRRIE 238


>gi|585710|sp|P37726|PORF_PSEFL RecName: Full=Outer membrane porin F; AltName: Full=Root adhesin;
           Flags: Precursor
 gi|5668610|gb|AAD45981.1| OprF [Pseudomonas fluorescens]
          Length = 326

 Score = 63.9 bits (154), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 30/84 (35%), Positives = 50/84 (59%), Gaps = 1/84 (1%)

Query: 99  IATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFA 158
           +A  + ++P+T + +  HTDSIG    N  +SQ RAD +K  L++ GV+ +R  +V G+ 
Sbjct: 239 LADFMAQYPATNVEVAGHTDSIGPDAYNQKLSQRRADRVKQVLVKDGVAPSRITAV-GYG 297

Query: 159 YKYPIDTNDTKVGRQNNQRIEIQI 182
              P+  N T+ GR  N+R+E  +
Sbjct: 298 ESRPVADNATEAGRAVNRRVEASV 321


>gi|88798412|ref|ZP_01113997.1| OmpA/MotB [Reinekea sp. MED297]
 gi|88778852|gb|EAR10042.1| OmpA/MotB [Reinekea sp. MED297]
          Length = 373

 Score = 63.9 bits (154), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 31/87 (35%), Positives = 51/87 (58%), Gaps = 1/87 (1%)

Query: 96  LQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVR 155
           LQ  A  L +FP   I I++HTDS  +   NL +S +RA  I+ YLI+ G+   R ++  
Sbjct: 270 LQEAANTLRQFPDINIQIEAHTDSTASEAYNLSLSDQRAQAIRDYLIELGIDEQR-LTAT 328

Query: 156 GFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           G+    P  +N+++ GR  N+R+E ++
Sbjct: 329 GYGESQPRASNESEEGRSLNRRVEFRM 355


>gi|327404330|ref|YP_004345168.1| OmpA/MotB domain-containing protein [Fluviicola taffensis DSM
           16823]
 gi|327319838|gb|AEA44330.1| OmpA/MotB domain protein [Fluviicola taffensis DSM 16823]
          Length = 809

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 32/84 (38%), Positives = 48/84 (57%), Gaps = 1/84 (1%)

Query: 99  IATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFA 158
           +A +L K P   + I  HTD+ G  K NL +S+ RA+ +K YL  +GV + + +    F 
Sbjct: 724 LAALLIKKPEWKLQIAGHTDNKGDAKKNLTLSKNRAEAVKKYLTSKGVDATK-LKPEWFG 782

Query: 159 YKYPIDTNDTKVGRQNNQRIEIQI 182
              PI TN T  GRQ N+R+E+ +
Sbjct: 783 QTKPIATNATPEGRQKNRRVEMNV 806


>gi|5081411|gb|AAD39366.1|AF117971_1 outer membrane protein OprF [Pseudomonas stutzeri LMG 11199T]
          Length = 328

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 52/85 (61%), Gaps = 2/85 (2%)

Query: 99  IATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLI-QRGVSSNRFISVRGF 157
           +A  + ++P T   ++ HTDS+GT + N  +S+ RA+ +++ L+ + GV  NR  SV G+
Sbjct: 242 LADFMQQYPQTTTVVEGHTDSVGTDQYNQRLSERRAEAVRNVLVNEYGVQGNRVNSV-GY 300

Query: 158 AYKYPIDTNDTKVGRQNNQRIEIQI 182
               P+  N T+ GRQ N+R+E  +
Sbjct: 301 GESRPVADNSTEEGRQINRRVEAAV 325


>gi|326794907|ref|YP_004312727.1| OmpA/MotB domain protein [Marinomonas mediterranea MMB-1]
 gi|326545671|gb|ADZ90891.1| OmpA/MotB domain protein [Marinomonas mediterranea MMB-1]
          Length = 209

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 32/98 (32%), Positives = 53/98 (54%)

Query: 88  LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVS 147
           ++ ++   ++ +A  + K P + I I+ HTD +G+ + NL +SQ RA  I S L    + 
Sbjct: 89  VKPRYYSEVKKLADFMRKNPQSSIVIEGHTDDVGSEELNLGLSQRRASAIASVLTDSFMV 148

Query: 148 SNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPR 185
               +   G+    PI TNDT  GR+ N+R+  +IF R
Sbjct: 149 RKSRVKGVGYGETRPIATNDTATGREQNRRVVAEIFAR 186


>gi|149372847|ref|ZP_01891868.1| OmpA family protein [unidentified eubacterium SCB49]
 gi|149354544|gb|EDM43109.1| OmpA family protein [unidentified eubacterium SCB49]
          Length = 235

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 44/151 (29%), Positives = 77/151 (50%), Gaps = 7/151 (4%)

Query: 43  FGSSLDKAEDEFQMQLQDTGIVVSRIGD--MITCYIPVHVSFVSEVF-LEKKFLPMLQLI 99
            G+ +DK   E + ++   G  V R+ D  +IT      V F +  + +       L  +
Sbjct: 79  IGNKMDKQAQEIESEI--PGAEVERVDDGIVITFDENSGVYFDTAKYNINTASQQNLDKL 136

Query: 100 ATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQ-RGVSSNRFISVRGFA 158
           A +L ++  T + +  HTDS+G+  +N+L+SQ RA  + +Y    +G+SS+RF +   + 
Sbjct: 137 AGVLQEYVDTNVLVVGHTDSVGSEDSNMLLSQRRAQAVTNYFTSTKGLSSSRF-TTNWYG 195

Query: 159 YKYPIDTNDTKVGRQNNQRIEIQIFPRGNIK 189
            + P+  N T  GR  N+R+ I I P   +K
Sbjct: 196 EQTPVGDNATPEGRAQNRRVNIVIVPNEKMK 226


>gi|78223923|ref|YP_385670.1| OmpA/MotB [Geobacter metallireducens GS-15]
 gi|78195178|gb|ABB32945.1| OmpA/MotB [Geobacter metallireducens GS-15]
          Length = 398

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 30/84 (35%), Positives = 51/84 (60%), Gaps = 1/84 (1%)

Query: 99  IATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFA 158
           IA IL  FP   I I  +TD++G  + NL +S++RA      L++ G+  +R  S  G+ 
Sbjct: 313 IAAILKAFPQVAIKIGGYTDNVGDPQANLKLSRDRASNTMQELVKLGIDPSRLES-EGYG 371

Query: 159 YKYPIDTNDTKVGRQNNQRIEIQI 182
            ++P+  N T+ GRQ N+RI++++
Sbjct: 372 EEHPVADNATEEGRQQNRRIDVRV 395


>gi|311697206|gb|ADQ00078.1| secreted protein containing outer membrane protein, OmpA/MotB,
           C-terminal domain [marine bacterium HP15]
          Length = 366

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 53/93 (56%), Gaps = 2/93 (2%)

Query: 88  LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQR-GV 146
           ++ +F P +  +A +L ++P++ I ++ HTDS G+   N  +S+ RAD +   LI R  +
Sbjct: 259 VKPQFYPEIGELAKVLKQYPTSTILLEGHTDSTGSASYNQQLSKSRADAVMKVLIDRFSI 318

Query: 147 SSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIE 179
            S R IS  G     PI +N T  GR  N+R+E
Sbjct: 319 PSTR-ISTTGMGESQPIASNATVEGRAQNRRVE 350


>gi|532658|gb|AAA99311.1| antigen [Treponema pallidum]
          Length = 416

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 31/87 (35%), Positives = 50/87 (57%)

Query: 96  LQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVR 155
           L+ IA +L  FP   + +  H +  G++++   IS+ERADV+  YL + GV     +  R
Sbjct: 327 LRKIAELLRAFPDRELLVSGHAERRGSVQDQQRISEERADVVARYLQELGVVDAAHVYTR 386

Query: 156 GFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           G   +  I  ND++ GR+ N+R+EI I
Sbjct: 387 GCGAQQSIAPNDSEDGRRKNRRVEITI 413


>gi|317491523|ref|ZP_07949959.1| OmpA family protein [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316921070|gb|EFV42393.1| OmpA family protein [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 564

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 46/84 (54%)

Query: 107 PSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTN 166
           P  +I I  HTD+ G  + NL +SQ RA+ ++ ++   G       +V+G+    PI +N
Sbjct: 473 PGWLIVIAGHTDATGNAQRNLALSQARAEAVRDWMRSMGDIPVTCFAVQGYGASQPIASN 532

Query: 167 DTKVGRQNNQRIEIQIFPRGNIKK 190
           +T  GR  N+R++I++ P     K
Sbjct: 533 ETDAGRAANRRVDIRLVPEAGACK 556


>gi|188997203|ref|YP_001931454.1| OmpA/MotB domain protein [Sulfurihydrogenibium sp. YO3AOP1]
 gi|188932270|gb|ACD66900.1| OmpA/MotB domain protein [Sulfurihydrogenibium sp. YO3AOP1]
          Length = 260

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 38/113 (33%), Positives = 65/113 (57%), Gaps = 2/113 (1%)

Query: 70  DMITCYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLI 129
           D IT  + VH  +++   ++K++LP L ++A  L   P   + I+ +TD+IG+ K N  +
Sbjct: 145 DAITQPVRVHF-YLNSSKIKKEYLPYLNIVAKYLKTHPDVKVKIKGYTDNIGSKKYNDKL 203

Query: 130 SQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           + +RA  +K YL++ GVS NR I + G      I +N+ ++ R  N+R E  I
Sbjct: 204 ALKRAKTVKQYLVKLGVSPNR-IMIDGVGKSEYIVSNNNELDRFTNRRAEFYI 255


>gi|33597667|ref|NP_885310.1| outer membrane protein A precursor [Bordetella parapertussis 12822]
 gi|33602447|ref|NP_890007.1| outer membrane protein A precursor [Bordetella bronchiseptica RB50]
 gi|33574095|emb|CAE38420.1| outer membrane protein A precursor [Bordetella parapertussis]
 gi|33576886|emb|CAE33966.1| outer membrane protein A precursor [Bordetella bronchiseptica RB50]
          Length = 193

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 33/74 (44%), Positives = 47/74 (63%), Gaps = 2/74 (2%)

Query: 109 TVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDT 168
           T+IA+  HTDSIGT   N  +S+ RA  +K+YL+ +G+  NR I   G     PI +N T
Sbjct: 116 TIIAV-GHTDSIGTEAYNQKLSERRAAAVKTYLVSKGIDPNR-IYTEGKGELQPIASNKT 173

Query: 169 KVGRQNNQRIEIQI 182
           + GR  N+R+EI+I
Sbjct: 174 REGRAQNRRVEIEI 187


>gi|332668211|ref|YP_004450999.1| OmpA/MotB domain-containing protein [Haliscomenobacter hydrossis
           DSM 1100]
 gi|332337025|gb|AEE54126.1| OmpA/MotB domain protein [Haliscomenobacter hydrossis DSM 1100]
          Length = 317

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 29/88 (32%), Positives = 51/88 (57%)

Query: 95  MLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISV 154
           +L +   +LN  P     I+ HTD +G  K+NLL+SQ RA  + + L  RG+ ++  + V
Sbjct: 228 ILAITVRMLNYNPEAKCRIEGHTDDVGNAKDNLLLSQSRAKAVATALKNRGIPTSVQLEV 287

Query: 155 RGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           +G+    P+ +N +  G+  N+R++I I
Sbjct: 288 KGYGSTKPVASNSSAEGKSLNRRVDIVI 315


>gi|301328313|ref|ZP_07221421.1| OmpA family protein [Escherichia coli MS 78-1]
 gi|300845245|gb|EFK73005.1| OmpA family protein [Escherichia coli MS 78-1]
          Length = 188

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 60/106 (56%), Gaps = 1/106 (0%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D  E + + +++ TG+ V+R GD I   +P +V+F  S   L+      L  +A +L +
Sbjct: 81  MDVQEAKLRDKMRGTGVSVTRSGDNIILNMPNNVTFDSSSATLKPAGANTLTGVAMVLKE 140

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRF 151
           +P T + +  +TDS G    N+ +SQ+RAD + S L  +GV ++R 
Sbjct: 141 YPKTAVNVIGYTDSTGGHDLNMRLSQQRADSVASALTPQGVDASRI 186


>gi|149371103|ref|ZP_01890698.1| OmpA domain protein [unidentified eubacterium SCB49]
 gi|149355889|gb|EDM44447.1| OmpA domain protein [unidentified eubacterium SCB49]
          Length = 466

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 56/95 (58%), Gaps = 1/95 (1%)

Query: 88  LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVS 147
           + K+    ++ +  I+N++ +    I+ H+DS G+   NL +S++RA  +K++L  +GV 
Sbjct: 371 IRKESHAAIRSMIDIMNEYKTANFLIEGHSDSSGSASYNLELSKKRAAAVKTFLESKGVD 430

Query: 148 SNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           ++R  S  GF    P  +N T  GRQ N+R+E+ +
Sbjct: 431 ASRLTS-EGFGETRPKASNSTAAGRQENRRVEVSL 464


>gi|313681313|ref|YP_004059051.1| ompa/motb domain protein [Sulfuricurvum kujiense DSM 16994]
 gi|313154173|gb|ADR32851.1| OmpA/MotB domain protein [Sulfuricurvum kujiense DSM 16994]
          Length = 367

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 36/106 (33%), Positives = 60/106 (56%), Gaps = 2/106 (1%)

Query: 78  VHVSFVSE-VFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADV 136
           +H++F ++   ++ +    +   A+ L + P+    I  HTDS  +   N  +S++RA  
Sbjct: 261 LHLNFATDSTKVDAEGAAKVAEFASFLKESPAYKANIVGHTDSTASDAYNQKLSEKRAAK 320

Query: 137 IKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           +KS LI+ GV S+R  S  G   K PI +N TK GR  N+RIE+++
Sbjct: 321 VKSMLIEDGVDSSRLTS-EGMGEKMPIASNKTKEGRAENRRIEVEL 365


>gi|33592100|ref|NP_879744.1| outer membrane protein A precursor [Bordetella pertussis Tohama I]
 gi|33571744|emb|CAE41245.1| outer membrane protein A precursor [Bordetella pertussis Tohama I]
 gi|332381516|gb|AEE66363.1| outer membrane protein A precursor [Bordetella pertussis CS]
          Length = 193

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 33/74 (44%), Positives = 47/74 (63%), Gaps = 2/74 (2%)

Query: 109 TVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDT 168
           T+IA+  HTDSIGT   N  +S+ RA  +K+YL+ +G+  NR I   G     PI +N T
Sbjct: 116 TIIAV-GHTDSIGTEAYNQKLSERRAAAVKTYLVSKGIDPNR-IYTEGKGELQPIASNKT 173

Query: 169 KVGRQNNQRIEIQI 182
           + GR  N+R+EI+I
Sbjct: 174 REGRAQNRRVEIEI 187


>gi|330504604|ref|YP_004381473.1| OmpA/MotB domain-containing protein [Pseudomonas mendocina NK-01]
 gi|328918890|gb|AEB59721.1| OmpA/MotB domain-containing protein [Pseudomonas mendocina NK-01]
          Length = 261

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 55/95 (57%), Gaps = 1/95 (1%)

Query: 88  LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVS 147
           L+   LP +  +A  L + P   + ++ +TDS+G+   N  +S+ RA+ ++  LI+ GV 
Sbjct: 153 LKSSALPNITQLARFLQENPERQVIVEGYTDSVGSASYNQGLSERRAESVRRALIRAGVE 212

Query: 148 SNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
             R ++ +G+  +YP+  N +  GR  N+R+E+ I
Sbjct: 213 PTRIVA-QGYGKEYPVADNSSDSGRAQNRRVEVTI 246


>gi|293604168|ref|ZP_06686576.1| outer membrane protein A [Achromobacter piechaudii ATCC 43553]
 gi|292817393|gb|EFF76466.1| outer membrane protein A [Achromobacter piechaudii ATCC 43553]
          Length = 193

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 34/74 (45%), Positives = 47/74 (63%), Gaps = 2/74 (2%)

Query: 109 TVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDT 168
           T+IA+  HTDSIGT   N  +S+ RA  +K+YL+ +G+  NR I   G     PI +N T
Sbjct: 117 TIIAV-GHTDSIGTEAYNQKLSERRAASVKTYLVSKGIDPNR-IYTEGKGELNPIASNKT 174

Query: 169 KVGRQNNQRIEIQI 182
           K GR  N+R+EI+I
Sbjct: 175 KEGRAQNRRVEIEI 188


>gi|347153|gb|AAC36899.1| protein F [Pseudomonas fluorescens]
          Length = 317

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 48/81 (59%), Gaps = 1/81 (1%)

Query: 99  IATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFA 158
           +A  + ++P T + +  HTDS+G    N  +SQ RAD +K  L++ GV+ +R  SV G+ 
Sbjct: 236 LADFMAQYPDTNVEVAGHTDSVGPDAYNQKLSQRRADAVKQVLVKDGVAPSRITSV-GYG 294

Query: 159 YKYPIDTNDTKVGRQNNQRIE 179
              P+  N T+ GR  N+R+E
Sbjct: 295 ESRPVADNATEAGRAVNRRVE 315


>gi|258545330|ref|ZP_05705564.1| OmpA family protein [Cardiobacterium hominis ATCC 15826]
 gi|258519433|gb|EEV88292.1| OmpA family protein [Cardiobacterium hominis ATCC 15826]
          Length = 244

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 71/125 (56%), Gaps = 3/125 (2%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGD-MITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILN 104
           +D+ +++ Q Q+ ++G+ V R+ +  I   I   V F V +  ++  F   L  IA  L 
Sbjct: 97  MDRQQEQLQQQVANSGVQVQRVNESTIQLNIQSEVLFDVDKAVIKPNFYQPLGSIAQTLQ 156

Query: 105 KFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPID 164
           ++P TV+ +   TD  G+ ++NL +SQ RA  +  YL Q+G++S RF+ V+G+  +Y   
Sbjct: 157 QYPETVVHVYGFTDGSGSPQHNLQLSQRRAQSVAQYLAQQGINSQRFV-VQGYGEQYASA 215

Query: 165 TNDTK 169
            N+ +
Sbjct: 216 ENNPQ 220


>gi|347159|gb|AAC36902.1| protein F [Pseudomonas fluorescens]
          Length = 317

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 49/81 (60%), Gaps = 1/81 (1%)

Query: 99  IATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFA 158
           +A  + ++P+T + +  HTDSIG    N  +SQ RAD +K  L++ GV+ +R  +V G+ 
Sbjct: 236 LADFMAQYPATNVEVAGHTDSIGPDAYNQKLSQRRADAVKQVLVKDGVAPSRITAV-GYG 294

Query: 159 YKYPIDTNDTKVGRQNNQRIE 179
              P+  N T+ GR  N+R+E
Sbjct: 295 ESRPVADNATEAGRAVNRRVE 315


>gi|77457455|ref|YP_346960.1| OmpA/MotB [Pseudomonas fluorescens Pf0-1]
 gi|77381458|gb|ABA72971.1| putative outer membrane protein [Pseudomonas fluorescens Pf0-1]
          Length = 364

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 38/145 (26%), Positives = 71/145 (48%), Gaps = 5/145 (3%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSE---VFLEKKFLPMLQLIATIL 103
           LD  E   +  ++D+ + + R  +++    PV  SF  +   + L     P  + +A IL
Sbjct: 136 LDDYEPRLRTAIKDSNLQLERRENVLVVTAPVEGSFNPDRPAMLLPVTLGPFTR-VAKIL 194

Query: 104 NKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPI 163
              P T + +  H+D+ G    N+ +SQERA  + +     G+  +R + +RG   + P 
Sbjct: 195 EADPKTAVLVLGHSDTTGAAPANVKLSQERAQAVAAIFRLSGLQRDRLM-LRGMGSEAPR 253

Query: 164 DTNDTKVGRQNNQRIEIQIFPRGNI 188
             ND+  GR  N+R+E+ + P+  +
Sbjct: 254 AANDSVEGRALNRRVELLVTPQNTM 278


>gi|148252339|ref|YP_001236924.1| OmpA domain-containing protein [Bradyrhizobium sp. BTAi1]
 gi|146404512|gb|ABQ33018.1| putative outer membrane protein with ompA domain [Bradyrhizobium
           sp. BTAi1]
          Length = 464

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 30/92 (32%), Positives = 51/92 (55%), Gaps = 1/92 (1%)

Query: 88  LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVS 147
           L++    +L  +  I  + P+  + I  HTD+ G    N  +S++RA  +  YL++ G+ 
Sbjct: 370 LDRDSTGLLDRLVEIAMRCPAANVEIAGHTDAEGDAAANQALSEKRAQAVVDYLVKAGLP 429

Query: 148 SNRFISVRGFAYKYPIDTNDTKVGRQNNQRIE 179
           + RF +V G+    P+ +NDT  GR  N+RIE
Sbjct: 430 AERFTAV-GYGSAQPVASNDTGDGRAQNRRIE 460


