PSIBLAST alignment of GI: 254780953 and protein with PDB id: 2aiz

>gi|159163741|pdb|2AIZ|P Chain P, Solution Structure Of Peptidoglycan Associated Lipoprotein From Haemophilus Influenza Bound To Udp-N-Acetylmuramoyl-L- Alanyl-D-Glutamyl-Meso-2,6-Diaminopimeloyl-D-Alanyl-D- Alanine Length = 134
 Score = 70.4 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 23/106 (21%), Positives = 47/106 (44%), Gaps = 1/106 (0%)

Query: 72  ITCYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQ 131
           +            +  +  +++ +L   A  LN  P+  + ++ +TD  GT + N+ + Q
Sbjct: 25  LQQRYNTVYFGFDKYDITGEYVQILDAHAAYLNATPAAKVLVEGNTDERGTPEYNIALGQ 84

Query: 132 ERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQR 177
            RAD +K YL  +GV + +  +V  +  + P      +     N+R
Sbjct: 85  RRADAVKGYLAGKGVDAGKLGTVS-YGEEKPAVLGHDEAAYSKNRR 129