PSIBLAST alignment of GI: 254780953 and protein with PDB id: 3nb3

>gi|323462898|pdb|3NB3|A Chain A, The Host Outer Membrane Proteins Ompa And Ompc Are Packed At Specific Sites In The Shigella Phage Sf6 Virion As Structural Components Length = 346
>gi|323462899|pdb|3NB3|B Chain B, The Host Outer Membrane Proteins Ompa And Ompc Are Packed At Specific Sites In The Shigella Phage Sf6 Virion As Structural Components Length = 346
 Score = 69.7 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 23/117 (19%), Positives = 45/117 (38%), Gaps = 12/117 (10%)

Query: 77  PVHVSFVSEVFLEKKFLPMLQLIATILNKF--PSTVIAIQSHTDSIGTLKNNLLISQERA 134
              +   ++  L+ +    L  + + L+        + +  +TD IG+   N  +S+ RA
Sbjct: 219 SDVLFNFNKATLKPEGQAALDQLYSQLSNLDPKDGSVVVLGYTDRIGSDAYNQGLSERRA 278

Query: 135 DVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTK---------VGRQNNQRIEIQI 182
             +  YLI +       IS RG     P+  N                 ++R+EI++
Sbjct: 279 QSVVDYLISK-GIPADKISARGMGESNPVTGNTCDNVKQRAALIDCLAPDRRVEIEV 334