>gi|116623978|ref|YP_826134.1| OmpA/MotB domain-containing protein [Candidatus Solibacter usitatus
           Ellin6076]
 gi|116227140|gb|ABJ85849.1| OmpA/MotB domain protein [Candidatus Solibacter usitatus Ellin6076]
          Length = 388

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 29/89 (32%), Positives = 54/89 (60%), Gaps = 1/89 (1%)

Query: 96  LQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVR 155
           L  IAT+LN  P   + I  +TD++G+ ++NL +S+ RA+ + + L++ GV   RF +  
Sbjct: 301 LNNIATVLNNCPGVRLDIAGYTDNVGSAESNLRLSRNRANSVVAVLVKEGVPRERF-NAE 359

Query: 156 GFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           G+  + P+  N  + GR  N+R+ +++ P
Sbjct: 360 GYGEEDPVADNSIEQGRAQNRRVAMRVAP 388


>gi|330958963|gb|EGH59223.1| OprF [Pseudomonas syringae pv. maculicola str. ES4326]
          Length = 344

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 52/88 (59%), Gaps = 2/88 (2%)

Query: 96  LQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLI-QRGVSSNRFISV 154
           ++ +A  + ++PST   ++ HTDS+G    N  +S+ RA+ +K  L+ Q GV + R  SV
Sbjct: 253 IKNLADFMQQYPSTTTTVEGHTDSVGPDAYNQKLSERRANAVKQVLVNQYGVGAGRVNSV 312

Query: 155 RGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
            G+    P+  N T+ GR  N+R+E Q+
Sbjct: 313 -GYGESRPVADNATEAGRAVNRRVEAQV 339


>gi|152995560|ref|YP_001340395.1| OmpA/MotB domain-containing protein [Marinomonas sp. MWYL1]
 gi|150836484|gb|ABR70460.1| OmpA/MotB domain protein [Marinomonas sp. MWYL1]
          Length = 296

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 34/88 (38%), Positives = 56/88 (63%), Gaps = 2/88 (2%)

Query: 96  LQLIATILNKFPST-VIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISV 154
           L L+A  ++  PS   I I  HTD IG+ ++N  +S+ RA+ + SYL+++GV + + IS 
Sbjct: 203 LDLVALYVSSDPSVEYIYIDGHTDVIGSRRDNRELSKVRAEKVTSYLLEKGVPAGKIIS- 261

Query: 155 RGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           R    +YP  TN+T  GR+ N+R+ I++
Sbjct: 262 RYHGERYPSTTNNTAQGRERNRRVTIRL 289


>gi|310817591|ref|YP_003949949.1| outer membrane protein [Stigmatella aurantiaca DW4/3-1]
 gi|309390663|gb|ADO68122.1| outer membrane protein [Stigmatella aurantiaca DW4/3-1]
          Length = 632

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 29/86 (33%), Positives = 52/86 (60%), Gaps = 2/86 (2%)

Query: 95  MLQLIATILNKFPSTV-IAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFIS 153
           +L  +A +LN+ P  V + I+ HTD  G    N  +S++RAD ++ YL+++GV++ R + 
Sbjct: 534 LLDQMAKLLNEHPEIVSVLIEGHTDDRGAADYNRTLSKQRADTVRDYLVKKGVAAER-LE 592

Query: 154 VRGFAYKYPIDTNDTKVGRQNNQRIE 179
            +G+    P+  N T  GR  N+R++
Sbjct: 593 TQGYGPDRPVQPNTTAAGRTANRRVD 618


>gi|256823578|ref|YP_003147541.1| OmpA/MotB domain-containing protein [Kangiella koreensis DSM 16069]
 gi|256797117|gb|ACV27773.1| OmpA/MotB domain protein [Kangiella koreensis DSM 16069]
          Length = 377

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 31/84 (36%), Positives = 51/84 (60%), Gaps = 2/84 (2%)

Query: 99  IATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQR-GVSSNRFISVRGF 157
           +A  L ++PS    IQ HTDS+G+   N  +S+ RA+ +K YL+   G++++R +S +G+
Sbjct: 288 VAEFLRQYPSVNAEIQGHTDSVGSSAYNQGLSERRANSVKDYLVSNFGINASR-LSAKGY 346

Query: 158 AYKYPIDTNDTKVGRQNNQRIEIQ 181
             + PI  N T+ GR  N+R E  
Sbjct: 347 GEEEPIADNSTEEGRALNRRAEAH 370


>gi|115373807|ref|ZP_01461100.1| thrombospondin type 3 repeat family [Stigmatella aurantiaca
           DW4/3-1]
 gi|115369206|gb|EAU68148.1| thrombospondin type 3 repeat family [Stigmatella aurantiaca
           DW4/3-1]
          Length = 663

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 29/86 (33%), Positives = 52/86 (60%), Gaps = 2/86 (2%)

Query: 95  MLQLIATILNKFPSTV-IAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFIS 153
           +L  +A +LN+ P  V + I+ HTD  G    N  +S++RAD ++ YL+++GV++ R + 
Sbjct: 565 LLDQMAKLLNEHPEIVSVLIEGHTDDRGAADYNRTLSKQRADTVRDYLVKKGVAAER-LE 623

Query: 154 VRGFAYKYPIDTNDTKVGRQNNQRIE 179
            +G+    P+  N T  GR  N+R++
Sbjct: 624 TQGYGPDRPVQPNTTAAGRTANRRVD 649


>gi|114777177|ref|ZP_01452188.1| outer membrane protein [Mariprofundus ferrooxydans PV-1]
 gi|114552322|gb|EAU54805.1| outer membrane protein [Mariprofundus ferrooxydans PV-1]
          Length = 212

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 53/87 (60%), Gaps = 2/87 (2%)

Query: 97  QLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRG 156
           + +AT LN+  +  + + +HTDS G+   NL +S+ RA  ++ YL+  G+ + R  S +G
Sbjct: 127 KAVAT-LNRRATIKVEVAAHTDSSGSDAYNLSLSERRAASVRDYLVAHGIDAARLTS-KG 184

Query: 157 FAYKYPIDTNDTKVGRQNNQRIEIQIF 183
           +    PI +N TK GR  N+R+E+++ 
Sbjct: 185 YGETQPIASNATKEGRAKNRRVELRVM 211


>gi|319762553|ref|YP_004126490.1| ompa/motb domain protein [Alicycliphilus denitrificans BC]
 gi|317117114|gb|ADU99602.1| OmpA/MotB domain protein [Alicycliphilus denitrificans BC]
          Length = 240

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 46/73 (63%), Gaps = 2/73 (2%)

Query: 110 VIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTK 169
           +IA+  HTDSIGT   N  +S  RA+ +K+YL+ +G+  NR +   G   K PI  N TK
Sbjct: 164 IIAV-GHTDSIGTDAYNQKLSVRRAEAVKAYLVSKGIEKNR-VYTEGKGEKQPIADNKTK 221

Query: 170 VGRQNNQRIEIQI 182
            GR  N+R+EI++
Sbjct: 222 EGRAKNRRVEIEV 234


>gi|330824570|ref|YP_004387873.1| OmpA/MotB domain-containing protein [Alicycliphilus denitrificans
           K601]
 gi|329309942|gb|AEB84357.1| OmpA/MotB domain protein [Alicycliphilus denitrificans K601]
          Length = 219

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 46/73 (63%), Gaps = 2/73 (2%)

Query: 110 VIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTK 169
           +IA+  HTDSIGT   N  +S  RA+ +K+YL+ +G+  NR +   G   K PI  N TK
Sbjct: 143 IIAV-GHTDSIGTDAYNQKLSVRRAEAVKAYLVSKGIEKNR-VYTEGKGEKQPIADNKTK 200

Query: 170 VGRQNNQRIEIQI 182
            GR  N+R+EI++
Sbjct: 201 EGRAKNRRVEIEV 213


>gi|260549981|ref|ZP_05824196.1| OmpA family protein [Acinetobacter sp. RUH2624]
 gi|260406973|gb|EEX00451.1| OmpA family protein [Acinetobacter sp. RUH2624]
          Length = 472

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 35/103 (33%), Positives = 56/103 (54%), Gaps = 3/103 (2%)

Query: 80  VSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKS 139
            S  SE+  + K +  L   AT+LNK  S  + +  HTDS G    N  +SQ RA  +  
Sbjct: 371 ASGSSEIPADNKAI--LDQAATLLNKVTSVKLNVGGHTDSTGNAAANKALSQRRAQAVVD 428

Query: 140 YLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           YL+ +GV +++ ++ +G   + P+  N T+ GR  N+RIE  +
Sbjct: 429 YLVSKGVDASKLVA-QGHGSENPVAENTTEEGRFKNRRIEFSV 470


>gi|159042678|ref|YP_001531472.1| OmpA/MotB domain-containing protein [Dinoroseobacter shibae DFL 12]
 gi|157910438|gb|ABV91871.1| OmpA/MotB domain protein [Dinoroseobacter shibae DFL 12]
          Length = 310

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 35/93 (37%), Positives = 52/93 (55%), Gaps = 2/93 (2%)

Query: 88  LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQ-RGV 146
           LE    P L  +A  L + P  VIA+  HTD+ G++  NL +S  RA+ ++  L+   GV
Sbjct: 213 LENGQYPSLTALAGFLTENPDLVIALVGHTDAEGSIDANLALSMRRAEAVRDRLVADYGV 272

Query: 147 SSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIE 179
           +S R +   G  Y  P  TN T+ GR+ N+R+E
Sbjct: 273 ASER-LRAEGVGYLAPRATNRTEEGRRANRRVE 304


>gi|313675126|ref|YP_004053122.1| ompa/motb domain protein [Marivirga tractuosa DSM 4126]
 gi|312941824|gb|ADR21014.1| OmpA/MotB domain protein [Marivirga tractuosa DSM 4126]
          Length = 699

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 56/100 (56%), Gaps = 2/100 (2%)

Query: 84  SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQ 143
           S    E  F  + ++I  ++  +PS  I I +HTD +G+   N  +SQERA+ + SY+  
Sbjct: 594 SSALFESSFEELDRVIK-LMKSYPSMKIEIAAHTDDVGSAAYNTRLSQERANSVISYITG 652

Query: 144 RGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
             ++  R IS +G+    P+  ND++  R  N+R+E++I 
Sbjct: 653 NSIAEGRLIS-KGYGESKPVVANDSEENRAKNRRVELKIL 691


>gi|237803660|ref|ZP_04591245.1| OprF [Pseudomonas syringae pv. oryzae str. 1_6]
 gi|331025642|gb|EGI05698.1| OprF [Pseudomonas syringae pv. oryzae str. 1_6]
          Length = 344

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 52/88 (59%), Gaps = 2/88 (2%)

Query: 96  LQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLI-QRGVSSNRFISV 154
           ++ +A  + ++PST   ++ HTDS+G    N  +S+ RA+ +K  L+ Q GV + R  SV
Sbjct: 253 IKNLADFMQQYPSTTTTVEGHTDSVGPDAYNQKLSERRANAVKQVLVNQYGVGAGRVNSV 312

Query: 155 RGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
            G+    P+  N T+ GR  N+R+E Q+
Sbjct: 313 -GYGESRPVADNATEAGRAVNRRVEAQV 339


>gi|157889016|dbj|BAF80962.1| fibronectin-binding protein [Campylobacter lari]
          Length = 328

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 35/122 (28%), Positives = 62/122 (50%), Gaps = 2/122 (1%)

Query: 62  GIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIG 121
           G ++  IG   T  +  +  F  ++ +  +F   +Q +  +L + P     ++ HTDS G
Sbjct: 206 GALLDHIGCEKTIALEGYFGF-DQISINPEFAQKIQEVGKVLEENPQYYTILEGHTDSTG 264

Query: 122 TLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQ 181
           +   N  +S ERA  +   L + GV   + I+ +G+ +  P  +NDTK GR  N+R+E +
Sbjct: 265 SKTYNQKLSLERAKAVAKELEKSGVVKEK-IATKGYGFDKPKASNDTKEGRAQNRRVEAK 323

Query: 182 IF 183
            F
Sbjct: 324 FF 325


>gi|161526078|ref|YP_001581090.1| OmpA/MotB domain-containing protein [Burkholderia multivorans ATCC
           17616]
 gi|189349207|ref|YP_001944835.1| OOP family OmpA-OmpF porin [Burkholderia multivorans ATCC 17616]
 gi|160343507|gb|ABX16593.1| OmpA/MotB domain protein [Burkholderia multivorans ATCC 17616]
 gi|189333229|dbj|BAG42299.1| OOP family OmpA-OmpF porin [Burkholderia multivorans ATCC 17616]
          Length = 316

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 49/88 (55%), Gaps = 1/88 (1%)

Query: 95  MLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISV 154
           +L  +A  L K  +  + I  HTD+ G   +N+ +SQ RAD +K YLI +G++  +  + 
Sbjct: 228 ILDQMAAALAKLQNRTVDIIGHTDNSGNRTSNIALSQARADAVKGYLITKGIAPQQMTTT 287

Query: 155 RGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
            G     PI  NDT  GR  N+RIE ++
Sbjct: 288 -GVGPDQPIAPNDTAEGRARNRRIEFRV 314


>gi|262066235|ref|ZP_06025847.1| fibronectin-binding protein [Fusobacterium periodonticum ATCC
           33693]
 gi|291380091|gb|EFE87609.1| fibronectin-binding protein [Fusobacterium periodonticum ATCC
           33693]
          Length = 82

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 49/75 (65%)

Query: 111 IAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKV 170
           + ++ HTDSIG+ + N+ +S+ RA+ +K+ LI+ G++  R + +     +YP+ TN+T  
Sbjct: 8   VTLEGHTDSIGSNQYNIGLSRRRAEAVKAKLIEFGLAEERIVGIEAKGEEYPVATNETPE 67

Query: 171 GRQNNQRIEIQIFPR 185
           GR  N+R+E ++  R
Sbjct: 68  GRLQNRRVEFRLVQR 82


>gi|153002489|ref|YP_001368170.1| OmpA/MotB domain-containing protein [Shewanella baltica OS185]
 gi|217975056|ref|YP_002359807.1| OmpA/MotB domain-containing protein [Shewanella baltica OS223]
 gi|151367107|gb|ABS10107.1| OmpA/MotB domain protein [Shewanella baltica OS185]
 gi|217500191|gb|ACK48384.1| OmpA/MotB domain protein [Shewanella baltica OS223]
          Length = 202

 Score = 63.5 bits (153), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 56/98 (57%), Gaps = 2/98 (2%)

Query: 86  VFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQR- 144
            ++  ++ P ++ +A  L ++P+T + I+ HT   GT + NL++SQERAD + + L +R 
Sbjct: 85  AYIAPEYYPQIEEVAVFLQQYPTTKVTIEGHTSRTGTDERNLVLSQERADAVTAVLAERF 144

Query: 145 GVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           G+  NR ++ +G+    P+    T      N+R+  ++
Sbjct: 145 GIDRNR-LTAKGYGSSNPVVLERTPEAEIRNRRVVAEV 181


>gi|262065804|ref|ZP_06025416.1| outer membrane protein [Fusobacterium periodonticum ATCC 33693]
 gi|291380509|gb|EFE88027.1| outer membrane protein [Fusobacterium periodonticum ATCC 33693]
          Length = 171

 Score = 63.2 bits (152), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 49/75 (65%)

Query: 111 IAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKV 170
           + ++ HTDSIG+ + N+ +S+ RA+ +K+ LI+ G++  R + +     +YP+ TN+T  
Sbjct: 97  VTLEGHTDSIGSNQYNIGLSRRRAEAVKAKLIEFGLAEERIVGIEAKGEEYPVATNETPE 156

Query: 171 GRQNNQRIEIQIFPR 185
           GR  N+R+E ++  R
Sbjct: 157 GRLQNRRVEFRLVQR 171


>gi|255533611|ref|YP_003093983.1| OmpA/MotB domain-containing protein [Pedobacter heparinus DSM 2366]
 gi|255346595|gb|ACU05921.1| OmpA/MotB domain protein [Pedobacter heparinus DSM 2366]
          Length = 440

 Score = 63.2 bits (152), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 47/73 (64%), Gaps = 1/73 (1%)

Query: 111 IAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKV 170
           + +  HTD+ G+   N+ +S++RA+ +K+YL+ +G +++R I   G+    PI +N T  
Sbjct: 369 LKLAGHTDNTGSAALNMRLSKDRAESVKAYLVSQGANASR-IEATGYGMNQPIASNKTAA 427

Query: 171 GRQNNQRIEIQIF 183
           GRQ N+R+E  +F
Sbjct: 428 GRQQNRRVEFTLF 440


>gi|113867012|ref|YP_725501.1| outer membrane protein and related peptidoglycan-associated
           (lipo)proteins [Ralstonia eutropha H16]
 gi|113525788|emb|CAJ92133.1| outer membrane protein and related peptidoglycan-associated
           (lipo)proteins [Ralstonia eutropha H16]
          Length = 308

 Score = 63.2 bits (152), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 48/87 (55%), Gaps = 1/87 (1%)

Query: 94  PMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFIS 153
           P+L   A  +   P   + ++ HTDS G    N  +S+ RA  ++ YL   GV ++R + 
Sbjct: 220 PLLDRAAKAVLAHPDWRLRVEGHTDSTGGDARNQPLSERRAAAVRRYLESAGVPADR-LD 278

Query: 154 VRGFAYKYPIDTNDTKVGRQNNQRIEI 180
            +G+   +P+ +NDT  GR  N+R+E+
Sbjct: 279 AKGYGATHPLMSNDTPFGRAQNRRVEL 305


>gi|262066137|ref|ZP_06025749.1| fibronectin-binding protein [Fusobacterium periodonticum ATCC
           33693]
 gi|291380232|gb|EFE87750.1| fibronectin-binding protein [Fusobacterium periodonticum ATCC
           33693]
          Length = 93

 Score = 63.2 bits (152), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 49/75 (65%)

Query: 111 IAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKV 170
           + ++ HTDSIG+ + N+ +S+ RA+ +K+ LI+ G++  R + +     +YP+ TN+T  
Sbjct: 19  VTLEGHTDSIGSNQYNIGLSRRRAEAVKAKLIEFGLAEERIVGIEAKGEEYPVATNETPE 78

Query: 171 GRQNNQRIEIQIFPR 185
           GR  N+R+E ++  R
Sbjct: 79  GRLQNRRVEFRLVQR 93


>gi|311104908|ref|YP_003977761.1| outer membrane protein A [Achromobacter xylosoxidans A8]
 gi|310759597|gb|ADP15046.1| outer membrane protein A [Achromobacter xylosoxidans A8]
          Length = 193

 Score = 63.2 bits (152), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 34/74 (45%), Positives = 47/74 (63%), Gaps = 2/74 (2%)

Query: 109 TVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDT 168
           T+IA+  HTDSIGT   N  +S+ RA  +K+YL+ +G+  NR I   G     PI +N T
Sbjct: 117 TIIAV-GHTDSIGTEAYNQKLSERRAASVKTYLVSKGIDPNR-IYTEGKGELNPIASNKT 174

Query: 169 KVGRQNNQRIEIQI 182
           K GR  N+R+EI+I
Sbjct: 175 KEGRAQNRRVEIEI 188


>gi|347163|gb|AAA62423.1| protein F [Pseudomonas fluorescens]
          Length = 317

 Score = 63.2 bits (152), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 49/81 (60%), Gaps = 1/81 (1%)

Query: 99  IATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFA 158
           +A  + ++P+T + +  HTDS+G    N  +SQ RAD +K  L++ GV+ +R  +V G+ 
Sbjct: 236 LADFMAQYPATNVEVAGHTDSVGPDAYNQKLSQRRADAVKQVLVKDGVAPSRVTAV-GYG 294

Query: 159 YKYPIDTNDTKVGRQNNQRIE 179
              P+  N T+ GR  N+R+E
Sbjct: 295 ESRPVADNATEAGRAVNRRVE 315


>gi|189464066|ref|ZP_03012851.1| hypothetical protein BACINT_00401 [Bacteroides intestinalis DSM
           17393]
 gi|198275155|ref|ZP_03207686.1| hypothetical protein BACPLE_01313 [Bacteroides plebeius DSM 17135]
 gi|298482396|ref|ZP_07000582.1| outer membrane protein [Bacteroides sp. D22]
 gi|189438400|gb|EDV07385.1| hypothetical protein BACINT_00401 [Bacteroides intestinalis DSM
           17393]
 gi|198271975|gb|EDY96245.1| hypothetical protein BACPLE_01313 [Bacteroides plebeius DSM 17135]
 gi|298271375|gb|EFI12950.1| outer membrane protein [Bacteroides sp. D22]
          Length = 213

 Score = 63.2 bits (152), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 55/93 (59%), Gaps = 1/93 (1%)

Query: 88  LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVS 147
           L ++   ML  +  I+++ P+T I I  HTD+IG  + N+++S+ RA  + +YL   G+ 
Sbjct: 115 LNEEAQKMLSDLCNIISEIPNTKIKIIGHTDNIGEKQYNIILSKNRAAAVGNYLRTAGIE 174

Query: 148 SNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEI 180
           +N  I+  G  Y  PI  N ++ GR  N+R+EI
Sbjct: 175 TNN-ITEDGKGYSEPIADNTSEAGRAKNRRVEI 206


>gi|254302309|ref|ZP_04969667.1| OmpA family outer membrane protein [Fusobacterium nucleatum subsp.
           polymorphum ATCC 10953]
 gi|148322501|gb|EDK87751.1| OmpA family outer membrane protein [Fusobacterium nucleatum subsp.
           polymorphum ATCC 10953]
          Length = 189

 Score = 63.2 bits (152), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 49/79 (62%)

Query: 111 IAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKV 170
           I I  HTDSIG+   N  +S+ RA+ +K+ L++ G++ +R + +     + PI TN+TK 
Sbjct: 99  ITIVGHTDSIGSNAYNFKLSRRRAESVKAKLLEFGLTEDRIVGIEAMGEEQPIATNETKE 158

Query: 171 GRQNNQRIEIQIFPRGNIK 189
           GR  N+R+E ++  R  ++
Sbjct: 159 GRAQNRRVEFKLVQRETVQ 177


>gi|330810957|ref|YP_004355419.1| lipoprotein [Pseudomonas brassicacearum subsp. brassicacearum
           NFM421]
 gi|327379065|gb|AEA70415.1| putative lipoprotein [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 269

 Score = 63.2 bits (152), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/82 (37%), Positives = 47/82 (57%), Gaps = 1/82 (1%)

Query: 99  IATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFA 158
           I   L   P  V+ I+ +TDS G  + NL +S++RA  +   L+  GV   R I V G+ 
Sbjct: 176 IVQFLQLNPKRVVRIEGYTDSTGGKQENLKLSRDRAQAVADVLVDLGVDEKR-IQVEGYG 234

Query: 159 YKYPIDTNDTKVGRQNNQRIEI 180
            +YP+D N ++ GR  N+R+EI
Sbjct: 235 DQYPVDVNASERGRAQNRRVEI 256


>gi|296159938|ref|ZP_06842759.1| OmpA/MotB domain protein [Burkholderia sp. Ch1-1]
 gi|295889921|gb|EFG69718.1| OmpA/MotB domain protein [Burkholderia sp. Ch1-1]
          Length = 318

 Score = 63.2 bits (152), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 48/85 (56%), Gaps = 1/85 (1%)

Query: 95  MLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISV 154
           +L  +A  + K  +  +AI  HTD+ G   +N+ +SQ RAD +K YL+ +G+   +  + 
Sbjct: 230 ILDQMAAAMMKMTNKTVAIIGHTDNSGNRTSNIALSQARADAVKGYLVAKGIPPQQMTTT 289

Query: 155 RGFAYKYPIDTNDTKVGRQNNQRIE 179
            G     PI +NDT  GR  N+RIE
Sbjct: 290 -GVGPDQPIASNDTTDGRARNRRIE 313


>gi|641920|gb|AAA85840.1| protein F precursor [Pseudomonas fluorescens]
          Length = 317

 Score = 63.2 bits (152), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 49/81 (60%), Gaps = 1/81 (1%)

Query: 99  IATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFA 158
           +A  + ++P+T + +  HTDS+G    N  +SQ RAD +K  L++ GV+ +R  +V G+ 
Sbjct: 236 LADFMAQYPATNVEVAGHTDSVGPDAYNQKLSQRRADAVKQVLVKDGVAPSRITAV-GYG 294

Query: 159 YKYPIDTNDTKVGRQNNQRIE 179
              P+  N T+ GR  N+R+E
Sbjct: 295 ESRPVADNATEAGRAVNRRVE 315


>gi|77165990|ref|YP_344515.1| OmpA/MotB [Nitrosococcus oceani ATCC 19707]
 gi|76884304|gb|ABA58985.1| OmpA/MotB [Nitrosococcus oceani ATCC 19707]
          Length = 319

 Score = 63.2 bits (152), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 40/126 (31%), Positives = 60/126 (47%), Gaps = 12/126 (9%)

Query: 62  GIVVSRIGDMITCYIPV------HVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQS 115
           G+ V  +G    C  PV      H  F S   L      +L  +   +  +P   I I  
Sbjct: 195 GVDVDEVG----CPKPVVLEDGVHFGFDS-AKLSPNAHTILDKVVENMRTYPDLEITIAG 249

Query: 116 HTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNN 175
           HTDS G    N  +SQ RA+   +YL  +G+  +R  ++ G+  + PI +N TK GR  N
Sbjct: 250 HTDSTGNADYNQRLSQLRAEAAMNYLASKGIDPSRMEAI-GYGEERPIASNSTKEGRAKN 308

Query: 176 QRIEIQ 181
           +R+E+Q
Sbjct: 309 RRVELQ 314


>gi|108761291|ref|YP_633197.1| OmpA domain-containing protein [Myxococcus xanthus DK 1622]
 gi|108465171|gb|ABF90356.1| OmpA domain protein [Myxococcus xanthus DK 1622]
          Length = 640

 Score = 63.2 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 33/89 (37%), Positives = 50/89 (56%), Gaps = 2/89 (2%)

Query: 95  MLQLIATILNKFPST-VIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFIS 153
           +L  +A IL   P    + ++ HTD+ G    NL +SQ RAD +  YL+ +GV+  R + 
Sbjct: 534 LLDTVANILIAHPEVEKVRVEGHTDNRGNPDYNLDLSQRRADAVVRYLVSKGVARER-LD 592

Query: 154 VRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
            +GF    PI  N+T  GR  N+R+E +I
Sbjct: 593 AKGFGPTQPIADNNTTQGRAKNRRVEFKI 621


>gi|326794724|ref|YP_004312544.1| OmpA/MotB domain protein [Marinomonas mediterranea MMB-1]
 gi|326545488|gb|ADZ90708.1| OmpA/MotB domain protein [Marinomonas mediterranea MMB-1]
          Length = 304

 Score = 63.2 bits (152), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 58/88 (65%), Gaps = 2/88 (2%)

Query: 96  LQLIATILNKFPS-TVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISV 154
           L L+A  +N  PS   I I  HTD+IG+ ++N  +S++RA+ I +YL+++GV ++  +S 
Sbjct: 203 LDLVALYVNNDPSIQYIYIDGHTDTIGSRRDNRELSKKRAEKITAYLLEQGVPADMIVS- 261

Query: 155 RGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           R    +YP+ ++ T  GR+ N+R+ I++
Sbjct: 262 RYHGERYPVASSRTNQGRERNRRVTIRL 289


>gi|260574860|ref|ZP_05842862.1| OmpA/MotB domain protein [Rhodobacter sp. SW2]
 gi|259022865|gb|EEW26159.1| OmpA/MotB domain protein [Rhodobacter sp. SW2]
          Length = 218

 Score = 63.2 bits (152), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 41/148 (27%), Positives = 71/148 (47%), Gaps = 3/148 (2%)

Query: 38  IVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPML 96
           +V    G++LD+   + + Q+ ++  +V+  G+ +   +P  + F +    L       L
Sbjct: 70  LVGGAIGNTLDQQAADLRSQMSNS-TMVTNTGNSLVVTMPQDILFALDSANLRPDLQADL 128

Query: 97  QLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRG 156
           + ++  L  +P + I +  HTD  G+   N  +S+ RA  + + L   GV   R IS  G
Sbjct: 129 RAVSNNLLDYPDSTIEVVGHTDDSGSAAYNQDLSERRARAVAAVLRNGGVPGGR-ISAYG 187

Query: 157 FAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
                PI +N T  GR  N+R+EI I P
Sbjct: 188 RGEDQPIASNQTVNGRAQNRRVEIIIHP 215


>gi|50956536|gb|AAT90783.1| conserved hypothetical protein [uncultured proteobacterium QS1]
          Length = 575

 Score = 63.2 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 31/89 (34%), Positives = 54/89 (60%), Gaps = 2/89 (2%)

Query: 98  LIATILN--KFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVR 155
           LIA ++N    P  +I I  HTD  G+ + NL +S+ RA  ++ ++ + G   +   +V+
Sbjct: 462 LIAALVNIKAQPGWLIVIAGHTDVTGSPEQNLELSRARAASVRDWMQRMGDIPDSCFAVQ 521

Query: 156 GFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           GF    P+ +NDT+VGR  N+R++I++ P
Sbjct: 522 GFGANQPVASNDTEVGRAANRRVDIRLVP 550


>gi|332520949|ref|ZP_08397409.1| OmpA/MotB domain protein [Lacinutrix algicola 5H-3-7-4]
 gi|332043479|gb|EGI79675.1| OmpA/MotB domain protein [Lacinutrix algicola 5H-3-7-4]
          Length = 442

 Score = 63.2 bits (152), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 40/130 (30%), Positives = 67/130 (51%), Gaps = 1/130 (0%)

Query: 53  EFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIA 112
           E Q  L     +  ++ + I  Y    V    +  L  +    L  I  I+N   +    
Sbjct: 312 ERQKNLDRNAKIKQQVTNDINNYCKAIVFNYGKTSLSPEGKKALDEIYKIMNLQKNMKFH 371

Query: 113 IQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGR 172
           +  HTD++G+   NL +S++RA  +K+YLI +G+S++R ++ +G+  + PI  N T  GR
Sbjct: 372 VTGHTDNVGSKATNLALSEKRAASVKNYLITKGISNSR-VTSQGYGEENPIADNSTNEGR 430

Query: 173 QNNQRIEIQI 182
             N+RIEI I
Sbjct: 431 IKNRRIEIYI 440


>gi|319796166|ref|YP_004157806.1| ompa/motb domain protein [Variovorax paradoxus EPS]
 gi|315598629|gb|ADU39695.1| OmpA/MotB domain protein [Variovorax paradoxus EPS]
          Length = 273

 Score = 63.2 bits (152), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 32/95 (33%), Positives = 53/95 (55%), Gaps = 1/95 (1%)

Query: 88  LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVS 147
           L +K   +L  +A IL K  +  +A+  HTD+ G+  +NL +SQ RA+ +K YL+ +G+ 
Sbjct: 177 LTRKGRDILDEMAPILQKLTNKSVAVIGHTDNAGSRASNLALSQSRAEAVKGYLVGKGID 236

Query: 148 SNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
               ++  G     P+  N T  GR  N+RIE ++
Sbjct: 237 P-MTLTTSGVGPDQPVANNATDEGRSRNRRIEFRV 270


>gi|256425383|ref|YP_003126036.1| OmpA/MotB domain protein [Chitinophaga pinensis DSM 2588]
 gi|256040291|gb|ACU63835.1| OmpA/MotB domain protein [Chitinophaga pinensis DSM 2588]
          Length = 449

 Score = 63.2 bits (152), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 53/90 (58%), Gaps = 2/90 (2%)

Query: 94  PMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFIS 153
           P L  +A +L +     + +  HTD++G    N+ +S++RA+ +K YL++ G + ++  +
Sbjct: 362 PSLDRVAEML-RTKGFSLKLGGHTDNVGNATKNMALSKDRAESVKQYLVEHGANPSKIEA 420

Query: 154 VRGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
           V G+    PI +N T  GRQ N+R+E  I+
Sbjct: 421 V-GYGANQPIASNKTAAGRQKNRRVEFTIY 449


>gi|209965863|ref|YP_002298778.1| outer membrane protein OmpA (probable proton motor MotY)
           [Rhodospirillum centenum SW]
 gi|209959329|gb|ACI99965.1| outer membrane protein OmpA (probable proton motor MotY)
           [Rhodospirillum centenum SW]
          Length = 281

 Score = 63.2 bits (152), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 50/87 (57%), Gaps = 1/87 (1%)

Query: 96  LQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVR 155
           L+ +   L   P   + I+ HTDS G    N  +SQ RA+ ++ +L+ +G+ + R I+ R
Sbjct: 184 LRPLVEYLRSQPDRAVLIEGHTDSQGPAAYNEELSQRRAEAVRDFLVDQGIQAAR-ITTR 242

Query: 156 GFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           G     P+ +N+T+ GR  N+RIE+ +
Sbjct: 243 GLGEGVPVASNETQAGRLQNRRIEVTV 269


>gi|126740854|ref|ZP_01756539.1| OmpA domain protein [Roseobacter sp. SK209-2-6]
 gi|126718150|gb|EBA14867.1| OmpA domain protein [Roseobacter sp. SK209-2-6]
          Length = 308

 Score = 63.2 bits (152), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 51/94 (54%)

Query: 86  VFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRG 145
           V L ++ +  L+ +A  L   P   + I  HTDS+G+L +N  +S+ RA+ ++  LI+  
Sbjct: 208 VRLGQRAVQSLEELAQFLKDHPEARVLIVGHTDSVGSLASNRSLSERRAEAVRGALIENS 267

Query: 146 VSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIE 179
              N  +   G  Y  PI +N +  GR+ N+R+E
Sbjct: 268 GIDNARVQATGVGYAAPIASNLSPAGREKNRRVE 301


>gi|4530367|gb|AAD22006.1| major outer membrane protein [Pseudomonas fluorescens]
          Length = 344

 Score = 63.2 bits (152), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 37/116 (31%), Positives = 60/116 (51%), Gaps = 3/116 (2%)

Query: 68  IGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNL 127
           + +++   + V   F   V  E  +  +  L A  + ++PST   ++ HTDS+G    N 
Sbjct: 226 VAEVVRVELDVKFDFDKSVVKENSYGDIKNL-ADFMKQYPSTSTTVEGHTDSVGPDAYNQ 284

Query: 128 LISQERADVIKSYLI-QRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
            +S+ RA+ +K  L  Q GV S+R  SV G+    P+  N T  GR  N+R+E Q+
Sbjct: 285 KLSERRANAVKQVLTNQYGVESSRVQSV-GYGESRPVADNATDAGRAVNRRVEAQV 339


>gi|221213356|ref|ZP_03586331.1| OmpA/MotB domain protein [Burkholderia multivorans CGD1]
 gi|221166808|gb|EED99279.1| OmpA/MotB domain protein [Burkholderia multivorans CGD1]
          Length = 316

 Score = 63.2 bits (152), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 49/88 (55%), Gaps = 1/88 (1%)

Query: 95  MLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISV 154
           +L  +A  L K  +  + I  HTD+ G   +N+ +SQ RAD +K YLI +G++  +  + 
Sbjct: 228 ILDQMAAALAKLQNRTVDIIGHTDNSGNRTSNIALSQARADAVKGYLITKGIAPQQMTTT 287

Query: 155 RGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
            G     PI  NDT  GR  N+RIE ++
Sbjct: 288 -GVGPDQPIAPNDTADGRARNRRIEFRV 314


>gi|328473467|gb|EGF44315.1| outer membrane protein OmpA [Vibrio parahaemolyticus 10329]
          Length = 319

 Score = 63.2 bits (152), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 51/85 (60%), Gaps = 1/85 (1%)

Query: 96  LQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVR 155
           L  +   LN+ P   + +  +TD+ G    N  +S++RA+ + + L+++G+ ++R I  R
Sbjct: 225 LDNLVAFLNEHPQAKVEVVGYTDTSGAAAYNQKVSEKRAESVANALVEKGIDASR-IQAR 283

Query: 156 GFAYKYPIDTNDTKVGRQNNQRIEI 180
           G     PI +NDT+ GRQ N+R+EI
Sbjct: 284 GEGENNPIASNDTREGRQQNRRVEI 308


>gi|289766688|ref|ZP_06526066.1| outer membrane protein [Fusobacterium sp. D11]
 gi|289718243|gb|EFD82255.1| outer membrane protein [Fusobacterium sp. D11]
          Length = 180

 Score = 63.2 bits (152), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 50/80 (62%)

Query: 111 IAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKV 170
           I I  HTDSIG+ + N  +S+ RA+ +K+ L++ G++ +R + +     + PI TN TK 
Sbjct: 90  ITIVGHTDSIGSNQYNFGLSRRRAEAVKAKLLEFGLAEDRIVGIEAMGEEQPIATNATKE 149

Query: 171 GRQNNQRIEIQIFPRGNIKK 190
           GR  N+R+E ++  R  +++
Sbjct: 150 GRAQNRRVEFKLVQREAVQE 169


>gi|119472858|ref|ZP_01614765.1| putative Component of sodium-driven polar flagellar motor
           [Alteromonadales bacterium TW-7]
 gi|119444690|gb|EAW25997.1| putative Component of sodium-driven polar flagellar motor
           [Alteromonadales bacterium TW-7]
          Length = 292

 Score = 63.2 bits (152), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 33/72 (45%), Positives = 46/72 (63%), Gaps = 1/72 (1%)

Query: 111 IAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKV 170
           I+I S+TDS G   NNL +S++RA  IK Y++  GV  N+ +   GF  K  +DTND  +
Sbjct: 219 ISIDSYTDSYGGRWNNLDLSRKRAKAIKDYMVSLGVDENK-VKTTGFGEKRFVDTNDNIL 277

Query: 171 GRQNNQRIEIQI 182
           GR  N+R+ IQI
Sbjct: 278 GRDKNRRLVIQI 289


>gi|28897538|ref|NP_797143.1| outer membrane protein OmpA [Vibrio parahaemolyticus RIMD 2210633]
 gi|153839084|ref|ZP_01991751.1| outer membrane protein OmpA [Vibrio parahaemolyticus AQ3810]
 gi|260364598|ref|ZP_05777200.1| outer membrane protein OmpA [Vibrio parahaemolyticus K5030]
 gi|260878297|ref|ZP_05890652.1| outer membrane protein OmpA [Vibrio parahaemolyticus AN-5034]
 gi|260898127|ref|ZP_05906623.1| outer membrane protein OmpA [Vibrio parahaemolyticus Peru-466]
 gi|260901940|ref|ZP_05910335.1| outer membrane protein OmpA [Vibrio parahaemolyticus AQ4037]
 gi|28805750|dbj|BAC59027.1| outer membrane protein OmpA [Vibrio parahaemolyticus RIMD 2210633]
 gi|149747422|gb|EDM58382.1| outer membrane protein OmpA [Vibrio parahaemolyticus AQ3810]
 gi|308086135|gb|EFO35830.1| outer membrane protein OmpA [Vibrio parahaemolyticus Peru-466]
 gi|308090168|gb|EFO39863.1| outer membrane protein OmpA [Vibrio parahaemolyticus AN-5034]
 gi|308106787|gb|EFO44327.1| outer membrane protein OmpA [Vibrio parahaemolyticus AQ4037]
 gi|308115125|gb|EFO52665.1| outer membrane protein OmpA [Vibrio parahaemolyticus K5030]
          Length = 319

 Score = 63.2 bits (152), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 51/85 (60%), Gaps = 1/85 (1%)

Query: 96  LQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVR 155
           L  +   LN+ P   + +  +TD+ G    N  +S++RA+ + + L+++G+ ++R I  R
Sbjct: 225 LDNLVAFLNEHPQAKVEVVGYTDTSGAAAYNQKVSEKRAESVANALVEKGIDASR-IQAR 283

Query: 156 GFAYKYPIDTNDTKVGRQNNQRIEI 180
           G     PI +NDT+ GRQ N+R+EI
Sbjct: 284 GEGENNPIASNDTREGRQQNRRVEI 308


>gi|28869391|ref|NP_792010.1| ompA family protein [Pseudomonas syringae pv. tomato str. DC3000]
 gi|213968194|ref|ZP_03396339.1| ompA family protein [Pseudomonas syringae pv. tomato T1]
 gi|301383801|ref|ZP_07232219.1| ompA family protein [Pseudomonas syringae pv. tomato Max13]
 gi|302060757|ref|ZP_07252298.1| ompA family protein [Pseudomonas syringae pv. tomato K40]
 gi|302131856|ref|ZP_07257846.1| ompA family protein [Pseudomonas syringae pv. tomato NCPPB 1108]
 gi|28852632|gb|AAO55705.1| ompA family protein [Pseudomonas syringae pv. tomato str. DC3000]
 gi|213927174|gb|EEB60724.1| ompA family protein [Pseudomonas syringae pv. tomato T1]
 gi|331018607|gb|EGH98663.1| ompA family protein [Pseudomonas syringae pv. lachrymans str.
           M302278PT]
          Length = 271

 Score = 63.2 bits (152), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 66/121 (54%), Gaps = 10/121 (8%)

Query: 60  DTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDS 119
           D G+V++ +GD++  +   H    S     +  L ++Q     L   P  V+ I+ +TDS
Sbjct: 148 DRGLVMT-LGDVL--FDAGHAELKSSA--SRTILKVVQF----LQINPRRVVRIEGYTDS 198

Query: 120 IGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIE 179
            G  ++NL +S++RA  +   L+  GV   R I V G+  ++P+D N ++ GR  N+R+E
Sbjct: 199 TGDREDNLTLSKDRAQAVADVLMDLGVDDKR-IQVEGYGQQFPVDANASERGRAQNRRVE 257

Query: 180 I 180
           I
Sbjct: 258 I 258


>gi|5081412|gb|AAD39367.1|AF117972_1 outer membrane protein OprF [Pseudomonas stutzeri A15]
          Length = 321

 Score = 63.2 bits (152), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 30/82 (36%), Positives = 51/82 (62%), Gaps = 2/82 (2%)

Query: 99  IATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLI-QRGVSSNRFISVRGF 157
           +A  + ++P T   ++ HTDS+GT + N  +S+ RA+ +++ L+ + GV  NR  SV G+
Sbjct: 240 LADFMQQYPQTTTVVEGHTDSVGTDQYNQRLSERRAEAVRNVLVNEYGVQGNRVNSV-GY 298

Query: 158 AYKYPIDTNDTKVGRQNNQRIE 179
               P+  N T+ GRQ N+R+E
Sbjct: 299 GESRPVADNSTEEGRQINRRVE 320


>gi|332975535|gb|EGK12425.1| OmpA domain protein [Desmospora sp. 8437]
          Length = 243

 Score = 63.2 bits (152), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 60/110 (54%), Gaps = 2/110 (1%)

Query: 72  ITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLIS 130
           +  ++P H+ F   +  +  K  P L  +   L ++  TV  I  +TD  G+   N  +S
Sbjct: 130 VVIHVPGHILFDTDQSTIRAKARPELDKLGKSLKEYKGTV-RIYGYTDDRGSAAYNQKLS 188

Query: 131 QERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEI 180
           QERA+ +K+YL++    +   + ++GF  K+P+  N++   RQ N+R+EI
Sbjct: 189 QERAEAVKAYLVKECGIAGDHLKIKGFGKKHPVVPNNSDSNRQKNRRVEI 238


>gi|152971688|ref|YP_001336797.1| hypothetical protein KPN_03169 [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|150956537|gb|ABR78567.1| hypothetical protein KPN_03169 [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
          Length = 567

 Score = 63.2 bits (152), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 44/79 (55%)

Query: 107 PSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTN 166
           P  +I +  +TD+ G  K N  +S  RA+ ++ +++Q       F +V+G    +P  TN
Sbjct: 461 PGWLIVVTGYTDTTGNKKANQQLSLRRAEAVRDWMLQTSDIPATFFAVQGLGESHPAATN 520

Query: 167 DTKVGRQNNQRIEIQIFPR 185
           DT  GR  N+R+EI + PR
Sbjct: 521 DTPEGRAANRRVEISLVPR 539


>gi|146308382|ref|YP_001188847.1| OmpA/MotB domain-containing protein [Pseudomonas mendocina ymp]
 gi|145576583|gb|ABP86115.1| OmpA/MotB domain protein [Pseudomonas mendocina ymp]
          Length = 261

 Score = 63.2 bits (152), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 55/95 (57%), Gaps = 1/95 (1%)

Query: 88  LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVS 147
           L+   LP +  +A  L + P   + ++ +TDS+G+   N  +S+ RA+ ++  LI+ GV 
Sbjct: 153 LKSSALPNVTQLARFLQENPERQVIVEGYTDSVGSASYNQGLSERRAESVRRALIRAGVE 212

Query: 148 SNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
             R ++ +G+  +YP+  N +  GR  N+R+E+ I
Sbjct: 213 PTRIVA-QGYGKEYPVADNSSDSGRAQNRRVEVTI 246


>gi|5081413|gb|AAD39368.1|AF117973_1 outer membrane protein OprF [Pseudomonas stutzeri DSM 4166]
          Length = 323

 Score = 63.2 bits (152), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 30/82 (36%), Positives = 51/82 (62%), Gaps = 2/82 (2%)

Query: 99  IATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLI-QRGVSSNRFISVRGF 157
           +A  + ++P T   ++ HTDS+GT + N  +S+ RA+ +++ L+ + GV  NR  SV G+
Sbjct: 242 LADFMQQYPQTTTVVEGHTDSVGTDQYNQRLSERRAEAVRNVLVNEYGVQGNRVNSV-GY 300

Query: 158 AYKYPIDTNDTKVGRQNNQRIE 179
               P+  N T+ GRQ N+R+E
Sbjct: 301 GESRPVADNSTEEGRQINRRVE 322


>gi|163745388|ref|ZP_02152748.1| OmpA family domain protein [Oceanibulbus indolifex HEL-45]
 gi|161382206|gb|EDQ06615.1| OmpA family domain protein [Oceanibulbus indolifex HEL-45]
          Length = 317

 Score = 63.2 bits (152), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 29/89 (32%), Positives = 55/89 (61%), Gaps = 2/89 (2%)

Query: 96  LQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQR-GVSSNRFISV 154
           L+ +A +L   P   +A+  HTD++G+L+ N ++S++RA+ ++  L+Q   V  +R +  
Sbjct: 227 LERLAELLKADPGLRVALVGHTDAVGSLEANTVLSRKRAEAVRERLVQSYDVDPDR-LEA 285

Query: 155 RGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
           RG  Y  P  +N T+ GR+ N+R+E+ + 
Sbjct: 286 RGAGYLAPRGSNLTEAGREENRRVEVVVL 314


>gi|228469678|ref|ZP_04054646.1| immunogenic 23 kDa lipoprotein PG3 [Porphyromonas uenonis 60-3]
 gi|228308697|gb|EEK17423.1| immunogenic 23 kDa lipoprotein PG3 [Porphyromonas uenonis 60-3]
          Length = 225

 Score = 63.2 bits (152), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 47/149 (31%), Positives = 73/149 (48%), Gaps = 13/149 (8%)

Query: 43  FGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPM------- 95
            G+ +DK + E + QL + G  V  + D       + V F S +        +       
Sbjct: 69  IGNRMDKQKKELEQQLPE-GTQVESVND----GQAIKVVFDSGLLFNTSSSTLSSSSRND 123

Query: 96  LQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVR 155
           L+  A  LNK   TV+ I  HTDS G  + N  +S++RA  ++ +L  +GVSS R +   
Sbjct: 124 LRKFADNLNKNHDTVLEIIGHTDSSGNDRINDPLSRDRAKSVRDFLEGQGVSSTR-MKYE 182

Query: 156 GFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           G     P+DTN T  G++ N+R+E+ I P
Sbjct: 183 GRGSHEPVDTNATAEGKRKNRRVEVFILP 211


>gi|88704266|ref|ZP_01101980.1| motB family protein [Congregibacter litoralis KT71]
 gi|88701317|gb|EAQ98422.1| motB family protein [Congregibacter litoralis KT71]
          Length = 286

 Score = 63.2 bits (152), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 47/140 (33%), Positives = 70/140 (50%), Gaps = 6/140 (4%)

Query: 48  DKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVS-EVFLEKKFLPMLQLIATILNKF 106
           DK +D  + ++Q   + V   G  IT  I    SF S    L   F+P++  I   L + 
Sbjct: 119 DKLKDMLEDEVQTGKVDVESDGRTITVRIREQGSFPSGSATLNTDFVPVMARIREALTEI 178

Query: 107 PSTVIAIQSHTDSI----GTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYP 162
           P T I+I+ HTDS     G  ++N  +S  RA  +   L++ G+  +  + V GFA   P
Sbjct: 179 PGT-ISIEGHTDSTPLRGGRYESNWGLSSSRALSVTHELLREGLLKDDRMMVVGFADTRP 237

Query: 163 IDTNDTKVGRQNNQRIEIQI 182
              NDT  GR +N+R+EI I
Sbjct: 238 FTFNDTVEGRASNRRVEIVI 257


>gi|325106498|ref|YP_004276152.1| OmpA/MotB domain protein [Pedobacter saltans DSM 12145]
 gi|324975346|gb|ADY54330.1| OmpA/MotB domain protein [Pedobacter saltans DSM 12145]
          Length = 435

 Score = 63.2 bits (152), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 49/73 (67%), Gaps = 1/73 (1%)

Query: 111 IAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKV 170
           + +  HTD+ G+++ N+ +S+ERA+ +K+YL+ +G +++R I   G+    PI +N T  
Sbjct: 364 LKLAGHTDNTGSMELNMRLSKERAESVKAYLVSQGANASR-IEATGYGPTQPIASNKTAE 422

Query: 171 GRQNNQRIEIQIF 183
           GRQ N+R+E  ++
Sbjct: 423 GRQKNRRVEFTLY 435


>gi|206889281|ref|YP_002248656.1| chemotaxis protein MotB [Thermodesulfovibrio yellowstonii DSM
           11347]
 gi|206741219|gb|ACI20276.1| chemotaxis protein MotB [Thermodesulfovibrio yellowstonii DSM
           11347]
          Length = 213

 Score = 63.2 bits (152), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 53/92 (57%), Gaps = 6/92 (6%)

Query: 96  LQLIATILNKFPSTVIAIQSHTDSI----GTLKNNLLISQERADVIKSYLIQRGVSSNRF 151
           L  IA  L + P  V AI+ HTD+I       K+N  +S  RA  +  +L+QRG+S +RF
Sbjct: 123 LTRIAEKLKELPGKV-AIEGHTDNIPISSSVYKSNWELSAARASSVLHFLLQRGLSPDRF 181

Query: 152 ISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
           + + G+    P+ TNDT  GR  N+R+E+ I 
Sbjct: 182 L-IAGYGEYKPVATNDTDEGRAKNRRVELIIL 212


>gi|146343548|ref|YP_001208596.1| putative outer membrane protein (ompA-like) [Bradyrhizobium sp.
           ORS278]
 gi|146196354|emb|CAL80381.1| conserved hypothetical protein; putative outer membrane protein
           (ompA-like) [Bradyrhizobium sp. ORS278]
          Length = 464

 Score = 63.2 bits (152), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/92 (33%), Positives = 52/92 (56%), Gaps = 1/92 (1%)

Query: 88  LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVS 147
           L++    +L  +  I  + P+  + I  HTD+ G    N ++SQ+RA  +  YL++ G+ 
Sbjct: 370 LDRDSTGLLDRLVEIAFRCPTANVDIIGHTDAEGDSAANQVLSQKRAQAVADYLVKAGLP 429

Query: 148 SNRFISVRGFAYKYPIDTNDTKVGRQNNQRIE 179
           ++RF  + G+    PI +NDT  GR  N+RIE
Sbjct: 430 ADRFTPI-GYGSTQPIASNDTAEGRTQNRRIE 460


>gi|256028784|ref|ZP_05442618.1| Outer membrane protein [Fusobacterium sp. D11]
          Length = 191

 Score = 63.2 bits (152), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 50/80 (62%)

Query: 111 IAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKV 170
           I I  HTDSIG+ + N  +S+ RA+ +K+ L++ G++ +R + +     + PI TN TK 
Sbjct: 101 ITIVGHTDSIGSNQYNFGLSRRRAEAVKAKLLEFGLAEDRIVGIEAMGEEQPIATNATKE 160

Query: 171 GRQNNQRIEIQIFPRGNIKK 190
           GR  N+R+E ++  R  +++
Sbjct: 161 GRAQNRRVEFKLVQREAVQE 180


>gi|254436394|ref|ZP_05049900.1| Thrombospondin type 3 repeat family [Nitrosococcus oceani AFC27]
 gi|207088084|gb|EDZ65357.1| Thrombospondin type 3 repeat family [Nitrosococcus oceani AFC27]
          Length = 344

 Score = 63.2 bits (152), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 40/126 (31%), Positives = 60/126 (47%), Gaps = 12/126 (9%)

Query: 62  GIVVSRIGDMITCYIPV------HVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQS 115
           G+ V  +G    C  PV      H  F S   L      +L  +   +  +P   I I  
Sbjct: 220 GVDVDEVG----CPKPVVLEDGVHFGFDS-AKLSPNAHTILDKVVENMRTYPDLEITIAG 274

Query: 116 HTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNN 175
           HTDS G    N  +SQ RA+   +YL  +G+  +R  ++ G+  + PI +N TK GR  N
Sbjct: 275 HTDSTGNADYNQRLSQLRAEAAMNYLASKGIDPSRMEAI-GYGEERPIASNSTKEGRAKN 333

Query: 176 QRIEIQ 181
           +R+E+Q
Sbjct: 334 RRVELQ 339


>gi|198282622|ref|YP_002218943.1| OmpA/MotB domain-containing protein [Acidithiobacillus ferrooxidans
           ATCC 53993]
 gi|218667641|ref|YP_002424813.1| OmpA family protein [Acidithiobacillus ferrooxidans ATCC 23270]
 gi|198247143|gb|ACH82736.1| OmpA/MotB domain protein [Acidithiobacillus ferrooxidans ATCC
           53993]
 gi|218519854|gb|ACK80440.1| OmpA family protein [Acidithiobacillus ferrooxidans ATCC 23270]
          Length = 217

 Score = 63.2 bits (152), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 49/86 (56%), Gaps = 1/86 (1%)

Query: 95  MLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISV 154
           +L  +A+   K P  V+ +  +   +GT   NL +S+ RA  +  YL   GV+S+R + +
Sbjct: 122 VLDEVASFAKKHPEAVLDVNGYCSKVGTYAYNLKLSKLRAQSVAQYLAHHGVASDRMV-L 180

Query: 155 RGFAYKYPIDTNDTKVGRQNNQRIEI 180
           +G +Y  P+ TN T  GR  NQR+EI
Sbjct: 181 KGHSYDNPVATNATPQGRFLNQRVEI 206


>gi|118589219|ref|ZP_01546625.1| hypothetical protein SIAM614_06738 [Stappia aggregata IAM 12614]
 gi|118437919|gb|EAV44554.1| hypothetical protein SIAM614_06738 [Stappia aggregata IAM 12614]
          Length = 360

 Score = 63.2 bits (152), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/92 (33%), Positives = 53/92 (57%), Gaps = 1/92 (1%)

Query: 88  LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVS 147
           L+ +  P+L  +  I+ + P  VI +  HTDS G+  +N L+S+ RA  +K YL+ + + 
Sbjct: 265 LDPRSEPLLNSLVDIILRCPGLVIEVGGHTDSDGSDTSNQLLSERRAGAVKQYLVSKSIP 324

Query: 148 SNRFISVRGFAYKYPIDTNDTKVGRQNNQRIE 179
            +R  SV G+    P+  N +  G++ N+RIE
Sbjct: 325 ESRIKSV-GYGESRPVAANTSADGKRRNRRIE 355


>gi|261856894|ref|YP_003264177.1| OmpA/MotB domain protein [Halothiobacillus neapolitanus c2]
 gi|261837363|gb|ACX97130.1| OmpA/MotB domain protein [Halothiobacillus neapolitanus c2]
          Length = 331

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 34/83 (40%), Positives = 51/83 (61%), Gaps = 2/83 (2%)

Query: 99  IATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQR-GVSSNRFISVRGF 157
           +A +L + PS  + I  HTD  G L +NL +S++RAD +   LI R G+SSNR ++  G 
Sbjct: 247 MAKMLKQEPSAHVYIVGHTDDTGALPHNLKLSRDRADAVVKALITRYGISSNRLVA-EGV 305

Query: 158 AYKYPIDTNDTKVGRQNNQRIEI 180
           A   P+ +N +  GR  N+R+EI
Sbjct: 306 ASFAPVASNASDQGRALNRRVEI 328


>gi|159025742|emb|CAO02045.1| outer membrane protein A [Bordetella hinzii]
 gi|159025744|emb|CAO02046.1| outer membrane protein A [Bordetella hinzii]
 gi|159025746|emb|CAO02047.1| outer membrane protein A [Bordetella hinzii]
          Length = 177

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 34/74 (45%), Positives = 46/74 (62%), Gaps = 2/74 (2%)

Query: 109 TVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDT 168
           T+IA+  HTDSIGT   N  +S+ RA  +K+YL+ +G+  NR I   G     PI TN T
Sbjct: 100 TIIAV-GHTDSIGTEAYNQKLSERRAASVKAYLVSKGIDPNR-IYTEGKGELQPIATNKT 157

Query: 169 KVGRQNNQRIEIQI 182
             GR  N+R+EI+I
Sbjct: 158 AEGRARNRRVEIEI 171


>gi|121594804|ref|YP_986700.1| OmpA/MotB domain-containing protein [Acidovorax sp. JS42]
 gi|222110597|ref|YP_002552861.1| ompa/motb domain-containing protein [Acidovorax ebreus TPSY]
 gi|120606884|gb|ABM42624.1| OmpA/MotB domain protein [Acidovorax sp. JS42]
 gi|221730041|gb|ACM32861.1| OmpA/MotB domain protein [Acidovorax ebreus TPSY]
          Length = 218

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 46/73 (63%), Gaps = 2/73 (2%)

Query: 110 VIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTK 169
           +IA+  HTDSIGT   N  +S  RA+ +K+YL+ +G+  NR +   G   K P+  N TK
Sbjct: 142 IIAV-GHTDSIGTDAYNQKLSVRRAEAVKAYLVSKGIEKNR-VYTEGKGEKQPVADNKTK 199

Query: 170 VGRQNNQRIEIQI 182
            GR  N+R+EI++
Sbjct: 200 EGRAKNRRVEIEV 212


>gi|294783516|ref|ZP_06748840.1| outer membrane protein OprF [Fusobacterium sp. 1_1_41FAA]
 gi|294480394|gb|EFG28171.1| outer membrane protein OprF [Fusobacterium sp. 1_1_41FAA]
          Length = 102

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 49/75 (65%)

Query: 111 IAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKV 170
           + I+ HTDS+G+ + N+ +S+ RA+ +K+ LI+ G+  +R + +     +YP+ TN+T  
Sbjct: 28  LTIEGHTDSVGSNQYNIGLSRRRAEAVKAKLIEFGLPEDRIVGIEAKGEEYPVATNETPE 87

Query: 171 GRQNNQRIEIQIFPR 185
           GR  N+R+E ++  R
Sbjct: 88  GRLQNRRVEFRLVQR 102


>gi|332878199|ref|ZP_08445928.1| OmpA family protein [Capnocytophaga sp. oral taxon 329 str. F0087]
 gi|332683937|gb|EGJ56805.1| OmpA family protein [Capnocytophaga sp. oral taxon 329 str. F0087]
          Length = 229

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 40/151 (26%), Positives = 75/151 (49%), Gaps = 8/151 (5%)

Query: 43  FGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIP----VHVSFVSEVFLEKKFLPMLQL 98
            G+ +DK   + + ++   G  V R+ D I         V+         EK    + +L
Sbjct: 73  IGNQMDKQAKKIEEEI--PGAEVKRVDDGIVVTFDENSGVYFETAKHNINEKSKETLNKL 130

Query: 99  IATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFA 158
           IA +L ++P T + +  +TDS+G  + N+ +S+ RA  + +Y    G++++RF + + F 
Sbjct: 131 IA-VLKEYPETNVVVAGYTDSVGKDEYNMGLSKRRAQSVTNYFTSNGLAASRF-TTKWFG 188

Query: 159 YKYPIDTNDTKVGRQNNQRIEIQIFPRGNIK 189
            + P+  N T  GR  N+R+ + I P   +K
Sbjct: 189 EQNPVADNGTPEGRAKNRRVNVVIVPNEKMK 219


>gi|237803483|ref|ZP_04591068.1| OmpA/MotB [Pseudomonas syringae pv. oryzae str. 1_6]
 gi|331025465|gb|EGI05521.1| OmpA/MotB [Pseudomonas syringae pv. oryzae str. 1_6]
          Length = 271

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 45/74 (60%), Gaps = 1/74 (1%)

Query: 107 PSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTN 166
           P  V+ I+ +TDS G  + NL +S++RA  +   LI  GV   R I V G+  ++P+D N
Sbjct: 186 PRRVVRIEGYTDSTGDRQENLKLSKDRAQAVADVLIDLGVDEKR-IQVEGYGQQFPVDAN 244

Query: 167 DTKVGRQNNQRIEI 180
            ++ GR  N+R+EI
Sbjct: 245 TSERGRAQNRRVEI 258


>gi|326798930|ref|YP_004316749.1| OmpA/MotB domain protein [Sphingobacterium sp. 21]
 gi|326549694|gb|ADZ78079.1| OmpA/MotB domain protein [Sphingobacterium sp. 21]
          Length = 229

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 34/88 (38%), Positives = 51/88 (57%), Gaps = 1/88 (1%)

Query: 103 LNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYP 162
           LN  P T I I  HTD+ GT + N  +S+ RA  +K+Y + +G+SS+R     G ++  P
Sbjct: 135 LNDNPDTDILIIGHTDNKGTAEYNQGLSERRAAAVKNYAVAQGLSSSR-AKTEGKSFNEP 193

Query: 163 IDTNDTKVGRQNNQRIEIQIFPRGNIKK 190
           I  N T+ GR  N+R+EI I     +K+
Sbjct: 194 IADNSTEAGRAQNRRVEIVIVANEKMKE 221


>gi|253572950|ref|ZP_04850347.1| conserved hypothetical protein [Bacteroides sp. 1_1_6]
 gi|254885124|ref|ZP_05257834.1| lipoprotein PG3 [Bacteroides sp. 4_3_47FAA]
 gi|251837477|gb|EES65571.1| conserved hypothetical protein [Bacteroides sp. 1_1_6]
 gi|254837917|gb|EET18226.1| lipoprotein PG3 [Bacteroides sp. 4_3_47FAA]
          Length = 213

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 54/93 (58%), Gaps = 1/93 (1%)

Query: 88  LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVS 147
           L ++   ML  +  I+ + P+T I I  HTD+IG  + N+++S+ RA  + +YL   G+ 
Sbjct: 115 LNEEAQKMLSNLCNIITEIPNTKIKIIGHTDNIGEKQYNIILSKNRAAAVGNYLRTAGIE 174

Query: 148 SNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEI 180
           +N  I+  G  Y  PI  N ++ GR  N+R+EI
Sbjct: 175 TNN-ITEDGKGYSEPIADNTSEAGRAKNRRVEI 206


>gi|60650175|ref|YP_209728.1| putative outer membrane protein [Bacteroides fragilis NCTC 9343]
 gi|255010962|ref|ZP_05283088.1| putative outer membrane protein [Bacteroides fragilis 3_1_12]
 gi|313148766|ref|ZP_07810959.1| lipoprotein [Bacteroides fragilis 3_1_12]
 gi|317477470|ref|ZP_07936697.1| OmpA family protein [Bacteroides eggerthii 1_2_48FAA]
 gi|60495255|emb|CAH05749.1| putative outer membrane protein [Bacteroides fragilis NCTC 9343]
 gi|313137533|gb|EFR54893.1| lipoprotein [Bacteroides fragilis 3_1_12]
 gi|316906390|gb|EFV28117.1| OmpA family protein [Bacteroides eggerthii 1_2_48FAA]
          Length = 213

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 54/93 (58%), Gaps = 1/93 (1%)

Query: 88  LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVS 147
           L ++   ML  +  I+ + P+T I I  HTD+IG  + N+++S+ RA  + +YL   G+ 
Sbjct: 115 LNEEAQKMLSDLCNIITEIPNTKIKIIGHTDNIGEKQYNIILSKNRAAAVGNYLRTAGIE 174

Query: 148 SNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEI 180
           +N  I+  G  Y  PI  N ++ GR  N+R+EI
Sbjct: 175 TNN-ITEDGKGYSEPIADNTSEAGRAKNRRVEI 206


>gi|218778089|ref|YP_002429407.1| OmpA/MotB domain protein [Desulfatibacillum alkenivorans AK-01]
 gi|218759473|gb|ACL01939.1| OmpA/MotB domain protein [Desulfatibacillum alkenivorans AK-01]
          Length = 377

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 43/158 (27%), Positives = 82/158 (51%), Gaps = 17/158 (10%)

Query: 27  KVFLHKSN---DTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV 83
           KVFL KSN   D+D      G  +    D+     +  G  V+++G    C+I   + F 
Sbjct: 229 KVFLKKSNQPLDSD------GDGVYDNADKCPGTPK--GADVNKVG----CWIIKDLEFD 276

Query: 84  SEVF-LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLI 142
            + + ++K++   ++ I  IL   P   + ++ HTD+ G+   N  +S  RAD +   ++
Sbjct: 277 FDSYEIKKEYQSCIKKIVAILRANPGLKLIVEGHTDNKGSKAYNDKLSLNRADAVIDSMV 336

Query: 143 QRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEI 180
            +G+   R +S +G+ +  P+ +NDT+ GR  N+R+++
Sbjct: 337 GKGIMPER-LSAKGYGFSKPVASNDTEEGRARNRRVQL 373


>gi|170723276|ref|YP_001750964.1| OmpA/MotB domain-containing protein [Pseudomonas putida W619]
 gi|169761279|gb|ACA74595.1| OmpA/MotB domain protein [Pseudomonas putida W619]
          Length = 262

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 35/134 (26%), Positives = 70/134 (52%), Gaps = 10/134 (7%)

Query: 49  KAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPS 108
           K +D    +  D G +V+  GD++  +        ++  L+   LP +  +A  L + P 
Sbjct: 123 KLQDSLNAKQTDRGTLVT-FGDVLFDF--------NKAELKSSALPNVTKLAQFLQENPE 173

Query: 109 TVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDT 168
             + ++ +TDS+G+   N  +S+ RA  ++  L++ GV   R ++ +G+  +YP+  N +
Sbjct: 174 RKVIVEGYTDSVGSANYNQSLSERRAGAVRMALVRAGVDPARIVA-QGYGKEYPVADNSS 232

Query: 169 KVGRQNNQRIEIQI 182
             GR  N+R+E+ I
Sbjct: 233 NSGRAQNRRVEVTI 246


>gi|110638537|ref|YP_678746.1| outer membrane protein [Cytophaga hutchinsonii ATCC 33406]
 gi|110281218|gb|ABG59404.1| outer membrane protein [Cytophaga hutchinsonii ATCC 33406]
          Length = 510

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 52/90 (57%), Gaps = 1/90 (1%)

Query: 96  LQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVR 155
           L  +  +L + P   I I+ HTD+ G    N+++SQ RA  +  Y+I +G++++R I+ +
Sbjct: 422 LDKVVKLLRENPKMKIEIEGHTDNQGNADKNMILSQNRAKSVMDYIISKGITADR-ITSK 480

Query: 156 GFAYKYPIDTNDTKVGRQNNQRIEIQIFPR 185
           GF    P+  NDT   RQ N+R+E  I  +
Sbjct: 481 GFGITKPMVDNDTPENRQLNRRVEFTILQK 510


>gi|149925845|ref|ZP_01914109.1| outer membrane protein, OmpA/MotB family [Limnobacter sp. MED105]
 gi|149825962|gb|EDM85170.1| outer membrane protein, OmpA/MotB family [Limnobacter sp. MED105]
          Length = 222

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 55/95 (57%), Gaps = 1/95 (1%)

Query: 88  LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVS 147
           ++ +F   L  IA  L   P+T++ +  +TDS G+ + N  +S  RA  + ++L  +G+S
Sbjct: 127 VKAQFAGTLDQIAATLRDNPNTIVCVIGYTDSTGSDQYNQDLSVRRAQSVTNFLTAKGIS 186

Query: 148 SNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
             R ++  G    +P+ +NDT+ GR  N+R+E+ +
Sbjct: 187 GAR-LTAAGLGEGFPVASNDTESGRAQNRRVEMYV 220


>gi|237707828|ref|ZP_04538309.1| conserved hypothetical protein [Bacteroides sp. 9_1_42FAA]
 gi|229458156|gb|EEO63877.1| conserved hypothetical protein [Bacteroides sp. 9_1_42FAA]
          Length = 213

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 54/93 (58%), Gaps = 1/93 (1%)

Query: 88  LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVS 147
           L ++   ML  +  I+ + P+T I I  HTD+IG  + N+++S+ RA  + +YL   G+ 
Sbjct: 115 LNEEAQKMLSDLCNIITEIPNTKIKIIGHTDNIGEKQYNIILSKNRAAAVGNYLRTAGIE 174

Query: 148 SNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEI 180
           +N  I+  G  Y  PI  N ++ GR  N+R+EI
Sbjct: 175 TNN-ITEDGKGYSEPIADNTSEAGRAKNRRVEI 206


>gi|198275312|ref|ZP_03207843.1| hypothetical protein BACPLE_01473 [Bacteroides plebeius DSM 17135]
 gi|198271895|gb|EDY96165.1| hypothetical protein BACPLE_01473 [Bacteroides plebeius DSM 17135]
          Length = 238

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 51/91 (56%), Gaps = 8/91 (8%)

Query: 102 ILNKFPSTVIAIQSHTDSIG--------TLKNNLLISQERADVIKSYLIQRGVSSNRFIS 153
           +LN+     +AI  +TD+ G        + + NL +SQERA  + SYL+  G SS++  S
Sbjct: 134 VLNQNKDMDVAIYGYTDNTGWKNSTAEQSRQKNLDLSQERAQSVSSYLLACGASSSQIKS 193

Query: 154 VRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           V G   + P+  N T  GRQ N+R+E+ ++ 
Sbjct: 194 VTGMGEENPVADNSTAAGRQENRRVEVYMYA 224


>gi|253699032|ref|YP_003020221.1| OmpA/MotB domain protein [Geobacter sp. M21]
 gi|251773882|gb|ACT16463.1| OmpA/MotB domain protein [Geobacter sp. M21]
          Length = 459

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 48/85 (56%), Gaps = 2/85 (2%)

Query: 99  IATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQR-GVSSNRFISVRGF 157
           +   + ++P+T   I+ HTD++G  + NL +S+ RA  +  YL+   G+  +R +  RGF
Sbjct: 246 VGNFMKQYPTTTAVIEGHTDNVGNPEYNLDLSKRRAQSVVDYLVDNYGIERSR-LEARGF 304

Query: 158 AYKYPIDTNDTKVGRQNNQRIEIQI 182
               PI  N T  GRQ N+RIE  I
Sbjct: 305 GMARPIAANSTDEGRQANRRIEAII 329



 Score = 62.0 bits (149), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 49/85 (57%), Gaps = 2/85 (2%)

Query: 99  IATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQR-GVSSNRFISVRGF 157
           +   +NK+P+T   I+ HTD++G    N+ +SQ+RA+    YL+Q  G+  +R +S +G+
Sbjct: 370 VGEYMNKYPTTTAVIEGHTDNVGGSDYNMKLSQQRAENAVQYLVQNFGIDKSR-LSAKGY 428

Query: 158 AYKYPIDTNDTKVGRQNNQRIEIQI 182
            Y   I  N T  GR  N+RI   I
Sbjct: 429 GYTRRIAYNSTPEGRAKNRRINAVI 453


>gi|294782738|ref|ZP_06748064.1| outer membrane protein OprF [Fusobacterium sp. 1_1_41FAA]
 gi|294481379|gb|EFG29154.1| outer membrane protein OprF [Fusobacterium sp. 1_1_41FAA]
          Length = 127

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 49/75 (65%)

Query: 111 IAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKV 170
           + I+ HTDS+G+ + N+ +S+ RA+ +K+ LI+ G+  +R + +     +YP+ TN+T  
Sbjct: 53  LTIEGHTDSVGSNQYNIGLSRRRAEAVKAKLIEFGLPEDRIVGIEAKGEEYPVATNETPE 112

Query: 171 GRQNNQRIEIQIFPR 185
           GR  N+R+E ++  R
Sbjct: 113 GRLQNRRVEFRLVQR 127


>gi|261417296|ref|YP_003250979.1| OmpA/MotB domain protein [Fibrobacter succinogenes subsp.
           succinogenes S85]
 gi|261373752|gb|ACX76497.1| OmpA/MotB domain protein [Fibrobacter succinogenes subsp.
           succinogenes S85]
 gi|302325429|gb|ADL24630.1| OmpA family protein [Fibrobacter succinogenes subsp. succinogenes
           S85]
          Length = 659

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 32/98 (32%), Positives = 54/98 (55%), Gaps = 1/98 (1%)

Query: 88  LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVS 147
           L K     L  IA ++ K P   + +Q HTD+ G+ K N  +S++RA  +  YL+++GV+
Sbjct: 563 LTKSSYGTLDDIAELMIKIPEANLEVQGHTDNKGSEKRNKKLSEDRAAAVVKYLVKKGVA 622

Query: 148 SNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPR 185
            +R +   G+  + PI  N    GR  N+R+E+  F +
Sbjct: 623 KDR-LRAAGYGSEKPIADNTDAAGRAQNRRVELVPFSK 659


>gi|254428815|ref|ZP_05042522.1| OmpA family protein [Alcanivorax sp. DG881]
 gi|196194984|gb|EDX89943.1| OmpA family protein [Alcanivorax sp. DG881]
          Length = 356

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 29/89 (32%), Positives = 51/89 (57%), Gaps = 1/89 (1%)

Query: 94  PMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFIS 153
           P++  +   L    +  + I  HTDS G+ + N  +S ERA  ++ YLI  GV++ R ++
Sbjct: 266 PLVDRLVKALKSQTNFDVEIAGHTDSTGSAEYNETLSDERAKAVRQYLIDNGVAAER-LT 324

Query: 154 VRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
            RG+    P+ +N+T  GR  N+R+E ++
Sbjct: 325 ARGYGEVVPVASNETSSGRAMNRRVEFRV 353


>gi|256846250|ref|ZP_05551707.1| type VI secretion system OmpA/MotB [Fusobacterium sp. 3_1_36A2]
 gi|256718019|gb|EEU31575.1| type VI secretion system OmpA/MotB [Fusobacterium sp. 3_1_36A2]
          Length = 191

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 29/79 (36%), Positives = 48/79 (60%)

Query: 111 IAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKV 170
           I I  HTDSIG+   N  +S+ RA+ +K+ L++ G+S +R + +     + PI TN TK 
Sbjct: 101 ITIVGHTDSIGSNAYNFKLSRRRAESVKAKLLEFGLSEDRIVGIEAMGEEQPIATNATKE 160

Query: 171 GRQNNQRIEIQIFPRGNIK 189
           GR  N+R+E ++  R  ++
Sbjct: 161 GRAQNRRVEFKLVQRETVQ 179


>gi|302347069|ref|YP_003815367.1| OmpA family protein [Prevotella melaninogenica ATCC 25845]
 gi|302150976|gb|ADK97237.1| OmpA family protein [Prevotella melaninogenica ATCC 25845]
          Length = 225

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 45/144 (31%), Positives = 70/144 (48%), Gaps = 13/144 (9%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVF-------LEKKFLPMLQLI 99
           +DK   E   QL +  +      + + C   V V+F S +        L       L   
Sbjct: 74  MDKVAREAAQQLPNARVDKVTDANGLDC---VKVTFDSGILFPLNGSNLSASAKNDLTKF 130

Query: 100 ATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAY 159
           A+++ +  +  +AIQ +TD+ G    NL +SQ RAD + SYL  RGVSS +  SV+GF  
Sbjct: 131 ASLMQRNSNCDVAIQGYTDASGNDNINLPLSQRRADAVSSYLKGRGVSSRQIRSVQGFGS 190

Query: 160 KYPIDTNDTKVGRQNNQRIEIQIF 183
             PI   + K   Q N+R+E+ ++
Sbjct: 191 ANPI---ENKTVSQANRRVEVYLY 211


>gi|146279022|ref|YP_001169181.1| OmpA/MotB domain-containing protein [Rhodobacter sphaeroides ATCC
           17025]
 gi|145557263|gb|ABP71876.1| OmpA/MotB domain protein [Rhodobacter sphaeroides ATCC 17025]
          Length = 316

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 51/96 (53%)

Query: 88  LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVS 147
           LE +  P L  +A  L + P+  + I  HTD+ G L+ N+ +S+ RA  ++  L+ R   
Sbjct: 219 LEDRTYPALAELAEWLKQDPARQVVIVGHTDASGGLEGNVSLSRARAASVRQRLVSRHGV 278

Query: 148 SNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
            +  +S  G  Y  P  +N T+ GR  N+R+E+ + 
Sbjct: 279 PDAQVSAEGVGYLAPRASNRTEEGRSRNRRVEVMLL 314


>gi|74318359|ref|YP_316099.1| hypothetical protein Tbd_2341 [Thiobacillus denitrificans ATCC
           25259]
 gi|74057854|gb|AAZ98294.1| conserved hypothetical protein [Thiobacillus denitrificans ATCC
           25259]
          Length = 225

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 53/97 (54%), Gaps = 1/97 (1%)

Query: 88  LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVS 147
           L+  +LP L  I+ +LN++  T + +  HTDS+GT + N  +S+ RA  +  Y   + V+
Sbjct: 126 LKAGYLPTLDKISRVLNQYGKTTVTVIGHTDSVGTTQYNQALSERRAQSVLDYFASQKVN 185

Query: 148 SNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
             R  S  G     P   N T+ GR+ N+R+E+ I P
Sbjct: 186 PLRLESY-GKGETEPRADNSTEDGRRLNRRVELWILP 221


>gi|313205096|ref|YP_004043753.1| ompa/motb domain protein [Paludibacter propionicigenes WB4]
 gi|312444412|gb|ADQ80768.1| OmpA/MotB domain protein [Paludibacter propionicigenes WB4]
          Length = 426

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/105 (29%), Positives = 61/105 (58%), Gaps = 1/105 (0%)

Query: 78  VHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVI 137
           +   F S+      +  + Q+  T+ +K     +++  +TD IGT + N ++S +RA+ +
Sbjct: 321 IEFEFGSDKLTTNSYATLDQIALTLKDKSAKVRLSVAGYTDYIGTEEYNQILSVKRANSV 380

Query: 138 KSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           + YL+ +GV ++  +++ G+  K P+  N+T  GRQ N+R+E QI
Sbjct: 381 RIYLLNKGVPASS-VTITGYGEKDPVANNNTDKGRQANRRVEFQI 424


>gi|295095728|emb|CBK84818.1| Outer membrane protein and related peptidoglycan-associated
           (lipo)proteins [Enterobacter cloacae subsp. cloacae NCTC
           9394]
          Length = 568

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 47/81 (58%)

Query: 107 PSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTN 166
           P  +I +  HTDS G  ++N ++S +RA+ ++ ++   G       +V+G+    P+ TN
Sbjct: 465 PGWLIVVAGHTDSTGDDQSNQVLSLKRAESVRDWMRDTGDVPESCFAVQGYGESRPVATN 524

Query: 167 DTKVGRQNNQRIEIQIFPRGN 187
           DT  GR  N+R+EI + P+ N
Sbjct: 525 DTAEGRALNRRVEISLVPQAN 545


>gi|294783612|ref|ZP_06748936.1| outer membrane protein [Fusobacterium sp. 1_1_41FAA]
 gi|294480490|gb|EFG28267.1| outer membrane protein [Fusobacterium sp. 1_1_41FAA]
          Length = 141

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 49/75 (65%)

Query: 111 IAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKV 170
           + I+ HTDS+G+ + N+ +S+ RA+ +K+ LI+ G+  +R + +     +YP+ TN+T  
Sbjct: 67  LTIEGHTDSVGSNQYNIGLSRRRAEAVKAKLIEFGLPEDRIVGIEAKGEEYPVATNETPE 126

Query: 171 GRQNNQRIEIQIFPR 185
           GR  N+R+E ++  R
Sbjct: 127 GRLQNRRVEFRLVQR 141


>gi|256846747|ref|ZP_05552203.1| type VI secretion system OmpA/MotB [Fusobacterium sp. 3_1_36A2]
 gi|256717967|gb|EEU31524.1| type VI secretion system OmpA/MotB [Fusobacterium sp. 3_1_36A2]
          Length = 190

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 29/79 (36%), Positives = 48/79 (60%)

Query: 111 IAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKV 170
           I I  HTDSIG+   N  +S+ RA+ +K+ L++ G+S +R + +     + PI TN TK 
Sbjct: 100 ITIVGHTDSIGSNAYNFKLSRRRAESVKAKLLEFGLSEDRIVGIEAMGEEQPIATNATKE 159

Query: 171 GRQNNQRIEIQIFPRGNIK 189
           GR  N+R+E ++  R  ++
Sbjct: 160 GRAQNRRVEFKLVQRETVQ 178


>gi|87122282|ref|ZP_01078164.1| OmpA family protein [Marinomonas sp. MED121]
 gi|86162425|gb|EAQ63708.1| OmpA family protein [Marinomonas sp. MED121]
          Length = 204

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 57/95 (60%), Gaps = 2/95 (2%)

Query: 92  FLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQR-GVSSNR 150
           F   L+ +A+ L K P++ + I+ HTD++G+  +N  +S +RA  I + +  +  ++ NR
Sbjct: 87  FYSELRELASFLKKNPASSVIIEGHTDNVGSKTSNQTLSFQRASAIAAVITDKFKIAPNR 146

Query: 151 FISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPR 185
            +  +GF    PI +N+T  GR+ N+R+  ++F R
Sbjct: 147 -VQAKGFGETSPIASNETHSGREANRRVVAEVFSR 180


>gi|332667773|ref|YP_004450561.1| OmpA/MotB domain-containing protein [Haliscomenobacter hydrossis
           DSM 1100]
 gi|332336587|gb|AEE53688.1| OmpA/MotB domain protein [Haliscomenobacter hydrossis DSM 1100]
          Length = 603

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 32/85 (37%), Positives = 49/85 (57%), Gaps = 1/85 (1%)

Query: 95  MLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISV 154
           +L  +A ++N++P+  + IQ HTDS G    NL +S++RA     YL+ R + + R I  
Sbjct: 513 ILDQVAALMNRYPAYKLDIQGHTDSQGKEDFNLSLSKKRAKSCYDYLLLRSIDAKR-IEH 571

Query: 155 RGFAYKYPIDTNDTKVGRQNNQRIE 179
            GF    PI +N T  GR  N+R+E
Sbjct: 572 EGFGETKPIASNKTPQGRVQNRRVE 596


>gi|198284396|ref|YP_002220717.1| OmpA/MotB domain-containing protein [Acidithiobacillus ferrooxidans
           ATCC 53993]
 gi|198248917|gb|ACH84510.1| OmpA/MotB domain protein [Acidithiobacillus ferrooxidans ATCC
           53993]
          Length = 184

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 49/76 (64%), Gaps = 1/76 (1%)

Query: 105 KFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPID 164
           K P+ ++ ++ +    G+ K NL +SQERA  +  YL+ RGV + R I+ RG++++ P+ 
Sbjct: 99  KHPTAILLVKGYCSKTGSYKYNLGLSQERAASVAHYLMGRGVPNYRIIT-RGYSWEDPVA 157

Query: 165 TNDTKVGRQNNQRIEI 180
           +N T+ GR  NQR+ I
Sbjct: 158 SNATREGRFLNQRVVI 173


>gi|330830900|ref|YP_004393852.1| sodium-driven polar flagellar protein [Aeromonas veronii B565]
 gi|328806036|gb|AEB51235.1| Sodium-driven polar flagellar protein [Aeromonas veronii B565]
          Length = 283

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 41/138 (29%), Positives = 70/138 (50%), Gaps = 8/138 (5%)

Query: 52  DEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTV 110
           ++ + Q+QD  I +  +G  I   I    SF     FL+ +F P+++ +AT+L   P   
Sbjct: 132 EQMKDQIQDGAIEIEALGQQIIIRIREKASFPAGSAFLQPQFWPVIRKVATLLKDVPGE- 190

Query: 111 IAIQSHTDSIGT----LKNNLLISQERADVIKSYLIQ-RGVSSNRFISVRGFAYKYPIDT 165
           I I  HTD++ T     ++N  +S +RA  +   +++  G    R + V+G A   P+  
Sbjct: 191 ITISGHTDNVATEDELFQSNWELSSQRAVAVAHQMLKVPGFDQGRLV-VQGMADSQPLVP 249

Query: 166 NDTKVGRQNNQRIEIQIF 183
           N T   R+ N+R+EI I 
Sbjct: 250 NTTPENRRMNRRVEIAIM 267


>gi|254302656|ref|ZP_04970014.1| hypothetical protein FNP_0283 [Fusobacterium nucleatum subsp.
           polymorphum ATCC 10953]
 gi|148322848|gb|EDK88098.1| hypothetical protein FNP_0283 [Fusobacterium nucleatum subsp.
           polymorphum ATCC 10953]
          Length = 157

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 49/79 (62%)

Query: 111 IAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKV 170
           I I  HTDSIG+   N  +S+ RA+ +K+ L++ G++ +R + +     + PI TN+TK 
Sbjct: 67  ITIVGHTDSIGSNAYNFKLSRRRAESVKAKLLEFGLTEDRIVGIEAMGEEQPIATNETKE 126

Query: 171 GRQNNQRIEIQIFPRGNIK 189
           GR  N+R+E ++  R  ++
Sbjct: 127 GRAQNRRVEFKLVQRETVQ 145


>gi|330951777|gb|EGH52037.1| thrombospondin type 3 repeat-containing OmpA/MotB protein
           [Pseudomonas syringae Cit 7]
          Length = 344

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 52/88 (59%), Gaps = 2/88 (2%)

Query: 96  LQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLI-QRGVSSNRFISV 154
           ++ +A  + ++P T   ++ HTDS+G    N  +S+ RA+ +K  L+ Q GV +NR  SV
Sbjct: 253 IKNLADFMQQYPQTTTTVEGHTDSVGPDAYNQKLSERRANAVKQVLVNQYGVGANRVNSV 312

Query: 155 RGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
            G+    P+  N T+ GR  N+R+E ++
Sbjct: 313 -GYGESRPVADNATEAGRAVNRRVEAEV 339


>gi|161520025|ref|YP_001583452.1| OmpA/MotB domain-containing protein [Burkholderia multivorans ATCC
           17616]
 gi|189353793|ref|YP_001949420.1| OmpA/MotB family outer membrane protein [Burkholderia multivorans
           ATCC 17616]
 gi|160344075|gb|ABX17160.1| OmpA/MotB domain protein [Burkholderia multivorans ATCC 17616]
 gi|189337815|dbj|BAG46884.1| OmpA/MotB family outer membrane protein [Burkholderia multivorans
           ATCC 17616]
          Length = 220

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 33/111 (29%), Positives = 57/111 (51%), Gaps = 8/111 (7%)

Query: 79  HVSFVSEVFLEKKFLPMLQLIATILNKF-------PSTVIAIQSHTDSIGTLKNNLLISQ 131
           HVS   +         +       L+K          T +++  +TDS+G+  +NL +S+
Sbjct: 109 HVSLAGDALFASGLATLTPAARASLDKLLNAHADRSYTQVSVTGYTDSVGSDASNLALSK 168

Query: 132 ERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
            RA+ + +YL QRG+++ R ++V G     PI +N T  GR  N+R+EI +
Sbjct: 169 RRAEAVAAYLQQRGLNA-RTLTVTGRGSADPIASNATAEGRATNRRVEISL 218


>gi|166714357|gb|ABY87945.1| outer membrane protein [Acinetobacter sp. bm-8]
          Length = 355

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 32/92 (34%), Positives = 57/92 (61%), Gaps = 2/92 (2%)

Query: 88  LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLI-QRGV 146
           ++ ++ P +  +A  LN++P+    I+ HTD+ G  K N  +S  RA+ +KS L+ +  +
Sbjct: 245 IKDQYKPEIAKVAEKLNEYPNATARIEGHTDNTGPRKLNERLSLARANSVKSALVSEYNI 304

Query: 147 SSNRFISVRGFAYKYPIDTNDTKVGRQNNQRI 178
            S+R ++ +GFA+  PI  N+TK GR  N+R+
Sbjct: 305 DSSR-LAAQGFAWDQPIADNNTKEGRAMNRRV 335


>gi|315181920|gb|ADT88833.1| outer membrane protein OmpA [Vibrio furnissii NCTC 11218]
          Length = 316

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 48/87 (55%), Gaps = 1/87 (1%)

Query: 96  LQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVR 155
           L+ +A  LNK P   I I  HTDS G+   N  +S  RA      L++  V+ +R I V 
Sbjct: 227 LRTLAATLNKQPQAQILIIGHTDSTGSDAYNTKLSTRRAQAAADVLMENQVAEHR-IKVF 285

Query: 156 GFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           G     PIDTN T  GR +N+R+E+QI
Sbjct: 286 GEGQTRPIDTNTTPAGRAHNRRVEVQI 312


>gi|149925042|ref|ZP_01913359.1| outer membrane protein, OmpA/MotB family [Plesiocystis pacifica
           SIR-1]
 gi|149814084|gb|EDM73711.1| outer membrane protein, OmpA/MotB family [Plesiocystis pacifica
           SIR-1]
          Length = 233

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 47/73 (64%), Gaps = 1/73 (1%)

Query: 111 IAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKV 170
           ++++ HTDS G+ + N  +SQ+RAD + +YL++ GV+  R  +V G   + PI  NDT  
Sbjct: 105 VSVEGHTDSDGSSRYNKKLSQKRADSVMAYLVEHGVAQERLEAV-GHGEEKPIADNDTDE 163

Query: 171 GRQNNQRIEIQIF 183
           G++ N+R+E  I 
Sbjct: 164 GKEKNRRVEFIIL 176


>gi|115375599|ref|ZP_01462856.1| OmpA/MotB [Stigmatella aurantiaca DW4/3-1]
 gi|310823174|ref|YP_003955532.1| OmpA domain-containing protein [Stigmatella aurantiaca DW4/3-1]
 gi|115367375|gb|EAU66353.1| OmpA/MotB [Stigmatella aurantiaca DW4/3-1]
 gi|309396246|gb|ADO73705.1| OmpA domain protein [Stigmatella aurantiaca DW4/3-1]
          Length = 468

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 36/91 (39%), Positives = 52/91 (57%), Gaps = 2/91 (2%)

Query: 93  LPMLQLIATILNKFPS-TVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRF 151
           L +L+ IA +L   P    + I+ HTDS G   +NL +SQ+RAD + + LI+ G+   R 
Sbjct: 376 LAILKDIALVLVDMPIIKKVRIEGHTDSQGADASNLRLSQKRADAVMAQLIKLGIDPGRL 435

Query: 152 ISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
            +V G+    PI +N TK GR  N+R E  I
Sbjct: 436 EAV-GYGETKPIASNATKAGRAENRRTEFNI 465


>gi|253701635|ref|YP_003022824.1| OmpA/MotB domain protein [Geobacter sp. M21]
 gi|251776485|gb|ACT19066.1| OmpA/MotB domain protein [Geobacter sp. M21]
          Length = 432

 Score = 62.8 bits (151), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 56/93 (60%), Gaps = 2/93 (2%)

Query: 88  LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQR-GV 146
           L+ ++   L+ +A  LN+FP+    I+ HTD++G    N+ +SQ RAD I++ LI+  G+
Sbjct: 333 LKPQYRAELKALADFLNEFPNATGVIEGHTDNVGPKALNMKLSQLRADKIRNSLIKEFGI 392

Query: 147 SSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIE 179
           +  R  ++ G+    P+ +N  K G+  N+RIE
Sbjct: 393 APERIKAI-GYGPAKPVASNKDKAGKAKNRRIE 424


>gi|313500273|gb|ADR61639.1| OmpA/MotB domain protein [Pseudomonas putida BIRD-1]
          Length = 263

 Score = 62.8 bits (151), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 35/134 (26%), Positives = 70/134 (52%), Gaps = 10/134 (7%)

Query: 49  KAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPS 108
           K +D    +  D G +V+  GD++  +        ++  L+    P +  +A  L + P 
Sbjct: 123 KLQDSLNAKQTDRGTLVT-FGDVLFDF--------NKAELKSNAYPNVTKLAQFLQENPE 173

Query: 109 TVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDT 168
             + ++ +TDS+G+   N  +S+ RA+ ++  L++ GV   R +S +G+  +YP+  N +
Sbjct: 174 RKVIVEGYTDSVGSANYNQTLSERRANSVRMALVRAGVDPARIVS-QGYGKEYPVADNSS 232

Query: 169 KVGRQNNQRIEIQI 182
             GR  N+R+E+ I
Sbjct: 233 NSGRAQNRRVEVTI 246


>gi|218666977|ref|YP_002427062.1| OmpA family protein [Acidithiobacillus ferrooxidans ATCC 23270]
 gi|218519190|gb|ACK79776.1| OmpA family protein [Acidithiobacillus ferrooxidans ATCC 23270]
          Length = 183

 Score = 62.8 bits (151), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 49/76 (64%), Gaps = 1/76 (1%)

Query: 105 KFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPID 164
           K P+ ++ ++ +    G+ K NL +SQERA  +  YL+ RGV + R I+ RG++++ P+ 
Sbjct: 98  KHPTAILLVKGYCSKTGSYKYNLGLSQERAASVAHYLMGRGVPNYRIIT-RGYSWEDPVA 156

Query: 165 TNDTKVGRQNNQRIEI 180
           +N T+ GR  NQR+ I
Sbjct: 157 SNATREGRFLNQRVVI 172


>gi|114799158|ref|YP_761149.1| OmpA family protein [Hyphomonas neptunium ATCC 15444]
 gi|114739332|gb|ABI77457.1| OmpA family protein [Hyphomonas neptunium ATCC 15444]
          Length = 297

 Score = 62.8 bits (151), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 34/88 (38%), Positives = 47/88 (53%), Gaps = 1/88 (1%)

Query: 96  LQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVR 155
           L  +A+ L+K P + I I  HTDS G    N  +S  RA  + +YL   GV S R  ++ 
Sbjct: 210 LAPLASYLSKQPESRIQIAGHTDSQGAEAYNQDLSARRAASVGTYLASTGVDSGRINTI- 268

Query: 156 GFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
           G     P+ +NDT  GR  N+R+EI I 
Sbjct: 269 GLGESTPLSSNDTAAGRAINRRVEITIL 296


>gi|104782672|ref|YP_609170.1| OmpA family outer membrane protein [Pseudomonas entomophila L48]
 gi|95111659|emb|CAK16380.1| putative outer membrane protein; OmpA family [Pseudomonas
           entomophila L48]
          Length = 269

 Score = 62.8 bits (151), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 28/74 (37%), Positives = 46/74 (62%), Gaps = 1/74 (1%)

Query: 107 PSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTN 166
           P  V+ I+ +TDS G  ++NL +S++RA  +   L+  GV   R I V G+  +YP++ N
Sbjct: 184 PRRVVRIEGYTDSTGNPEDNLKLSRDRAQAVADMLVDLGVDEKR-IQVEGYGDQYPVEAN 242

Query: 167 DTKVGRQNNQRIEI 180
            ++ GR  N+R+EI
Sbjct: 243 ASERGRAQNRRVEI 256


>gi|26988234|ref|NP_743659.1| OmpA/MotB domain protein [Pseudomonas putida KT2440]
 gi|24982975|gb|AAN67123.1|AE016341_6 OmpA family protein [Pseudomonas putida KT2440]
          Length = 263

 Score = 62.8 bits (151), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 35/134 (26%), Positives = 70/134 (52%), Gaps = 10/134 (7%)

Query: 49  KAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPS 108
           K +D    +  D G +V+  GD++  +        ++  L+    P +  +A  L + P 
Sbjct: 123 KLQDSLNAKQTDRGTLVT-FGDVLFDF--------NKAELKSNAYPNITKLAQFLQENPE 173

Query: 109 TVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDT 168
             + ++ +TDS+G+   N  +S+ RA+ ++  L++ GV   R +S +G+  +YP+  N +
Sbjct: 174 RKVIVEGYTDSVGSANYNQTLSERRANSVRMALVRAGVDPARIVS-QGYGKEYPVADNSS 232

Query: 169 KVGRQNNQRIEIQI 182
             GR  N+R+E+ I
Sbjct: 233 NSGRAQNRRVEVTI 246


>gi|148549426|ref|YP_001269528.1| OmpA/MotB domain-containing protein [Pseudomonas putida F1]
 gi|148513484|gb|ABQ80344.1| OmpA/MotB domain protein [Pseudomonas putida F1]
          Length = 263

 Score = 62.4 bits (150), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 35/134 (26%), Positives = 70/134 (52%), Gaps = 10/134 (7%)

Query: 49  KAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPS 108
           K +D    +  D G +V+  GD++  +        ++  L+    P +  +A  L + P 
Sbjct: 123 KLQDSLNAKQTDRGTLVT-FGDVLFDF--------NKAELKSSAYPNITKLAQFLQENPE 173

Query: 109 TVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDT 168
             + ++ +TDS+G+   N  +S+ RA+ ++  L++ GV   R +S +G+  +YP+  N +
Sbjct: 174 RKVIVEGYTDSVGSANYNQTLSERRANSVRMALVRAGVDPARIVS-QGYGKEYPVADNSS 232

Query: 169 KVGRQNNQRIEIQI 182
             GR  N+R+E+ I
Sbjct: 233 NSGRAQNRRVEVTI 246


>gi|313677015|ref|YP_004055011.1| ompa/motb domain protein [Marivirga tractuosa DSM 4126]
 gi|312943713|gb|ADR22903.1| OmpA/MotB domain protein [Marivirga tractuosa DSM 4126]
          Length = 670

 Score = 62.4 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 34/97 (35%), Positives = 57/97 (58%), Gaps = 2/97 (2%)

Query: 88  LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVS 147
           L  + L  L++I  +L   P   + I  HTD++G    N L+S++RA  +  YLI  G++
Sbjct: 569 LRTESLGELKVIKDLLTNSPDLRVQINGHTDNVGNSVYNKLLSKKRAQSVVDYLIANGIN 628

Query: 148 SNRFISVRGFAYKYPIDTNDTKV-GRQNNQRIEIQIF 183
           S R +  +GF  + P+ +ND ++ GR+ N+R EI+I 
Sbjct: 629 SER-LEAKGFGEEKPLVSNDDEIGGREINRRTEIEIL 664


>gi|119776394|ref|YP_929134.1| OmpA/MotB [Shewanella amazonensis SB2B]
 gi|119768894|gb|ABM01465.1| OmpA/MotB [Shewanella amazonensis SB2B]
          Length = 201

 Score = 62.4 bits (150), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 54/97 (55%), Gaps = 2/97 (2%)

Query: 87  FLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQR-G 145
           +L  ++   ++ +A+ + +FP+T + I+ H    G    N+ +SQ RA+ +   L Q+ G
Sbjct: 85  YLAPQYFGQIEELASFMRQFPNTKVTIEGHCSRTGGYDYNMELSQRRANAVTEVLTQQYG 144

Query: 146 VSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           + S+R  +V GF Y  P+D +DT      N+R+  +I
Sbjct: 145 IESSRLKAV-GFGYNSPVDPSDTPEAHDKNRRVIAEI 180


>gi|77458004|ref|YP_347509.1| OmpF [Pseudomonas fluorescens Pf0-1]
 gi|77382007|gb|ABA73520.1| outer membrane fibronectin-binding protein [Pseudomonas fluorescens
           Pf0-1]
          Length = 344

 Score = 62.4 bits (150), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 50/85 (58%), Gaps = 2/85 (2%)

Query: 99  IATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLI-QRGVSSNRFISVRGF 157
           +A  + ++PST   ++ HTDS+G    N  +S+ RA+ +K  L  Q GV S+R  S+ G+
Sbjct: 256 LADFMKQYPSTTTTVEGHTDSVGPDAYNQKLSERRANAVKQVLTNQYGVESSRVQSI-GY 314

Query: 158 AYKYPIDTNDTKVGRQNNQRIEIQI 182
               P+  N T+ GR  N+R+E Q+
Sbjct: 315 GESRPVADNKTEAGRAVNRRVEAQV 339


>gi|283786451|ref|YP_003366316.1| T6SS protein Cts1O [Citrobacter rodentium ICC168]
 gi|282949905|emb|CBG89530.1| T6SS protein Cts1O [Citrobacter rodentium ICC168]
          Length = 594

 Score = 62.4 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 34/91 (37%), Positives = 49/91 (53%), Gaps = 2/91 (2%)

Query: 96  LQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLI-QRGVSSNRFISV 154
           L  I  ++ + P     I  H+DS G+   N+ +S  RA VIK +L+   G+ + +FI+ 
Sbjct: 505 LLTIVPVIRRSPEKTFLIIGHSDSTGSAATNMALSAARAQVIKEWLVAHTGLPAGQFIT- 563

Query: 155 RGFAYKYPIDTNDTKVGRQNNQRIEIQIFPR 185
            G     PI  NDTK GR  N+R+EI   PR
Sbjct: 564 EGAGDTRPIANNDTKEGRAQNRRVEIIPLPR 594


>gi|90020235|ref|YP_526062.1| OmpA domain-containing protein [Saccharophagus degradans 2-40]
 gi|89949835|gb|ABD79850.1| OmpA/MotB [Saccharophagus degradans 2-40]
          Length = 381

 Score = 62.4 bits (150), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 29/92 (31%), Positives = 57/92 (61%), Gaps = 2/92 (2%)

Query: 88  LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLI-QRGV 146
           +++ +   ++ +A  +N++ +T ++++ +TD  G+   N  +SQ+RAD +K+ L+ Q  +
Sbjct: 277 VKESYYAEVKRVADFMNQYANTQVSVEGYTDDRGSAAYNKQLSQKRADAVKATLVSQFNI 336

Query: 147 SSNRFISVRGFAYKYPIDTNDTKVGRQNNQRI 178
            + R ++  GF    PIDTNDT  GR  N+R+
Sbjct: 337 DAAR-VTATGFGEINPIDTNDTAAGRAANRRV 367


>gi|330995812|ref|ZP_08319709.1| OmpA family protein [Paraprevotella xylaniphila YIT 11841]
 gi|329574542|gb|EGG56107.1| OmpA family protein [Paraprevotella xylaniphila YIT 11841]
          Length = 242

 Score = 62.4 bits (150), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 37/124 (29%), Positives = 61/124 (49%), Gaps = 16/124 (12%)

Query: 77  PVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTV--------IAIQSHTDSIG------- 121
            V V+F S +        +       L KF STV        +AI+ +TD+ G       
Sbjct: 105 AVKVTFDSGILFNTSSSALSSNATASLAKFASTVLNVNKDMDVAIKGYTDNQGWKNSTAA 164

Query: 122 -TLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEI 180
            +++ N+ +S +RA+ + +YL Q GVSS +  SV G     P+  N T  GR+ N+R+E+
Sbjct: 165 QSVQKNMDLSLQRANSVSNYLKQCGVSSTQITSVEGLGEADPVADNSTAAGREQNRRVEV 224

Query: 181 QIFP 184
            ++ 
Sbjct: 225 YLYA 228


>gi|206602390|gb|EDZ38871.1| Putative OmpA family protein [Leptospirillum sp. Group II '5-way
           CG']
          Length = 265

 Score = 62.4 bits (150), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 53/93 (56%), Gaps = 7/93 (7%)

Query: 99  IATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFA 158
           +A  +   P   + I+ +TDS GT   N  +S +RA+ ++  L+  G++  R ++ +G+ 
Sbjct: 172 LAEFMQSDPKRNVMIEGYTDSTGTAAYNEKLSLKRAESVRDALVNDGINPQRIVT-KGYG 230

Query: 159 YKYPIDTNDTKVGRQNNQRIEIQI------FPR 185
            KYPI +N T  GRQ N+R+EI I      FP+
Sbjct: 231 PKYPIASNKTADGRQQNRRVEIVISDEKGLFPK 263


>gi|34763981|ref|ZP_00144872.1| Outer membrane porin F [Fusobacterium nucleatum subsp. vincentii
           ATCC 49256]
 gi|27886240|gb|EAA23525.1| Outer membrane porin F [Fusobacterium nucleatum subsp. vincentii
           ATCC 49256]
          Length = 315

 Score = 62.4 bits (150), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 57/90 (63%), Gaps = 3/90 (3%)

Query: 95  MLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISV 154
           +L+ +A +L +       +  HTDS  + K+N ++S+ RA+ +K++L  +G+++   I++
Sbjct: 227 VLKNLAIVLKEADIKAFEVDGHTDSDASDKHNRILSENRANAVKNFLTSQGITAE--ITI 284

Query: 155 RGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           +G+    PI +NDT  G+Q N+R+EI I P
Sbjct: 285 KGYGESRPIASNDTAEGKQKNRRVEI-IIP 313


>gi|254457130|ref|ZP_05070558.1| OmpA/MotB [Campylobacterales bacterium GD 1]
 gi|207085922|gb|EDZ63206.1| OmpA/MotB [Campylobacterales bacterium GD 1]
          Length = 407

 Score = 62.4 bits (150), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 40/115 (34%), Positives = 62/115 (53%), Gaps = 4/115 (3%)

Query: 70  DMITCYIPVHVSFV--SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNL 127
           D     I +HV F   S+V     +  +++  A  LN + S    I  +TDS G+   N 
Sbjct: 292 DGCPAKITLHVKFENNSDVVNTSSY-DIIEKYADFLNNYSSYSAKIIGYTDSKGSANYNQ 350

Query: 128 LISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
            +S++RA+ IKS L+++GV ++R  SV G     P+  N TK GR  N+RIE ++
Sbjct: 351 KLSEKRANAIKSMLLEKGVPADRLSSV-GMGESNPVADNSTKEGRAQNRRIEAEL 404


>gi|163802616|ref|ZP_02196508.1| flagellar basal body P-ring biosynthesis protein A [Vibrio sp.
           AND4]
 gi|159173699|gb|EDP58518.1| flagellar basal body P-ring biosynthesis protein A [Vibrio sp.
           AND4]
          Length = 315

 Score = 62.4 bits (150), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 52/85 (61%), Gaps = 1/85 (1%)

Query: 96  LQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVR 155
           L  +   LN++P   + +  +TD+ G    N  +S++RA+ + + L+++G+ ++R I  R
Sbjct: 221 LDDLVAFLNEYPQATVGVIGYTDTSGPAAYNQKVSEKRAESVANALVEKGIDASR-IQAR 279

Query: 156 GFAYKYPIDTNDTKVGRQNNQRIEI 180
           G     PI +N+T+ GR+ N+R+E+
Sbjct: 280 GEGENNPIASNETREGREQNRRVEV 304


>gi|124514812|gb|EAY56324.1| putative OmpA family protein [Leptospirillum rubarum]
          Length = 265

 Score = 62.4 bits (150), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 53/93 (56%), Gaps = 7/93 (7%)

Query: 99  IATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFA 158
           +A  +   P   + I+ +TDS GT   N  +S +RA+ ++  L+  G++  R ++ +G+ 
Sbjct: 172 LAEFMQSDPKRNVMIEGYTDSTGTAAYNEKLSLKRAESVRDALVNDGINPQRIVT-KGYG 230

Query: 159 YKYPIDTNDTKVGRQNNQRIEIQI------FPR 185
            KYPI +N T  GRQ N+R+EI I      FP+
Sbjct: 231 PKYPIASNKTADGRQQNRRVEIVISDEKGLFPK 263


>gi|237752179|ref|ZP_04582659.1| cadF [Helicobacter winghamensis ATCC BAA-430]
 gi|229376421|gb|EEO26512.1| cadF [Helicobacter winghamensis ATCC BAA-430]
          Length = 307

 Score = 62.4 bits (150), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 31/84 (36%), Positives = 48/84 (57%), Gaps = 1/84 (1%)

Query: 100 ATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAY 159
           A  + + PS    I  HTDS G  + N  +S+ RA+ +K  +I+ GV + R +  +G+  
Sbjct: 220 AQSMKENPSQTAIISGHTDSTGNDEYNQKLSERRANAVKDAIIEEGVQAER-LQAKGYGE 278

Query: 160 KYPIDTNDTKVGRQNNQRIEIQIF 183
             PI  N TK GRQ N+R+E +I+
Sbjct: 279 SKPIADNATKEGRQENRRVEAEIY 302


>gi|169123287|gb|ACA47115.1| OmpF [Pseudomonas putida]
          Length = 343

 Score = 62.4 bits (150), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 32/85 (37%), Positives = 50/85 (58%), Gaps = 2/85 (2%)

Query: 99  IATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLI-QRGVSSNRFISVRGF 157
           +A  + ++PST   ++ HTDS+G    N  +S+ RA+ +K  L  Q GV S+R  SV G+
Sbjct: 255 LADFMKQYPSTSTTVEGHTDSVGPDAYNQKLSERRANAVKQVLTNQYGVESSRVQSV-GY 313

Query: 158 AYKYPIDTNDTKVGRQNNQRIEIQI 182
               P+  N T+ GR  N+R+E Q+
Sbjct: 314 GESRPVADNKTEAGRAVNRRVEAQV 338


>gi|149774748|gb|ABR28420.1| OmpA/MotB [Delftia tsuruhatensis]
          Length = 219

 Score = 62.4 bits (150), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 46/73 (63%), Gaps = 2/73 (2%)

Query: 110 VIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTK 169
           VIA+  HTDS+G+   N  +S  RA+ +K+YL+ +G+  NR +   G   K PI  N TK
Sbjct: 142 VIAV-GHTDSVGSDAYNQKLSVRRAEAVKAYLVSKGIEKNR-VYTEGKGEKQPIADNKTK 199

Query: 170 VGRQNNQRIEIQI 182
            GR  N+R+EI++
Sbjct: 200 EGRAKNRRVEIEV 212


>gi|160900150|ref|YP_001565732.1| OmpA/MotB domain-containing protein [Delftia acidovorans SPH-1]
 gi|151500323|gb|ABS12102.1| OmpA/MotB [Delftia acidovorans]
 gi|160365734|gb|ABX37347.1| OmpA/MotB domain protein [Delftia acidovorans SPH-1]
          Length = 219

 Score = 62.4 bits (150), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 46/73 (63%), Gaps = 2/73 (2%)

Query: 110 VIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTK 169
           VIA+  HTDS+G+   N  +S  RA+ +K+YL+ +G+  NR +   G   K PI  N TK
Sbjct: 142 VIAV-GHTDSVGSDAYNQKLSVRRAEAVKAYLVSKGIEKNR-VYTEGKGEKQPIADNKTK 199

Query: 170 VGRQNNQRIEIQI 182
            GR  N+R+EI++
Sbjct: 200 EGRAKNRRVEIEV 212


>gi|262042941|ref|ZP_06016085.1| conserved hypothetical protein [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|259039658|gb|EEW40785.1| conserved hypothetical protein [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
          Length = 568

 Score = 62.4 bits (150), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 46/79 (58%)

Query: 107 PSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTN 166
           P  +I +  HTDS+G  K N L+S +RA+ ++ ++   G   +   +V+G+    PI TN
Sbjct: 465 PGWLIVVAGHTDSVGEEKANQLLSLKRAESVRDWMRDTGDVPDSCFAVQGYGESRPIATN 524

Query: 167 DTKVGRQNNQRIEIQIFPR 185
            T  GR  N+R+EI + P+
Sbjct: 525 GTPEGRALNRRVEISLVPQ 543


>gi|312885261|ref|ZP_07744938.1| outer membrane protein A precursor [Vibrio caribbenthicus ATCC
           BAA-2122]
 gi|309367068|gb|EFP94643.1| outer membrane protein A precursor [Vibrio caribbenthicus ATCC
           BAA-2122]
          Length = 323

 Score = 62.4 bits (150), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 52/87 (59%), Gaps = 1/87 (1%)

Query: 96  LQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVR 155
           L  I  +L  +P +V+ +  +TD+ G  K N  +S++RA  +K+ LI +G+  +R  ++ 
Sbjct: 229 LDSIVEVLEDYPQSVVEVSGYTDTSGPEKYNQKLSEQRAQAVKAVLIAKGIDESRITAI- 287

Query: 156 GFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           G     PI +N+T  GR+ N+R+EI I
Sbjct: 288 GKGEANPIASNETLEGRKQNRRVEINI 314


>gi|261342420|ref|ZP_05970278.1| OmpA family protein [Enterobacter cancerogenus ATCC 35316]
 gi|288315055|gb|EFC53993.1| OmpA family protein [Enterobacter cancerogenus ATCC 35316]
          Length = 606

 Score = 62.4 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 35/95 (36%), Positives = 51/95 (53%), Gaps = 2/95 (2%)

Query: 96  LQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLI-QRGVSSNRFISV 154
           L  +   + + P  +  I  H+DS G+   NL +S ERA VIK +L+   G+ + +FI+ 
Sbjct: 506 LLAVVPAIRRSPEKMFLIVGHSDSTGSAATNLALSAERAQVIKEWLVAHTGLPAEQFIT- 564

Query: 155 RGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGNIK 189
            G     P+  NDTK GR  N+R+EI    R  IK
Sbjct: 565 EGAGDTRPVANNDTKDGRAQNRRVEIIPLSRQTIK 599


>gi|126736820|ref|ZP_01752555.1| OmpA domain protein [Roseobacter sp. SK209-2-6]
 gi|126721405|gb|EBA18108.1| OmpA domain protein [Roseobacter sp. SK209-2-6]
          Length = 205

 Score = 62.4 bits (150), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 38/147 (25%), Positives = 72/147 (48%), Gaps = 8/147 (5%)

Query: 43  FGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQL---- 98
            G+ LD  E E +  L +  I +   GD +    P  ++F ++        P++Q     
Sbjct: 61  IGNQLDAQERELRQSLANDSISIVNTGDRLILSFPNDLTFATD---SAAISPVVQADLRS 117

Query: 99  IATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFA 158
           +A  L ++P++ + +  HTDS G    N  +S+ RA+ +   +   GV  +R + + G  
Sbjct: 118 VAGSLVRYPNSTVQVIGHTDSDGDASYNQGLSERRANAVADQIQAGGVPYHR-LRIIGLG 176

Query: 159 YKYPIDTNDTKVGRQNNQRIEIQIFPR 185
            + P+ +N T  G+  N+R+E+ I P+
Sbjct: 177 EEQPVASNLTPEGKARNRRVEVVIIPQ 203


>gi|4530365|gb|AAD22005.1| major outer membrane protein [Pseudomonas fluorescens]
          Length = 343

 Score = 62.4 bits (150), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 52/88 (59%), Gaps = 2/88 (2%)

Query: 96  LQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLI-QRGVSSNRFISV 154
           ++ +A  + ++PST   ++ HTDS+G    N  +S+ RA+ +K  L  Q GV S+R  SV
Sbjct: 252 IKNLADFMKQYPSTSTTVEGHTDSVGPDAYNQKLSERRANAVKQVLTNQYGVESSRVQSV 311

Query: 155 RGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
            G+    P+  N T+ GR  N+R+E Q+
Sbjct: 312 -GYGESRPVADNATEAGRAVNRRVEAQV 338


>gi|330807890|ref|YP_004352352.1| hypothetical protein PSEBR_a1170 [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327375998|gb|AEA67348.1| Conserved hypothetical protein; putative outer membrane protein,
           putative OmpA family [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 370

 Score = 62.4 bits (150), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 68/141 (48%), Gaps = 5/141 (3%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSE---VFLEKKFLPMLQLIATIL 103
           LD  E + +  +QD+ + + R  +++    PV  SF  +   + L     P  + +A IL
Sbjct: 138 LDDYEPKLRTAIQDSKLQLERRDNVLVVTAPVDGSFNPDRPAMLLPVTLGPFTR-VAKIL 196

Query: 104 NKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPI 163
              P T + I  H D+ G    NL +SQERA  + +     G+  +R + +RG     P 
Sbjct: 197 EADPKTAVLILGHADTSGAAPANLKLSQERAQSVAAIFRLSGLQRDRLM-LRGMGAVAPR 255

Query: 164 DTNDTKVGRQNNQRIEIQIFP 184
             ND+  GR  N+R+E+ + P
Sbjct: 256 AANDSVEGRALNRRVELLVTP 276


>gi|163754618|ref|ZP_02161740.1| phosphoglycerate kinase [Kordia algicida OT-1]
 gi|161325559|gb|EDP96886.1| phosphoglycerate kinase [Kordia algicida OT-1]
          Length = 457

 Score = 62.4 bits (150), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 54/88 (61%), Gaps = 3/88 (3%)

Query: 95  MLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISV 154
           +L  I  ++  FP+    I  HTDS+G+   N  +S++RA+ +KSYL  +   SN+F ++
Sbjct: 370 ILNKIVELIKGFPAEEFTIGGHTDSVGSDSLNQKLSEKRANAVKSYLESK--LSNKFTAI 427

Query: 155 RGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
            G+    PI +N T+ GR  N+R+EI++
Sbjct: 428 -GYGENEPIASNRTRKGRAQNRRVEIKL 454


>gi|153003419|ref|YP_001377744.1| OmpA/MotB domain-containing protein [Anaeromyxobacter sp. Fw109-5]
 gi|152026992|gb|ABS24760.1| OmpA/MotB domain protein [Anaeromyxobacter sp. Fw109-5]
          Length = 205

 Score = 62.4 bits (150), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 35/95 (36%), Positives = 54/95 (56%), Gaps = 1/95 (1%)

Query: 88  LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVS 147
           L+ + +  L  +  IL K+    I I+ HTDS G+   N  +S++RAD +++ L+ RGV 
Sbjct: 106 LKGEAVTQLTQVGDILAKYADDRIRIEGHTDSSGSDSLNEALSRKRADSVRTVLVSRGVR 165

Query: 148 SNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
             + I+V G     PI  N TK GR  N+R+E+ I
Sbjct: 166 EEQ-ITVVGNGETKPIADNATKEGRAKNRRVELHI 199


>gi|83814826|ref|YP_444492.1| OmpA family protein [Salinibacter ruber DSM 13855]
 gi|83756220|gb|ABC44333.1| OmpA family protein [Salinibacter ruber DSM 13855]
          Length = 230

 Score = 62.4 bits (150), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 40/138 (28%), Positives = 66/138 (47%), Gaps = 4/138 (2%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +D   +E   +L +    V R+G+ I       + F      L  +    L   A  +  
Sbjct: 77  MDTKAEELDEELDNAD--VERVGEGIKVTFDSGILFDFDSSTLRAEARQNLTEFAESMQG 134

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           F  T I +  HTD+ G+ + N  +S  RA+    +L+ RGV  +R  SV G     P+ +
Sbjct: 135 FEDTKILVVGHTDAQGSEEYNQKLSDRRAESATRHLVDRGVDPSRLTSV-GRGETEPVAS 193

Query: 166 NDTKVGRQNNQRIEIQIF 183
           N+T+ GRQ N+R+E+ I+
Sbjct: 194 NETEEGRQQNRRVEVAIY 211


>gi|126440077|ref|YP_001060632.1| ompA family protein [Burkholderia pseudomallei 668]
 gi|126219570|gb|ABN83076.1| ompA family protein [Burkholderia pseudomallei 668]
          Length = 310

 Score = 62.4 bits (150), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 48/85 (56%), Gaps = 1/85 (1%)

Query: 95  MLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISV 154
           +L  +A  L K  +  + I  HTD+ G   +N+ +SQ RAD +K YL+ +G++S +  + 
Sbjct: 222 ILDQMAGALAKMSNRTVEIIGHTDNSGNRTSNIALSQARADAVKGYLVTKGIASQQLTTT 281

Query: 155 RGFAYKYPIDTNDTKVGRQNNQRIE 179
            G     PI  ND+  GR  N+RIE
Sbjct: 282 -GVGPDQPIAPNDSADGRARNRRIE 305


>gi|332886461|gb|EGK06705.1| hypothetical protein HMPREF9456_00579 [Dysgonomonas mossii DSM
           22836]
          Length = 224

 Score = 62.4 bits (150), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 49/85 (57%), Gaps = 1/85 (1%)

Query: 100 ATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAY 159
           A  LN  P T + I  HTD+ G+   N  +S++RA  + ++L  +GVS +R +S +GF  
Sbjct: 129 AASLNNNPDTDVQIYGHTDNTGSDAINNPLSEKRAQAVYNFLQTKGVSGSRMVS-QGFGS 187

Query: 160 KYPIDTNDTKVGRQNNQRIEIQIFP 184
             P+  N +  GR  N+R+E+ I P
Sbjct: 188 TQPVADNSSVAGRAQNRRVEVYILP 212


>gi|325275390|ref|ZP_08141334.1| OmpA/MotB domain-containing protein [Pseudomonas sp. TJI-51]
 gi|324099474|gb|EGB97376.1| OmpA/MotB domain-containing protein [Pseudomonas sp. TJI-51]
          Length = 270

 Score = 62.4 bits (150), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 45/74 (60%), Gaps = 1/74 (1%)

Query: 107 PSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTN 166
           P  V+ I+ +TDS GT + NL +S +RA  +   L+  GV   R + V G+  +YPI+ N
Sbjct: 185 PHRVVRIEGYTDSTGTPEENLKLSHDRAQSVADMLVDLGVDEKR-LQVEGYGDQYPIEAN 243

Query: 167 DTKVGRQNNQRIEI 180
            ++ GR  N+R+EI
Sbjct: 244 ASERGRAQNRRVEI 257


>gi|227540121|ref|ZP_03970170.1| OmpA/MotB:Rickettsia surface antigen [Sphingobacterium spiritivorum
           ATCC 33300]
 gi|300771844|ref|ZP_07081715.1| OmpA family protein [Sphingobacterium spiritivorum ATCC 33861]
 gi|227239982|gb|EEI89997.1| OmpA/MotB:Rickettsia surface antigen [Sphingobacterium spiritivorum
           ATCC 33300]
 gi|300761230|gb|EFK58055.1| OmpA family protein [Sphingobacterium spiritivorum ATCC 33861]
          Length = 173

 Score = 62.4 bits (150), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 52/94 (55%), Gaps = 1/94 (1%)

Query: 87  FLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGV 146
           +L  K    L  +A +L     T I +  HTD+ GT + NL +S +RA  +K +L+  G+
Sbjct: 75  YLTDKSKGELSKLAKLLKDNSKTKIRVDGHTDATGTPEYNLWLSDKRAVSVKKFLVDSGI 134

Query: 147 SSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEI 180
           S +R I+ +G     P+  N T  GRQ N+R+E+
Sbjct: 135 SESR-ITTKGIGQAKPVADNKTPEGRQMNRRVEV 167


>gi|86750700|ref|YP_487196.1| OmpA/MotB [Rhodopseudomonas palustris HaA2]
 gi|86573728|gb|ABD08285.1| OmpA/MotB [Rhodopseudomonas palustris HaA2]
          Length = 451

 Score = 62.4 bits (150), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 48/87 (55%), Gaps = 1/87 (1%)

Query: 93  LPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFI 152
           LP+L+ +A ++   P+  I +  HTD+ G    N  +S+ RA+ +   L + G+ S +  
Sbjct: 362 LPVLKQLAEVIAHCPAATIEVAGHTDAAGKKAANEALSKRRAEAVADNLTKAGIGSAKLT 421

Query: 153 SVRGFAYKYPIDTNDTKVGRQNNQRIE 179
           +V G+    P+  ND+  GR  N+RIE
Sbjct: 422 AV-GYGASKPLAANDSADGRAKNRRIE 447


>gi|288801975|ref|ZP_06407416.1| lipoprotein PG3 [Prevotella melaninogenica D18]
 gi|288335410|gb|EFC73844.1| lipoprotein PG3 [Prevotella melaninogenica D18]
          Length = 225

 Score = 62.4 bits (150), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 45/144 (31%), Positives = 70/144 (48%), Gaps = 13/144 (9%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVF-------LEKKFLPMLQLI 99
           +DK   E   QL +  +      + + C   V V+F S +        L       L   
Sbjct: 74  MDKVAREAAQQLPNARVDKVTDANGLDC---VKVTFDSGILFPLNGSNLSASAKNDLTKF 130

Query: 100 ATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAY 159
           A+++ +  +  +AIQ +TD+ G    NL +SQ RAD + SYL  RGVSS +  SV+GF  
Sbjct: 131 ASLMQRNSNCDVAIQGYTDASGNDNINLPLSQRRADAVSSYLKGRGVSSRQIRSVQGFGS 190

Query: 160 KYPIDTNDTKVGRQNNQRIEIQIF 183
             PI   + K   Q N+R+E+ ++
Sbjct: 191 ANPI---ENKTISQANRRVEVYLY 211


>gi|167740414|ref|ZP_02413188.1| ompA family protein [Burkholderia pseudomallei 14]
          Length = 245

 Score = 62.4 bits (150), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 48/85 (56%), Gaps = 1/85 (1%)

Query: 95  MLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISV 154
           +L  +A  L K  +  + I  HTD+ G   +N+ +SQ RAD +K YL+ +G++S +  + 
Sbjct: 157 ILDQMAGALAKMSNRTVEIIGHTDNSGNRTSNIALSQARADAVKGYLVTKGIASQQLTTT 216

Query: 155 RGFAYKYPIDTNDTKVGRQNNQRIE 179
            G     PI  ND+  GR  N+RIE
Sbjct: 217 -GVGPDQPIAPNDSADGRARNRRIE 240


>gi|330808432|ref|YP_004352894.1| Outer membrane porin F [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327376540|gb|AEA67890.1| Outer membrane porin F [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 344

 Score = 62.4 bits (150), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 52/88 (59%), Gaps = 2/88 (2%)

Query: 96  LQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLI-QRGVSSNRFISV 154
           ++ +A  + ++PST   ++ HTDS+G    N  +S+ RA+ +K  L  Q GV S+R  SV
Sbjct: 253 IKNLADFMKQYPSTSTTVEGHTDSVGPDAYNQKLSERRANAVKQVLTNQYGVESSRVQSV 312

Query: 155 RGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
            G+    P+  N T+ GR  N+R+E Q+
Sbjct: 313 -GYGESRPVADNATEAGRAVNRRVEAQV 339


>gi|53720708|ref|YP_109694.1| putative outer membrane protein [Burkholderia pseudomallei K96243]
 gi|52211122|emb|CAH37110.1| putative outer membrane protein [Burkholderia pseudomallei K96243]
          Length = 310

 Score = 62.4 bits (150), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 48/85 (56%), Gaps = 1/85 (1%)

Query: 95  MLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISV 154
           +L  +A  L K  +  + I  HTD+ G   +N+ +SQ RAD +K YL+ +G++S +  + 
Sbjct: 222 ILDQMAGALAKMSNRTVEIIGHTDNSGNRTSNIALSQARADAVKGYLVTKGIASQQLTTT 281

Query: 155 RGFAYKYPIDTNDTKVGRQNNQRIE 179
            G     PI  ND+  GR  N+RIE
Sbjct: 282 -GVGPDQPIAPNDSADGRARNRRIE 305


>gi|306820526|ref|ZP_07454159.1| outer membrane porin F [Eubacterium yurii subsp. margaretiae ATCC
           43715]
 gi|304551440|gb|EFM39398.1| outer membrane porin F [Eubacterium yurii subsp. margaretiae ATCC
           43715]
          Length = 432

 Score = 62.4 bits (150), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 57/90 (63%), Gaps = 4/90 (4%)

Query: 95  MLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISV 154
           +++LI  +L K       I  HTDS  T + N ++S+ RA+ +K +L++ G+++N  I+ 
Sbjct: 345 LMKLI-DVLKKAKVEKFEIYGHTDSDDTDEYNQVLSENRANSVKDFLVKNGITAN--IAT 401

Query: 155 RGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           +GF  K PI TN TK G+Q N+R+EI I P
Sbjct: 402 KGFGEKKPIATNSTKEGKQLNRRVEI-IIP 430


>gi|254449210|ref|ZP_05062659.1| outer membrane protein [gamma proteobacterium HTCC5015]
 gi|198261187|gb|EDY85483.1| outer membrane protein [gamma proteobacterium HTCC5015]
          Length = 229

 Score = 62.4 bits (150), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 53/97 (54%), Gaps = 3/97 (3%)

Query: 88  LEKKFLPMLQLIATILNKFPSTVIAIQ--SHTDSIGTLKNNLLISQERADVIKSYLIQRG 145
           L  K    L  +A  L    + V ++Q   HTDS G+   N  +S++RA  +KSYL+++G
Sbjct: 124 LSSKGKESLDDLAMKLKALGNGVKSVQIDGHTDSQGSESLNQRVSEQRAQAVKSYLVEQG 183

Query: 146 VSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           V  +  I+ +G+    P+  N T  GR  N+R+EI +
Sbjct: 184 VDGS-LINTKGYGESQPVADNATAAGRAQNRRVEISV 219


>gi|167817630|ref|ZP_02449310.1| ompA family protein [Burkholderia pseudomallei 91]
          Length = 240

 Score = 62.4 bits (150), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 48/85 (56%), Gaps = 1/85 (1%)

Query: 95  MLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISV 154
           +L  +A  L K  +  + I  HTD+ G   +N+ +SQ RAD +K YL+ +G++S +  + 
Sbjct: 152 ILDQMAGALAKMSNRTVEIIGHTDNSGNRTSNIALSQARADAVKGYLVTKGIASQQLTTT 211

Query: 155 RGFAYKYPIDTNDTKVGRQNNQRIE 179
            G     PI  ND+  GR  N+RIE
Sbjct: 212 -GVGPDQPIAPNDSADGRARNRRIE 235


>gi|163744900|ref|ZP_02152260.1| OmpA family domain protein [Oceanibulbus indolifex HEL-45]
 gi|161381718|gb|EDQ06127.1| OmpA family domain protein [Oceanibulbus indolifex HEL-45]
          Length = 221

 Score = 62.4 bits (150), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 38/140 (27%), Positives = 69/140 (49%), Gaps = 3/140 (2%)

Query: 46  SLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSE-VFLEKKFLPMLQLIATILN 104
           SLDK E E +  + D+ +V++  GD +   +P  + F ++   +       L  +A  +N
Sbjct: 81  SLDKQEAELRAAM-DSRVVITNTGDRLIVTLPQDILFATDSTSVAPGLRDDLAALAQNVN 139

Query: 105 KFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPID 164
            + ++ + +  HTDS G    N  +S+ RA  + + L+  GV   R  +  G     P+ 
Sbjct: 140 IYQNSTLQVVGHTDSDGEAAYNQQLSERRAQAVGNILLSNGVPQQRLQTF-GRGESQPVA 198

Query: 165 TNDTKVGRQNNQRIEIQIFP 184
           +N +  G+  N+R+EI I P
Sbjct: 199 SNLSAAGKSQNRRVEIVILP 218


>gi|94311700|ref|YP_584910.1| OmpA/MotB [Cupriavidus metallidurans CH34]
 gi|93355552|gb|ABF09641.1| outer membrane protein, OmpA/MotB family(modular protein)
           [Cupriavidus metallidurans CH34]
          Length = 294

 Score = 62.4 bits (150), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 36/110 (32%), Positives = 56/110 (50%), Gaps = 2/110 (1%)

Query: 76  IPVHVSFVSEV-FLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERA 134
           IP  V+F ++   ++  F  +L  +A  L +       +  HTDS G  + N+ +SQ RA
Sbjct: 183 IPSQVTFDTDSSTIKPSFRNVLDQVAQTLAQHQDVSANVVGHTDSTGNPQYNMQLSQRRA 242

Query: 135 DVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
             +  YL  RGV+  R +S  G     P+  N T+ GR  N+R+EI + P
Sbjct: 243 QSVAGYLGDRGVARTR-LSAEGRGQTQPVADNSTEAGRAQNRRVEIFLKP 291


>gi|332666790|ref|YP_004449578.1| OmpA/MotB domain-containing protein [Haliscomenobacter hydrossis
           DSM 1100]
 gi|332335604|gb|AEE52705.1| OmpA/MotB domain protein [Haliscomenobacter hydrossis DSM 1100]
          Length = 495

 Score = 62.4 bits (150), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 28/72 (38%), Positives = 43/72 (59%), Gaps = 1/72 (1%)

Query: 111 IAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKV 170
           I +  HTD IG    NL +SQ+RAD +  YL+ +GV ++R +S +GF    P+  ND+  
Sbjct: 422 IQLAGHTDDIGEDAQNLALSQKRADAVMKYLVSKGVDASR-LSAKGFGESQPVAANDSDD 480

Query: 171 GRQNNQRIEIQI 182
            R  N+R E ++
Sbjct: 481 NRAQNRRTEFRV 492


>gi|167920717|ref|ZP_02507808.1| ompA family protein [Burkholderia pseudomallei BCC215]
          Length = 247

 Score = 62.4 bits (150), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 48/85 (56%), Gaps = 1/85 (1%)

Query: 95  MLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISV 154
           +L  +A  L K  +  + I  HTD+ G   +N+ +SQ RAD +K YL+ +G++S +  + 
Sbjct: 159 ILDQMAGALAKMSNRTVEIIGHTDNSGNRTSNIALSQARADAVKGYLVTKGIASQQLTTT 218

Query: 155 RGFAYKYPIDTNDTKVGRQNNQRIE 179
            G     PI  ND+  GR  N+RIE
Sbjct: 219 -GVGPDQPIAPNDSADGRARNRRIE 242


>gi|260774919|ref|ZP_05883820.1| outer membrane protein A precursor [Vibrio coralliilyticus ATCC
           BAA-450]
 gi|260609174|gb|EEX35332.1| outer membrane protein A precursor [Vibrio coralliilyticus ATCC
           BAA-450]
          Length = 188

 Score = 62.4 bits (150), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 29/88 (32%), Positives = 51/88 (57%), Gaps = 1/88 (1%)

Query: 95  MLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISV 154
           ML  +   + +FP + + +  +TDS G    N  +S+ RA  +   L ++G+ ++R IS 
Sbjct: 94  MLAELVAFMTEFPQSTVEVVGYTDSSGAASYNQKLSERRAQSVADALEEQGIDASR-ISA 152

Query: 155 RGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           RG     PI +N+T+ GR+ N+R+EI +
Sbjct: 153 RGEGENNPIASNETQQGREQNRRVEIMV 180


>gi|167847521|ref|ZP_02473029.1| ompA family protein [Burkholderia pseudomallei B7210]
          Length = 249

 Score = 62.4 bits (150), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 48/85 (56%), Gaps = 1/85 (1%)

Query: 95  MLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISV 154
           +L  +A  L K  +  + I  HTD+ G   +N+ +SQ RAD +K YL+ +G++S +  + 
Sbjct: 161 ILDQMAGALAKMSNRTVEIIGHTDNSGNRTSNIALSQARADAVKGYLVTKGIASQQLTTT 220

Query: 155 RGFAYKYPIDTNDTKVGRQNNQRIE 179
            G     PI  ND+  GR  N+RIE
Sbjct: 221 -GVGPDQPIAPNDSADGRARNRRIE 244


>gi|332559394|ref|ZP_08413716.1| OmpA/MotB domain-containing protein [Rhodobacter sphaeroides WS8N]
 gi|332277106|gb|EGJ22421.1| OmpA/MotB domain-containing protein [Rhodobacter sphaeroides WS8N]
          Length = 310

 Score = 62.4 bits (150), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 50/96 (52%)

Query: 88  LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVS 147
           LE +  P L  +A  L + P+  + I  HTD+ G L+ N+ +S+ RA  ++  LI R   
Sbjct: 213 LEDRAYPALADLAQWLKEDPARRVVIVGHTDASGGLEGNVTLSRARAASVRERLIARHGV 272

Query: 148 SNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
               ++  G  Y  P  TN T+ GR  N+R+E+ + 
Sbjct: 273 DGAQVTADGVGYLAPRATNRTEEGRARNRRVEVMLL 308


>gi|126453039|ref|YP_001067883.1| ompA family protein [Burkholderia pseudomallei 1106a]
 gi|242315370|ref|ZP_04814386.1| ompA family protein [Burkholderia pseudomallei 1106b]
 gi|254198619|ref|ZP_04905040.1| ompA family protein [Burkholderia pseudomallei S13]
 gi|126226681|gb|ABN90221.1| ompA family protein [Burkholderia pseudomallei 1106a]
 gi|169655359|gb|EDS88052.1| ompA family protein [Burkholderia pseudomallei S13]
 gi|242138609|gb|EES25011.1| ompA family protein [Burkholderia pseudomallei 1106b]
          Length = 310

 Score = 62.4 bits (150), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 48/85 (56%), Gaps = 1/85 (1%)

Query: 95  MLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISV 154
           +L  +A  L K  +  + I  HTD+ G   +N+ +SQ RAD +K YL+ +G++S +  + 
Sbjct: 222 ILDQMAGALAKMSNRTVEIIGHTDNSGNRTSNIALSQARADAVKGYLVTKGIASQQLTTT 281

Query: 155 RGFAYKYPIDTNDTKVGRQNNQRIE 179
            G     PI  ND+  GR  N+RIE
Sbjct: 282 -GVGPDQPIAPNDSADGRARNRRIE 305


>gi|300023765|ref|YP_003756376.1| OmpA/MotB domain protein [Hyphomicrobium denitrificans ATCC 51888]
 gi|299525586|gb|ADJ24055.1| OmpA/MotB domain protein [Hyphomicrobium denitrificans ATCC 51888]
          Length = 716

 Score = 62.4 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 32/87 (36%), Positives = 49/87 (56%), Gaps = 1/87 (1%)

Query: 96  LQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVR 155
           L+ +  + N+ PS  I I+ HTD+ GT + N  +S  RA  +  +L Q GVS+ R +S  
Sbjct: 628 LRDLVEVANECPSFSIEIEGHTDAEGTDERNQRLSDRRARAVADFLTQNGVSARR-LSTI 686

Query: 156 GFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           G+    P+  N T+ GR  N+RIE  +
Sbjct: 687 GYGATRPVADNATETGRAKNRRIEFNV 713


>gi|209883793|ref|YP_002287650.1| OmpA/MotB [Oligotropha carboxidovorans OM5]
 gi|209871989|gb|ACI91785.1| OmpA/MotB [Oligotropha carboxidovorans OM5]
          Length = 464

 Score = 62.4 bits (150), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 32/85 (37%), Positives = 49/85 (57%), Gaps = 1/85 (1%)

Query: 95  MLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISV 154
           +L  +  ++ +  ++ I I  HTDS G  ++NL +S  RA  +  YLI+ GV S R  ++
Sbjct: 377 LLDRLVEVVLRCSTSQIEITGHTDSNGDAESNLALSNRRAQSVADYLIKAGVPSERITAI 436

Query: 155 RGFAYKYPIDTNDTKVGRQNNQRIE 179
            GF    PI  NDT+ G+  N+RIE
Sbjct: 437 -GFGSGRPIAPNDTEEGKAQNRRIE 460


>gi|237742042|ref|ZP_04572523.1| outer membrane porin F [Fusobacterium sp. 4_1_13]
 gi|229429690|gb|EEO39902.1| outer membrane porin F [Fusobacterium sp. 4_1_13]
          Length = 348

 Score = 62.4 bits (150), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 29/88 (32%), Positives = 56/88 (63%), Gaps = 2/88 (2%)

Query: 95  MLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISV 154
           +L+ +A +L +       +  HTDS  + K+N ++S+ RA+ +K++L  +G+++   I++
Sbjct: 260 VLKNLAIVLKEADIKAFEVDGHTDSDASDKHNQILSENRANAVKNFLTSQGITAE--ITI 317

Query: 155 RGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           +G+    PI +NDT  G+Q N+R+EI I
Sbjct: 318 KGYGESRPIASNDTPEGKQKNRRVEIVI 345


>gi|5081414|gb|AAD39369.1|AF117974_1 outer membrane protein OprF [Pseudomonas sp. DC]
          Length = 343

 Score = 62.4 bits (150), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 51/88 (57%), Gaps = 2/88 (2%)

Query: 96  LQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLI-QRGVSSNRFISV 154
           ++ +A  + ++P T   ++ HTDS+G    N  +S+ RA+ +K  L+ Q GV +NR  SV
Sbjct: 252 IKNLADFMKQYPQTTTTVEGHTDSVGPDAYNQKLSERRANAVKQVLVNQYGVGANRVSSV 311

Query: 155 RGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
            G+    P+  N T  GR  N+R+E ++
Sbjct: 312 -GYGETRPVADNATDAGRAVNRRVEAEV 338


>gi|15639284|ref|NP_218733.1| outer membrane protein (tpn50) [Treponema pallidum subsp. pallidum
           str. Nichols]
 gi|189025526|ref|YP_001933298.1| outer membrane protein TpN50 [Treponema pallidum subsp. pallidum
           SS14]
 gi|586110|sp|P38369|TPN50_TREPA RecName: Full=Outer membrane protein tpn50; AltName: Full=Antigen
           tpp57; Flags: Precursor
 gi|3322558|gb|AAC65272.1| outer membrane protein (tpn50) [Treponema pallidum subsp. pallidum
           str. Nichols]
 gi|7144504|gb|AAA20517.2| TpN50 precursor [Treponema pallidum]
 gi|189018101|gb|ACD70719.1| outer membrane protein TpN50 [Treponema pallidum subsp. pallidum
           SS14]
 gi|291059692|gb|ADD72427.1| outer membrane protein Tpn50 (Antigen tpp57) [Treponema pallidum
           subsp. pallidum str. Chicago]
          Length = 417

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 31/87 (35%), Positives = 49/87 (56%)

Query: 96  LQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVR 155
           L+ IA +L  FP   + +  H    G++++   IS+ERADV+  YL + GV     +  R
Sbjct: 328 LRKIAELLRAFPDRELLVSGHAARRGSVQDQQRISEERADVVARYLQELGVVDAAHVYTR 387

Query: 156 GFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           G   +  I  ND++ GR+ N+R+EI I
Sbjct: 388 GCGAQQSIAPNDSEDGRRKNRRVEITI 414


>gi|124004460|ref|ZP_01689305.1| OmpA family protein [Microscilla marina ATCC 23134]
 gi|123990032|gb|EAY29546.1| OmpA family protein [Microscilla marina ATCC 23134]
          Length = 350

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 48/87 (55%)

Query: 96  LQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVR 155
           L  +  +L ++P+ VI I  HTD+IGT   N  +SQ RA  + +YL+ +G      I   
Sbjct: 261 LDKLVKLLKQYPAIVILITGHTDNIGTDTKNFDLSQRRAQTVANYLLTKGGVDPDRIRTE 320

Query: 156 GFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           G     P+ +N+T  GR  N+R+E ++
Sbjct: 321 GMGETQPVMSNNTNTGRALNRRVEFRV 347


>gi|294785320|ref|ZP_06750608.1| outer membrane porin F [Fusobacterium sp. 3_1_27]
 gi|294487034|gb|EFG34396.1| outer membrane porin F [Fusobacterium sp. 3_1_27]
          Length = 396

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 57/90 (63%), Gaps = 3/90 (3%)

Query: 95  MLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISV 154
           +L+ +A +L +       +  HTDS  + K+N ++S+ RA+ +K++L  +G+++   I++
Sbjct: 308 VLKNLAIVLKEADIKAFEVDGHTDSDASDKHNQILSENRANAVKNFLTSQGITAE--ITI 365

Query: 155 RGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           +G+    PI +NDT  G+Q N+R+EI I P
Sbjct: 366 KGYGESRPIASNDTAEGKQKNRRVEI-IIP 394


>gi|261253628|ref|ZP_05946201.1| outer membrane protein A precursor [Vibrio orientalis CIP 102891]
 gi|260937019|gb|EEX93008.1| outer membrane protein A precursor [Vibrio orientalis CIP 102891]
          Length = 324

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 55/90 (61%), Gaps = 2/90 (2%)

Query: 96  LQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVR 155
           L  +   LN +P   + I  +TD+ G  + N ++S++RA+ + + L ++G+ S+R I+ R
Sbjct: 230 LDELVEFLNTYPQANVEIIGYTDTSGAAEYNQVVSEKRAESVATTLEEKGIDSSR-ITAR 288

Query: 156 GFAYKYPIDTNDTKVGRQNNQRIEIQIFPR 185
           G     PI +N+T+ GR+ N+R+E+ I P 
Sbjct: 289 GEGENNPIASNETREGREQNRRVEV-IVPE 317


>gi|167896107|ref|ZP_02483509.1| ompA family protein [Burkholderia pseudomallei 7894]
          Length = 243

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 48/85 (56%), Gaps = 1/85 (1%)

Query: 95  MLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFI