BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780953|ref|YP_003065366.1| OmpA/MotB [Candidatus
Liberibacter asiaticus str. psy62]
         (190 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|254780953|ref|YP_003065366.1| OmpA/MotB [Candidatus Liberibacter asiaticus str. psy62]
 gi|254040630|gb|ACT57426.1| OmpA/MotB [Candidatus Liberibacter asiaticus str. psy62]
          Length = 190

 Score =  156 bits (395), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 190/190 (100%), Positives = 190/190 (100%)

Query: 1   MIKELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQD 60
           MIKELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQD
Sbjct: 1   MIKELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQD 60

Query: 61  TGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSI 120
           TGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSI
Sbjct: 61  TGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSI 120

Query: 121 GTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEI 180
           GTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEI
Sbjct: 121 GTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEI 180

Query: 181 QIFPRGNIKK 190
           QIFPRGNIKK
Sbjct: 181 QIFPRGNIKK 190


>gi|56476024|ref|YP_157613.1| outer membrane lipoprotein [Aromatoleum aromaticum EbN1]
 gi|56312067|emb|CAI06712.1| outer membrane lipoprotein containing OmpA/MotB domain [Aromatoleum
           aromaticum EbN1]
          Length = 232

 Score =  154 bits (389), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 52/213 (24%), Positives = 90/213 (42%), Gaps = 31/213 (14%)

Query: 1   MIKELGLSMFIMTTISGCG-----------------------------LASREKKKVFLH 31
           M+K   L+      I+GC                                S ++ K  L 
Sbjct: 1   MMKTALLATVTTLLIAGCAQNPYYGDTAKTARGATIGAGAGAVLGSVVSGSGDRTKGGLI 60

Query: 32  KSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSE-VFLEK 90
            +     V    G  +DK E E + Q+  TG+ V R GD I    P +++F +    ++ 
Sbjct: 61  GAAVGATVGGLIGRQMDKQEAELREQMAGTGVEVQRQGDTIRLQAPENITFDTNRADIKP 120

Query: 91  KFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNR 150
           +F P+L  +A  + ++P TVI ++ HTDS+G+   N  +S+ RA  +    + +      
Sbjct: 121 QFQPVLGQLAQSIQQYPDTVIQVEGHTDSVGSASYNQTLSENRAGAV-RSYLIQRGVDAN 179

Query: 151 FISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
            ++  G+    P+  N T  GR  N+R+E+ I 
Sbjct: 180 RLAAVGYGLTRPVADNSTAAGRAQNRRVEMLIV 212


>gi|239832093|ref|ZP_04680422.1| OmpA family protein [Ochrobactrum intermedium LMG 3301]
 gi|239824360|gb|EEQ95928.1| OmpA family protein [Ochrobactrum intermedium LMG 3301]
          Length = 260

 Score =  153 bits (386), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 61/217 (28%), Positives = 103/217 (47%), Gaps = 34/217 (15%)

Query: 1   MIKELGLSMFIMTTISGCGL--------------------------------ASREKKKV 28
           M+K+ G+++F  T ++GC                                  +SR ++  
Sbjct: 40  MLKKTGIALFAATFLAGCTTDPYTGEQKMSNTAGGAAIGAAVGALGGLMVGGSSRAQRNA 99

Query: 29  FLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV-SEVF 87
            L  +    +     G+ +D+ E+E + QLQ TG+ V+R GD I   +P  ++F   +  
Sbjct: 100 VLIGAGIGALGGGAIGNYMDRQENELRAQLQGTGVSVTRNGDQIILNMPSSITFDTDQDQ 159

Query: 88  LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVS 147
           ++ +F P L  +A +L KF  T++ +  HTDS G++ +N  +SQ RA  + S  +     
Sbjct: 160 VKSQFYPTLNSVAIVLRKFNQTLVDVYGHTDSTGSVSHNQALSQRRAASVAS-YLGSQGI 218

Query: 148 SNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
             R  +V G+    P+ TN T  GR  N+R+EIQI P
Sbjct: 219 DPRRFAVIGYGASQPVATNATPEGRAQNRRVEIQISP 255


>gi|294852539|ref|ZP_06793212.1| outer membrane protein [Brucella sp. NVSL 07-0026]
 gi|294821128|gb|EFG38127.1| outer membrane protein [Brucella sp. NVSL 07-0026]
          Length = 258

 Score =  152 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 59/217 (27%), Positives = 99/217 (45%), Gaps = 34/217 (15%)

Query: 1   MIKELGLSMFIMTTISGCGL--------------------------------ASREKKKV 28
           M+K+ G+++   T ++GC                                  +SR ++  
Sbjct: 13  MLKKTGIALICATFLAGCTTDPYTGQQKVSNTTGGAAIGAAVGALGGLMVGGSSRAQRNA 72

Query: 29  FLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV-SEVF 87
            L  +    +     G+ +D+ E E + QLQ TG+ V+R GD I   +P +++F   +  
Sbjct: 73  VLIGAGIGALGGGLIGNYMDRQEAELRAQLQGTGVSVTRNGDRIILNMPSNITFDTDQDQ 132

Query: 88  LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVS 147
           ++ +F P L  +A +L KF  T++ +   TDS G+   N  +SQ RA  + S  +     
Sbjct: 133 VKSQFYPTLNSVAIVLRKFDKTLVDVYGFTDSTGSASYNQALSQRRAASVAS-YLDSQGI 191

Query: 148 SNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
             R  +V G+    PI +N T  GR  N+R+EIQI P
Sbjct: 192 DPRRFAVIGYGASQPIASNATPEGRAQNRRVEIQISP 228


>gi|148559799|ref|YP_001259124.1| OmpA family protein [Brucella ovis ATCC 25840]
 gi|148371056|gb|ABQ61035.1| OmpA family protein [Brucella ovis ATCC 25840]
          Length = 243

 Score =  152 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 59/217 (27%), Positives = 99/217 (45%), Gaps = 34/217 (15%)

Query: 1   MIKELGLSMFIMTTISGCGL--------------------------------ASREKKKV 28
           M+K+ G+++   T ++GC                                  +SR ++  
Sbjct: 24  MLKKTGIALICATFLAGCTTDPYTGQQKVSNTTGGAAIGAAVGALGGLMVGGSSRAQRNA 83

Query: 29  FLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV-SEVF 87
            L  +    +     G+ +D+ E E + QLQ TG+ V+R GD I   +P +++F   +  
Sbjct: 84  VLIGAGIGALGGGLIGNYMDRQEAELRAQLQGTGVSVTRNGDRIILNMPSNITFDTDQDQ 143

Query: 88  LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVS 147
           ++ +F P L  +A +L KF  T++ +   TDS G+   N  +SQ RA  + S  +     
Sbjct: 144 VKSQFYPTLNSVAIVLRKFDKTLVDVYGFTDSTGSASYNQALSQRRAASVAS-YLDSQGI 202

Query: 148 SNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
             R  +V G+    PI +N T  GR  N+R+EIQI P
Sbjct: 203 DPRRFAVIGYGASQPIASNATPEGRAQNRRVEIQISP 239


>gi|153009315|ref|YP_001370530.1| OmpA/MotB domain-containing protein [Ochrobactrum anthropi ATCC
           49188]
 gi|151561203|gb|ABS14701.1| OmpA/MotB domain protein [Ochrobactrum anthropi ATCC 49188]
          Length = 221

 Score =  152 bits (383), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 61/217 (28%), Positives = 104/217 (47%), Gaps = 34/217 (15%)

Query: 1   MIKELGLSMFIMTTISGCGL--------------------------------ASREKKKV 28
           M+K++G+++F  T ++GC                                  +SR ++  
Sbjct: 1   MLKKIGIALFAATFLAGCTTDPYTGEQKMSNTAGGAAIGAAVGALGGLMVGGSSRAQRNA 60

Query: 29  FLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV-SEVF 87
            L  +    +     G+ +D+ E+E + QLQ TG+ V+R GD I   +P  ++F   +  
Sbjct: 61  VLIGAGIGALGGGAIGNYMDRQENELRAQLQGTGVSVTRNGDQIILNMPSSITFDTDQDQ 120

Query: 88  LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVS 147
           ++ +F P L  +A +L KF  T++ +  HTDS G++ +N  +SQ RA  + S  +     
Sbjct: 121 VKSQFYPTLNSVAIVLRKFNQTLVDVYGHTDSTGSVSHNQALSQRRAASVAS-YLGSQGI 179

Query: 148 SNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
             R  +V G+    P+ TN T  GR  N+R+EIQI P
Sbjct: 180 DPRRFAVIGYGASQPVATNATPEGRAQNRRVEIQISP 216


>gi|225627675|ref|ZP_03785712.1| OmpA family protein [Brucella ceti str. Cudo]
 gi|225617680|gb|EEH14725.1| OmpA family protein [Brucella ceti str. Cudo]
          Length = 243

 Score =  152 bits (383), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 59/217 (27%), Positives = 99/217 (45%), Gaps = 34/217 (15%)

Query: 1   MIKELGLSMFIMTTISGCGL--------------------------------ASREKKKV 28
           M+K+ G+++   T ++GC                                  +SR ++  
Sbjct: 24  MLKKTGIALICATFLAGCTTDPYTGQQKVSNTTGGAAIGAAVGALGGLMVGGSSRAQRNA 83

Query: 29  FLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV-SEVF 87
            L  +    +     G+ +D+ E E + QLQ TG+ V+R GD I   +P +++F   +  
Sbjct: 84  VLIGAGIGALGGGLIGNYMDRQEAELRAQLQGTGVSVTRNGDRIILNMPSNITFDTDQDQ 143

Query: 88  LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVS 147
           ++ +F P L  +A +L KF  T++ +   TDS G+   N  +SQ RA  + S  +     
Sbjct: 144 VKSQFYPTLNSVAIVLRKFDKTLVDVYGFTDSTGSASYNQALSQRRAASVAS-YLDSQGI 202

Query: 148 SNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
             R  +V G+    PI +N T  GR  N+R+EIQI P
Sbjct: 203 DPRRFAVIGYGASQPIASNATPEGRAQNRRVEIQISP 239


>gi|254693909|ref|ZP_05155737.1| Bacterial outer membrane protein [Brucella abortus bv. 3 str.
           Tulya]
 gi|261214200|ref|ZP_05928481.1| OmpA/MotB domain-containing protein [Brucella abortus bv. 3 str.
           Tulya]
 gi|260915807|gb|EEX82668.1| OmpA/MotB domain-containing protein [Brucella abortus bv. 3 str.
           Tulya]
          Length = 216

 Score =  151 bits (382), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 60/213 (28%), Positives = 99/213 (46%), Gaps = 30/213 (14%)

Query: 1   MIKELGLSMFIMTTISGCGL----------------------------ASREKKKVFLHK 32
           M+K+ G+++   T ++GC                              +SR ++   L  
Sbjct: 1   MLKKTGIALICATFLAGCTTDPYTGQQKVSNTTGGAAVGALGGLMVGGSSRAQRNAVLIG 60

Query: 33  SNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV-SEVFLEKK 91
           +    +     G+ +D+ E E + QLQ TG+ V+R GD I   +P +++F   +  ++ +
Sbjct: 61  AGIGALGGGLIGNYMDRQEAELRAQLQGTGVSVTRNGDRIILNMPSNITFDTDQDQVKSQ 120

Query: 92  FLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRF 151
           F P L  +A +L KF  T++ +   TDS G+   N  +SQ RA  + S  +       R 
Sbjct: 121 FYPTLNSVAIVLRKFDKTLVDVYGFTDSTGSASYNQALSQRRAASVAS-YLDSQGIDPRR 179

Query: 152 ISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
            SV G+    PI +N T  GR  N+R+EIQI P
Sbjct: 180 FSVIGYGASQPIVSNATPEGRAQNRRVEIQISP 212


>gi|237815623|ref|ZP_04594620.1| OmpA family protein [Brucella abortus str. 2308 A]
 gi|237788921|gb|EEP63132.1| OmpA family protein [Brucella abortus str. 2308 A]
          Length = 243

 Score =  151 bits (382), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 60/217 (27%), Positives = 99/217 (45%), Gaps = 34/217 (15%)

Query: 1   MIKELGLSMFIMTTISGCGL--------------------------------ASREKKKV 28
           M+K+ G+++   T ++GC                                  +SR ++  
Sbjct: 24  MLKKTGIALICATFLAGCTTDPYTGQQKVSNTTGGAAIGAAVGALGGLMVGGSSRAQRNA 83

Query: 29  FLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV-SEVF 87
            L  +    +     G+ +D+ E E + QLQ TG+ V+R GD I   +P +++F   +  
Sbjct: 84  VLIGAGIGALGGGLIGNYMDRQEAELRAQLQGTGVSVTRNGDRIILNMPSNITFDTDQDQ 143

Query: 88  LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVS 147
           ++ +F P L  +A +L KF  T++ +   TDS G+   N  +SQ RA  + S  +     
Sbjct: 144 VKSQFYPTLNSVAIVLRKFDKTLVDVYGFTDSTGSASYNQALSQRRAASVAS-YLDSQGI 202

Query: 148 SNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
             R  SV G+    PI +N T  GR  N+R+EIQI P
Sbjct: 203 DPRRFSVIGYGASQPIVSNATPEGRAQNRRVEIQISP 239


>gi|23502081|ref|NP_698208.1| OmpA family protein [Brucella suis 1330]
 gi|161619159|ref|YP_001593046.1| OmpA/MotB domain-containing protein [Brucella canis ATCC 23365]
 gi|163843469|ref|YP_001627873.1| OmpA/MotB domain-containing protein [Brucella suis ATCC 23445]
 gi|225852700|ref|YP_002732933.1| OmpA/MotB domain-containing protein [Brucella melitensis ATCC
           23457]
 gi|254701944|ref|ZP_05163772.1| OmpA family protein [Brucella suis bv. 5 str. 513]
 gi|254704489|ref|ZP_05166317.1| OmpA family protein [Brucella suis bv. 3 str. 686]
 gi|254706615|ref|ZP_05168443.1| OmpA family protein [Brucella pinnipedialis M163/99/10]
 gi|254710275|ref|ZP_05172086.1| OmpA family protein [Brucella pinnipedialis B2/94]
 gi|254714272|ref|ZP_05176083.1| OmpA family protein [Brucella ceti M644/93/1]
 gi|254717709|ref|ZP_05179520.1| OmpA family protein [Brucella ceti M13/05/1]
 gi|256031769|ref|ZP_05445383.1| OmpA family protein [Brucella pinnipedialis M292/94/1]
 gi|256044854|ref|ZP_05447758.1| OmpA family protein [Brucella melitensis bv. 1 str. Rev.1]
 gi|256061284|ref|ZP_05451434.1| OmpA family protein [Brucella neotomae 5K33]
 gi|256113758|ref|ZP_05454562.1| OmpA family protein [Brucella melitensis bv. 3 str. Ether]
 gi|256159939|ref|ZP_05457657.1| OmpA family protein [Brucella ceti M490/95/1]
 gi|256255170|ref|ZP_05460706.1| OmpA family protein [Brucella ceti B1/94]
 gi|256369628|ref|YP_003107138.1| OmpA family protein [Brucella microti CCM 4915]
 gi|260168903|ref|ZP_05755714.1| OmpA family protein [Brucella sp. F5/99]
 gi|260565544|ref|ZP_05836028.1| bacterial outer membrane protein [Brucella melitensis bv. 1 str.
           16M]
 gi|260566267|ref|ZP_05836737.1| bacterial outer membrane protein [Brucella suis bv. 4 str. 40]
 gi|261219551|ref|ZP_05933832.1| OmpA/MotB domain-containing protein [Brucella ceti M13/05/1]
 gi|261314075|ref|ZP_05953272.1| OmpA/MotB domain-containing protein [Brucella pinnipedialis
           M163/99/10]
 gi|261317837|ref|ZP_05957034.1| OmpA/MotB domain-containing protein [Brucella pinnipedialis B2/94]
 gi|261322046|ref|ZP_05961243.1| OmpA/MotB domain-containing protein [Brucella ceti M644/93/1]
 gi|261752512|ref|ZP_05996221.1| OmpA/MotB domain-containing protein [Brucella suis bv. 5 str. 513]
 gi|261755171|ref|ZP_05998880.1| OmpA/MotB domain-containing protein [Brucella suis bv. 3 str. 686]
 gi|261758395|ref|ZP_06002104.1| bacterial outer membrane protein [Brucella sp. F5/99]
 gi|306840330|ref|ZP_07473102.1| OmpA family protein [Brucella sp. BO2]
 gi|306844105|ref|ZP_07476699.1| OmpA family protein [Brucella sp. BO1]
 gi|23348039|gb|AAN30123.1| OmpA family protein [Brucella suis 1330]
 gi|161335970|gb|ABX62275.1| OmpA/MotB domain protein [Brucella canis ATCC 23365]
 gi|163674192|gb|ABY38303.1| OmpA/MotB domain protein [Brucella suis ATCC 23445]
 gi|225641065|gb|ACO00979.1| OmpA/MotB domain protein [Brucella melitensis ATCC 23457]
 gi|255999790|gb|ACU48189.1| OmpA family protein [Brucella microti CCM 4915]
 gi|260151612|gb|EEW86706.1| bacterial outer membrane protein [Brucella melitensis bv. 1 str.
           16M]
 gi|260155785|gb|EEW90865.1| bacterial outer membrane protein [Brucella suis bv. 4 str. 40]
 gi|260924640|gb|EEX91208.1| OmpA/MotB domain-containing protein [Brucella ceti M13/05/1]
 gi|261294736|gb|EEX98232.1| OmpA/MotB domain-containing protein [Brucella ceti M644/93/1]
 gi|261297060|gb|EEY00557.1| OmpA/MotB domain-containing protein [Brucella pinnipedialis B2/94]
 gi|261303101|gb|EEY06598.1| OmpA/MotB domain-containing protein [Brucella pinnipedialis
           M163/99/10]
 gi|261738379|gb|EEY26375.1| bacterial outer membrane protein [Brucella sp. F5/99]
 gi|261742265|gb|EEY30191.1| OmpA/MotB domain-containing protein [Brucella suis bv. 5 str. 513]
 gi|261744924|gb|EEY32850.1| OmpA/MotB domain-containing protein [Brucella suis bv. 3 str. 686]
 gi|306275548|gb|EFM57280.1| OmpA family protein [Brucella sp. BO1]
 gi|306289729|gb|EFM60918.1| OmpA family protein [Brucella sp. BO2]
          Length = 220

 Score =  150 bits (380), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 59/217 (27%), Positives = 99/217 (45%), Gaps = 34/217 (15%)

Query: 1   MIKELGLSMFIMTTISGCGL--------------------------------ASREKKKV 28
           M+K+ G+++   T ++GC                                  +SR ++  
Sbjct: 1   MLKKTGIALICATFLAGCTTDPYTGQQKVSNTTGGAAIGAAVGALGGLMVGGSSRAQRNA 60

Query: 29  FLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV-SEVF 87
            L  +    +     G+ +D+ E E + QLQ TG+ V+R GD I   +P +++F   +  
Sbjct: 61  VLIGAGIGALGGGLIGNYMDRQEAELRAQLQGTGVSVTRNGDRIILNMPSNITFDTDQDQ 120

Query: 88  LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVS 147
           ++ +F P L  +A +L KF  T++ +   TDS G+   N  +SQ RA  + S  +     
Sbjct: 121 VKSQFYPTLNSVAIVLRKFDKTLVDVYGFTDSTGSASYNQALSQRRAASVAS-YLDSQGI 179

Query: 148 SNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
             R  +V G+    PI +N T  GR  N+R+EIQI P
Sbjct: 180 DPRRFAVIGYGASQPIASNATPEGRAQNRRVEIQISP 216


>gi|17987069|ref|NP_539703.1| outer membrane protein [Brucella melitensis bv. 1 str. 16M]
 gi|261222366|ref|ZP_05936647.1| OmpA/MotB domain-containing protein [Brucella ceti B1/94]
 gi|261325291|ref|ZP_05964488.1| OmpA/MotB domain-containing protein [Brucella neotomae 5K33]
 gi|265988867|ref|ZP_06101424.1| OmpA/MotB domain-containing protein [Brucella pinnipedialis
           M292/94/1]
 gi|265991281|ref|ZP_06103838.1| OmpA/MotB domain-containing protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|265995118|ref|ZP_06107675.1| OmpA/MotB domain-containing protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|265998331|ref|ZP_06110888.1| OmpA/MotB domain-containing protein [Brucella ceti M490/95/1]
 gi|265999432|ref|ZP_05466341.2| bacterial outer membrane protein [Brucella melitensis bv. 2 str.
           63/9]
 gi|17982726|gb|AAL51967.1| outer membrane protein [Brucella melitensis bv. 1 str. 16M]
 gi|260920950|gb|EEX87603.1| OmpA/MotB domain-containing protein [Brucella ceti B1/94]
 gi|261301271|gb|EEY04768.1| OmpA/MotB domain-containing protein [Brucella neotomae 5K33]
 gi|262552799|gb|EEZ08789.1| OmpA/MotB domain-containing protein [Brucella ceti M490/95/1]
 gi|262766231|gb|EEZ12020.1| OmpA/MotB domain-containing protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|263002065|gb|EEZ14640.1| OmpA/MotB domain-containing protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|263093937|gb|EEZ17871.1| bacterial outer membrane protein [Brucella melitensis bv. 2 str.
           63/9]
 gi|264661064|gb|EEZ31325.1| OmpA/MotB domain-containing protein [Brucella pinnipedialis
           M292/94/1]
 gi|326409224|gb|ADZ66289.1| OmpA/MotB domain-containing protein [Brucella melitensis M28]
 gi|326538933|gb|ADZ87148.1| OmpA/MotB domain protein [Brucella melitensis M5-90]
          Length = 232

 Score =  150 bits (380), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 59/217 (27%), Positives = 99/217 (45%), Gaps = 34/217 (15%)

Query: 1   MIKELGLSMFIMTTISGCGL--------------------------------ASREKKKV 28
           M+K+ G+++   T ++GC                                  +SR ++  
Sbjct: 13  MLKKTGIALICATFLAGCTTDPYTGQQKVSNTTGGAAIGAAVGALGGLMVGGSSRAQRNA 72

Query: 29  FLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV-SEVF 87
            L  +    +     G+ +D+ E E + QLQ TG+ V+R GD I   +P +++F   +  
Sbjct: 73  VLIGAGIGALGGGLIGNYMDRQEAELRAQLQGTGVSVTRNGDRIILNMPSNITFDTDQDQ 132

Query: 88  LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVS 147
           ++ +F P L  +A +L KF  T++ +   TDS G+   N  +SQ RA  + S  +     
Sbjct: 133 VKSQFYPTLNSVAIVLRKFDKTLVDVYGFTDSTGSASYNQALSQRRAASVAS-YLDSQGI 191

Query: 148 SNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
             R  +V G+    PI +N T  GR  N+R+EIQI P
Sbjct: 192 DPRRFAVIGYGASQPIASNATPEGRAQNRRVEIQISP 228


>gi|62290115|ref|YP_221908.1| OmpA family protein [Brucella abortus bv. 1 str. 9-941]
 gi|82700038|ref|YP_414612.1| outer membrane protein MotY [Brucella melitensis biovar Abortus
           2308]
 gi|189024353|ref|YP_001935121.1| outer membrane protein [Brucella abortus S19]
 gi|254689424|ref|ZP_05152678.1| Bacterial outer membrane protein [Brucella abortus bv. 6 str. 870]
 gi|254697559|ref|ZP_05159387.1| Bacterial outer membrane protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254730453|ref|ZP_05189031.1| Bacterial outer membrane protein [Brucella abortus bv. 4 str. 292]
 gi|256257670|ref|ZP_05463206.1| Bacterial outer membrane protein [Brucella abortus bv. 9 str. C68]
 gi|260546663|ref|ZP_05822402.1| bacterial outer membrane protein [Brucella abortus NCTC 8038]
 gi|260754947|ref|ZP_05867295.1| OmpA/MotB domain-containing protein [Brucella abortus bv. 6 str.
           870]
 gi|260758163|ref|ZP_05870511.1| OmpA/MotB domain-containing protein [Brucella abortus bv. 4 str.
           292]
 gi|260761989|ref|ZP_05874332.1| OmpA/MotB domain-containing protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|62196247|gb|AAX74547.1| OmpA family protein [Brucella abortus bv. 1 str. 9-941]
 gi|82616139|emb|CAJ11182.1| MotY protein:Bacterial outer membrane protein:OmpA/MotB domain
           [Brucella melitensis biovar Abortus 2308]
 gi|189019925|gb|ACD72647.1| Bacterial outer membrane protein [Brucella abortus S19]
 gi|260095713|gb|EEW79590.1| bacterial outer membrane protein [Brucella abortus NCTC 8038]
 gi|260668481|gb|EEX55421.1| OmpA/MotB domain-containing protein [Brucella abortus bv. 4 str.
           292]
 gi|260672421|gb|EEX59242.1| OmpA/MotB domain-containing protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260675055|gb|EEX61876.1| OmpA/MotB domain-containing protein [Brucella abortus bv. 6 str.
           870]
          Length = 220

 Score =  150 bits (379), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 60/217 (27%), Positives = 99/217 (45%), Gaps = 34/217 (15%)

Query: 1   MIKELGLSMFIMTTISGCGL--------------------------------ASREKKKV 28
           M+K+ G+++   T ++GC                                  +SR ++  
Sbjct: 1   MLKKTGIALICATFLAGCTTDPYTGQQKVSNTTGGAAIGAAVGALGGLMVGGSSRAQRNA 60

Query: 29  FLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV-SEVF 87
            L  +    +     G+ +D+ E E + QLQ TG+ V+R GD I   +P +++F   +  
Sbjct: 61  VLIGAGIGALGGGLIGNYMDRQEAELRAQLQGTGVSVTRNGDRIILNMPSNITFDTDQDQ 120

Query: 88  LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVS 147
           ++ +F P L  +A +L KF  T++ +   TDS G+   N  +SQ RA  + S  +     
Sbjct: 121 VKSQFYPTLNSVAIVLRKFDKTLVDVYGFTDSTGSASYNQALSQRRAASVAS-YLDSQGI 179

Query: 148 SNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
             R  SV G+    PI +N T  GR  N+R+EIQI P
Sbjct: 180 DPRRFSVIGYGASQPIVSNATPEGRAQNRRVEIQISP 216


>gi|260883956|ref|ZP_05895570.1| OmpA/MotB domain-containing protein [Brucella abortus bv. 9 str.
           C68]
 gi|297248510|ref|ZP_06932228.1| outer membrane protein [Brucella abortus bv. 5 str. B3196]
 gi|260873484|gb|EEX80553.1| OmpA/MotB domain-containing protein [Brucella abortus bv. 9 str.
           C68]
 gi|297175679|gb|EFH35026.1| outer membrane protein [Brucella abortus bv. 5 str. B3196]
          Length = 232

 Score =  150 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 60/217 (27%), Positives = 99/217 (45%), Gaps = 34/217 (15%)

Query: 1   MIKELGLSMFIMTTISGCGL--------------------------------ASREKKKV 28
           M+K+ G+++   T ++GC                                  +SR ++  
Sbjct: 13  MLKKTGIALICATFLAGCTTDPYTGQQKVSNTTGGAAIGAAVGALGGLMVGGSSRAQRNA 72

Query: 29  FLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV-SEVF 87
            L  +    +     G+ +D+ E E + QLQ TG+ V+R GD I   +P +++F   +  
Sbjct: 73  VLIGAGIGALGGGLIGNYMDRQEAELRAQLQGTGVSVTRNGDRIILNMPSNITFDTDQDQ 132

Query: 88  LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVS 147
           ++ +F P L  +A +L KF  T++ +   TDS G+   N  +SQ RA  + S  +     
Sbjct: 133 VKSQFYPTLNSVAIVLRKFDKTLVDVYGFTDSTGSASYNQALSQRRAASVAS-YLDSQGI 191

Query: 148 SNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
             R  SV G+    PI +N T  GR  N+R+EIQI P
Sbjct: 192 DPRRFSVIGYGASQPIVSNATPEGRAQNRRVEIQISP 228


>gi|56460671|ref|YP_155952.1| Outer membrane protein and related peptidoglycan-associated
           (lipo)proteins [Idiomarina loihiensis L2TR]
 gi|56179681|gb|AAV82403.1| Outer membrane protein and related peptidoglycan-associated
           (lipo)proteins [Idiomarina loihiensis L2TR]
          Length = 208

 Score =  149 bits (377), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 57/208 (27%), Positives = 100/208 (48%), Gaps = 25/208 (12%)

Query: 1   MIKELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFG---------------- 44
           M K +   MF    + GC   S  + K     +    ++ K  G                
Sbjct: 1   MKKLVLTMMFSSLALVGCENMSNTQ-KGASIGAVTGALLGKGTGDHDKSRYVWGAAVGAL 59

Query: 45  ------SSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQ 97
                 S +DK E+EF+ +L D+G+ V R GD +   +P +++F      + + F P+L 
Sbjct: 60  AGGAIGSYMDKQEEEFREELADSGVKVIRDGDNLRLQLPSNITFATGSANISQSFNPVLD 119

Query: 98  LIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGF 157
            +A +L K+  T + I+ HTDS G+ + N  +S  RA+ +++ L+      +R ++  G+
Sbjct: 120 DVARVLKKYEKTTMLIEGHTDSTGSAEYNQQLSLNRANAVRNNLVGN-GVDSRRVTTEGY 178

Query: 158 AYKYPIDTNDTKVGRQNNQRIEIQIFPR 185
               P+  NDT+ GRQ N+R+E++I P 
Sbjct: 179 GESMPVADNDTESGRQLNRRVELRIVPN 206


>gi|254719262|ref|ZP_05181073.1| OmpA family protein [Brucella sp. 83/13]
 gi|265984261|ref|ZP_06096996.1| OmpA/MotB domain-containing protein [Brucella sp. 83/13]
 gi|306838013|ref|ZP_07470871.1| OmpA family protein [Brucella sp. NF 2653]
 gi|264662853|gb|EEZ33114.1| OmpA/MotB domain-containing protein [Brucella sp. 83/13]
 gi|306406937|gb|EFM63158.1| OmpA family protein [Brucella sp. NF 2653]
          Length = 220

 Score =  149 bits (376), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 58/217 (26%), Positives = 98/217 (45%), Gaps = 34/217 (15%)

Query: 1   MIKELGLSMFIMTTISGCGL--------------------------------ASREKKKV 28
           M+K+ G+++   T ++GC                                  +SR ++  
Sbjct: 1   MLKKTGIALICATFLAGCTTDPYTGQQKVSNTTGGAAIGAAVGALGGLMVGGSSRAQRNA 60

Query: 29  FLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV-SEVF 87
            L  +    +     G+ +D+ E E + Q Q TG+ V+R GD I   +P +++F   +  
Sbjct: 61  VLIGAGIGALGGGLIGNYMDRQEAELRAQSQGTGVSVTRNGDRIILNMPSNITFDTDQDQ 120

Query: 88  LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVS 147
           ++ +F P L  +A +L KF  T++ +   TDS G+   N  +SQ RA  + S  +     
Sbjct: 121 VKSQFYPTLNSVAIVLRKFDKTLVDVYGFTDSTGSASYNQALSQRRAASVAS-YLDSQGI 179

Query: 148 SNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
             R  +V G+    PI +N T  GR  N+R+EIQI P
Sbjct: 180 DPRRFAVIGYGASQPIASNATPEGRAQNRRVEIQISP 216


>gi|90420689|ref|ZP_01228595.1| outer membrane protein [Aurantimonas manganoxydans SI85-9A1]
 gi|90334980|gb|EAS48741.1| outer membrane protein [Aurantimonas manganoxydans SI85-9A1]
          Length = 220

 Score =  149 bits (375), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 51/217 (23%), Positives = 95/217 (43%), Gaps = 35/217 (16%)

Query: 2   IKELGLSMFIMTTISGCGL---------------------------------ASREKKKV 28
           +K+L   + +    +GC                                   A  +  + 
Sbjct: 1   MKKLAFVLALTVAFAGCTTDPYTGEQKLSNTVGGAGIGAGVGALGGYLVGRAAGVDSGRA 60

Query: 29  FLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV-SEVF 87
            L  +    +     G+ +D  E + + QL+ TG+ V+R+GD I   +P +++F   +  
Sbjct: 61  ALIGAGIGTLGGGAVGAYMDNQEAKLRDQLRGTGVSVTRVGDRIILNMPSNITFPTDQSS 120

Query: 88  LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVS 147
           +   F P L  +A +L ++  +++ +  HTDS G+   N  +SQ+RA  +   L  +   
Sbjct: 121 ILPAFYPTLNSVALVLKEYDKSIVNVYGHTDSQGSDGYNFTLSQQRASSVSQLLASQ-GV 179

Query: 148 SNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
             R ++ +GF    P+ +NDT+ GR  N+R+EI I P
Sbjct: 180 DPRRLNTQGFGESQPVASNDTESGRAQNRRVEIAISP 216


>gi|254428835|ref|ZP_05042542.1| Rickettsia 17 kDa surface antigen family [Alcanivorax sp. DG881]
 gi|196195004|gb|EDX89963.1| Rickettsia 17 kDa surface antigen family [Alcanivorax sp. DG881]
          Length = 221

 Score =  147 bits (370), Expect = 9e-34,   Method: Composition-based stats.
 Identities = 55/219 (25%), Positives = 104/219 (47%), Gaps = 37/219 (16%)

Query: 2   IKELG--LSMFIMTTISGCGL---------------------------------ASREKK 26
           +K     L++     ++GC                                   +++E+K
Sbjct: 1   MKRFAGSLALASAIAVTGCSTVNPYTGEKQTSKATSGAAIGAVAGALIGIATSDSAKERK 60

Query: 27  KVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEV 86
           +  L  +    +     G  +D  E + + +L+  G+ V+R G+ I   +P +++F ++ 
Sbjct: 61  ERALAGAGIGAVTGGGVGYYMDVQEAKLRQKLEGAGVSVTRDGENIILNMPGNLTFATDS 120

Query: 87  F-LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRG 145
             ++  F P+L  ++ +LN++ ST+I +  HTDS G  + NLL+SQ+RA  + + L   G
Sbjct: 121 TNVKSSFDPVLDAVSEVLNEYKSTMIQVAGHTDSTGGDRYNLLLSQQRAQAVSNKLSGYG 180

Query: 146 VSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           V   R  +V GF    PI +N+T  GR+ N+R+E+ + P
Sbjct: 181 VEQVRLDTV-GFGETQPIASNNTASGREQNRRVELTLLP 218


>gi|110834272|ref|YP_693131.1| OmpA family protein [Alcanivorax borkumensis SK2]
 gi|110647383|emb|CAL16859.1| OmpA family protein [Alcanivorax borkumensis SK2]
          Length = 221

 Score =  145 bits (367), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 48/219 (21%), Positives = 99/219 (45%), Gaps = 37/219 (16%)

Query: 2   IKELG--LSMFIMTTISGCGL---------------------------------ASREKK 26
           +K     +++     ++GC                                   +++E+K
Sbjct: 1   MKRFAGSIALASAIAVTGCSTINPYTGEKQTSKATSGAAIGAVAGALIGIATSDSAKERK 60

Query: 27  KVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEV 86
           +  L  +    +     G  +D  E + + +L+  G+ V+R G+ I   +P +++F ++ 
Sbjct: 61  ERALAGAGIGAVTGGGVGYYMDVQEAKLRQKLEGAGVSVTRDGENIILNMPGNLTFATDS 120

Query: 87  -FLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRG 145
             ++  F P+L+ +A +L ++ ST+I +  HTDS G  + NLL+SQ+RA  + +  +   
Sbjct: 121 TDVKPSFDPVLEAVAEVLKEYKSTMIQVAGHTDSTGGDRYNLLLSQQRAQAVSNK-LSAF 179

Query: 146 VSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
                 +   GF    PI +N +  GR+ N+R+E+ + P
Sbjct: 180 GVEQVRLDPVGFGETQPIASNSSASGREQNRRVELTLLP 218


>gi|85711329|ref|ZP_01042388.1| Outer membrane protein and related
           peptidoglycan-associated(lipo)proteins [Idiomarina
           baltica OS145]
 gi|85694830|gb|EAQ32769.1| Outer membrane protein and related
           peptidoglycan-associated(lipo)proteins [Idiomarina
           baltica OS145]
          Length = 188

 Score =  145 bits (367), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 54/168 (32%), Positives = 92/168 (54%), Gaps = 2/168 (1%)

Query: 21  ASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHV 80
                K  +L  +    +     G+ +DK E+ F+ +L  +G+ V R GD I   +P ++
Sbjct: 22  TGDHDKSRYLWGAAVGALAGSAIGNYMDKQEEAFRDELSGSGVQVIRDGDNIRLQLPGNI 81

Query: 81  SFVS-EVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKS 139
           +F S    + + F P+L+ +A +LNK+  T + I+ HTDS G+   N  +S  RA+ +++
Sbjct: 82  TFASESANISQNFYPVLEDVAAVLNKYNKTTMMIEGHTDSTGSADYNQQLSLNRANAVRN 141

Query: 140 YLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGN 187
           YL+      +R ++ +GF    PI TNDT  GRQ N+R+E++I P   
Sbjct: 142 YLVG-YGVDSRRVTTQGFGESQPIATNDTAQGRQQNRRVELRIIPNQQ 188


>gi|109900555|ref|YP_663810.1| OmpA/MotB [Pseudoalteromonas atlantica T6c]
 gi|109702836|gb|ABG42756.1| OmpA/MotB [Pseudoalteromonas atlantica T6c]
          Length = 215

 Score =  145 bits (366), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 55/212 (25%), Positives = 100/212 (47%), Gaps = 29/212 (13%)

Query: 1   MIKELGLSMFIM-TTISGCGL--------------------------ASREKKKVFLHKS 33
           M K+L + + +    +SGC                                 K  ++  +
Sbjct: 1   MYKKLVIGVALSGLVLSGCASNSMGGASNTQKGAGIGAIVGALIGKGTGDNDKSRYVWGA 60

Query: 34  NDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV-SEVFLEKKF 92
               +     G+ +DK E+EF+ +L D+G+ V R GD +  Y+P  ++F      ++  F
Sbjct: 61  AVGALAGSAIGNYMDKQEEEFREELADSGVEVYREGDTLRLYMPGSITFSSGNASVDSSF 120

Query: 93  LPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFI 152
            P+L+ +A ++NK+  T + ++ HTD+ G    N  +S+ RA+ +K+  + +    NR +
Sbjct: 121 YPVLKDVALVINKYEKTTLMVEGHTDNTGADDMNQRLSEARANSVKN-YLVQNGVDNRRV 179

Query: 153 SVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           S  G     PI  N T+ GRQ N+R+E++I P
Sbjct: 180 STLGMGEYTPIADNATQAGRQKNRRVELKIIP 211


>gi|163759606|ref|ZP_02166691.1| OmpA/MotB [Hoeflea phototrophica DFL-43]
 gi|162283203|gb|EDQ33489.1| OmpA/MotB [Hoeflea phototrophica DFL-43]
          Length = 215

 Score =  144 bits (362), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 59/214 (27%), Positives = 97/214 (45%), Gaps = 31/214 (14%)

Query: 1   MIKELGLSMFIMTTISGCGLAS-----------------------------REKKKVFLH 31
           M  +L ++      +SGC                                  + +K  L 
Sbjct: 1   MKSKLLIAAIAAVFVSGCTTDPYTGQQKVSNLAGGAALGALGGAALGTLAGGDDRKNALI 60

Query: 32  KSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV-SEVFLEK 90
            +    +     G  +D+ E + + QLQ TG+ V+R+GD I   +P +++F   +  ++ 
Sbjct: 61  GAGVGALAGGAIGGYMDQQEAQLRAQLQGTGVSVTRVGDKIILNMPSNITFDSDQSAVKP 120

Query: 91  KFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNR 150
           +F   L  +A +L KF  +++ +  HTDS G+   NL +SQ+RA  + SYLI +  +  R
Sbjct: 121 QFYETLNSVALVLQKFNRSLVDVAGHTDSTGSDSYNLTLSQQRAQSVSSYLISQ-GNDAR 179

Query: 151 FISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
               +GF    PI  N T  GR  N+R+EIQI P
Sbjct: 180 RFYTQGFGESRPIADNGTDAGRAANRRVEIQISP 213


>gi|49188511|ref|YP_025325.1| OmpA [Pseudomonas alcaligenes]
 gi|5123490|gb|AAD40344.1|U88088_22 OmpA [Pseudomonas alcaligenes]
          Length = 220

 Score =  144 bits (362), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 53/215 (24%), Positives = 95/215 (44%), Gaps = 31/215 (14%)

Query: 2   IKELGLSMFIMTTISGCGLASRE-----------------------------KKKVFLHK 32
           +K +  +  ++ T++GC     E                             + +  L  
Sbjct: 1   MKSVIAASLVIFTLTGCASIQNEDGTTKNTALYGAGGALAGAVAGALIGKENRAQGALIG 60

Query: 33  SNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKK 91
           +     +   +G   DK E E + Q++ +G+ V R GD I   +P  ++F   +  ++  
Sbjct: 61  AAVAGSLGAGYGYYADKQEAELREQMKGSGVQVERQGDEIVIVMPGAITFATGKAEIQPN 120

Query: 92  FLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRF 151
           F   L  +A     +P + + +  HTDS+G+ + N L+SQ RA  +  +L   GV ++R 
Sbjct: 121 FANTLNQLAGSFRNYPDSRLIVTGHTDSVGSYEANELLSQRRAQSVAQFLRGNGVQTDR- 179

Query: 152 ISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRG 186
           I V G     P+ +N T  GR  N+R+EI++ PR 
Sbjct: 180 IEVIGAGPNQPVASNATAEGRAQNRRVEIKLAPRA 214


>gi|114707989|ref|ZP_01440881.1| OmpA family protein [Fulvimarina pelagi HTCC2506]
 gi|114536618|gb|EAU39750.1| OmpA family protein [Fulvimarina pelagi HTCC2506]
          Length = 221

 Score =  143 bits (361), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 55/218 (25%), Positives = 94/218 (43%), Gaps = 35/218 (16%)

Query: 1   MIKELGLSMFIMTTISGCGL---------------------------------ASREKKK 27
           MIK++   + +   + GC                                      ++  
Sbjct: 1   MIKKITAVLCLSVAMGGCTTDPYTGEMKISNTLGGAGLGTGLGAAGGYLVARATGSDEAT 60

Query: 28  VFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV-SEV 86
                +    +     G+ +D  E + + QLQ TG+ V+R+GD I   +P +V+F   + 
Sbjct: 61  AAAIGAGLGGLAGAGIGAYMDNQEAQLRQQLQGTGVSVTRVGDRIILNMPSNVTFPSDQS 120

Query: 87  FLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGV 146
            +   F P L  +A +L KF  T++ +  HTDS G    NL +SQ+RA  +  +L  R  
Sbjct: 121 QILPGFYPTLDSVAIVLQKFDETIVNVYGHTDSQGGDGYNLSLSQQRASSVSQFLASR-G 179

Query: 147 SSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
            +   ++ +G+    PI  N T+ GR  N+R+E+QI P
Sbjct: 180 VNPNRLNTQGYGESQPIADNSTEAGRARNRRVEVQISP 217


>gi|241205517|ref|YP_002976613.1| OmpA/MotB domain protein [Rhizobium leguminosarum bv. trifolii
           WSM1325]
 gi|240859407|gb|ACS57074.1| OmpA/MotB domain protein [Rhizobium leguminosarum bv. trifolii
           WSM1325]
          Length = 221

 Score =  142 bits (358), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 59/218 (27%), Positives = 95/218 (43%), Gaps = 35/218 (16%)

Query: 1   MIKELGLSMFIMTTISGCGLASR---------------------------------EKKK 27
           MIK+  L     + +S C                                       K+ 
Sbjct: 1   MIKKFVLLAIAASYLSACTTTDPYTGEQKVSNTAGGAALGALGGALVGVAVGGGGHGKRN 60

Query: 28  VFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV-SEV 86
             L  +    +     G+ +D+ E E + QL+ TGI V+R GD I   +P +++F   + 
Sbjct: 61  AALIGAGVGALAGGAIGNYMDQQESELRAQLEGTGISVTRNGDNIILNMPSNITFDVDQD 120

Query: 87  FLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGV 146
            ++  F P L  +A +L KF  T+I +  HTDS G+L++N  +SQ RA  +    +    
Sbjct: 121 AVKPGFYPTLNSVAIVLRKFNRTLIDVNGHTDSTGSLQHNQDLSQRRALSVAD-YLGGQG 179

Query: 147 SSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
              R +S  GF    P+ +N ++ GR  N+R+EIQI P
Sbjct: 180 IDQRRVSAVGFGPSQPVASNASEAGRAQNRRVEIQIAP 217


>gi|114319490|ref|YP_741173.1| OmpA/MotB domain-containing protein [Alkalilimnicola ehrlichii
           MLHE-1]
 gi|114225884|gb|ABI55683.1| OmpA/MotB domain protein [Alkalilimnicola ehrlichii MLHE-1]
          Length = 224

 Score =  142 bits (358), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 52/157 (33%), Positives = 84/157 (53%), Gaps = 2/157 (1%)

Query: 29  FLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVF 87
            L  +    +     G  +D+  +E + +L+ TG+ V+R G+ +   +P HV+F      
Sbjct: 66  ALIGAGIGALSGAAVGGYMDRQAEELRQRLRGTGVSVTRDGENVILNMPGHVTFAFDSAD 125

Query: 88  LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVS 147
           L   F  +L  +A + N+F  T+I +  HTDS G  + N  +S+ RA  +  YL+ R V+
Sbjct: 126 LRSDFFEVLDSVAIVANEFDQTMIEVAGHTDSTGPAEYNQRLSERRAQTVARYLVGRDVA 185

Query: 148 SNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
             R I+V GF  + PI +N T+ GRQ N+R+EI   P
Sbjct: 186 EMRMIAV-GFGEERPIASNQTEEGRQQNRRVEITFLP 221


>gi|116253010|ref|YP_768848.1| OmpA family outer membrane protein [Rhizobium leguminosarum bv.
           viciae 3841]
 gi|115257658|emb|CAK08755.1| putative OmpA family outer membrane protein [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 221

 Score =  142 bits (358), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 59/218 (27%), Positives = 95/218 (43%), Gaps = 35/218 (16%)

Query: 1   MIKELGLSMFIMTTISGCGLASR---------------------------------EKKK 27
           MIK+  L     + +S C                                       K+ 
Sbjct: 1   MIKKFILLAIAASYLSACTTTDPYTGEQKVSNTAGGAALGALGGALVGVAVGGGGHGKRN 60

Query: 28  VFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV-SEV 86
             L  +    +     G+ +D+ E E + QL+ TGI V+R GD I   +P +++F   + 
Sbjct: 61  AALIGAGVGALAGGAIGNYMDQQESELRAQLEGTGISVTRNGDNIILNMPSNITFDVDQD 120

Query: 87  FLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGV 146
            ++  F P L  +A +L KF  T+I +  HTDS G+L++N  +SQ RA  +    +    
Sbjct: 121 AVKPGFYPTLNSVAIVLRKFNRTLIDVNGHTDSTGSLQHNQDLSQRRALSVAD-YLGGQG 179

Query: 147 SSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
              R +S  GF    P+ +N ++ GR  N+R+EIQI P
Sbjct: 180 IDQRRVSAVGFGPSQPVASNASEAGRAQNRRVEIQIAP 217


>gi|209550136|ref|YP_002282053.1| OmpA/MotB domain protein [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|209535892|gb|ACI55827.1| OmpA/MotB domain protein [Rhizobium leguminosarum bv. trifolii
           WSM2304]
          Length = 221

 Score =  142 bits (357), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 58/218 (26%), Positives = 95/218 (43%), Gaps = 35/218 (16%)

Query: 1   MIKELGLSMFIMTTISGCGLASR---------------------------------EKKK 27
           MIK+  L     + ++ C                                       K+ 
Sbjct: 1   MIKKFVLLAVAASYLTACTTTDPYTGEQKVSNTAGGAALGALGGALVGVAVGGGGHGKRN 60

Query: 28  VFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV-SEV 86
             L  +    +     G+ +D+ E E + QL+ TGI V+R GD I   +P +++F   + 
Sbjct: 61  AALIGAGVGALAGGAIGNYMDQQESELRAQLEGTGISVTRNGDNIILNMPSNITFDVDQD 120

Query: 87  FLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGV 146
            ++  F P L  +A +L KF  T+I +  HTDS G+L++N  +SQ RA  +    +    
Sbjct: 121 AVKPGFYPTLNSVAIVLRKFNRTLIDVNGHTDSTGSLQHNQDLSQRRALSVAD-YLGGQG 179

Query: 147 SSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
              R +S  GF    P+ +N ++ GR  N+R+EIQI P
Sbjct: 180 IDQRRVSAVGFGPSQPVASNASEAGRAQNRRVEIQIAP 217


>gi|285017932|ref|YP_003375643.1| hypothetical protein XALc_1141 [Xanthomonas albilineans GPE PC73]
 gi|283473150|emb|CBA15656.1| hypothetical protein XALc_1141 [Xanthomonas albilineans]
          Length = 231

 Score =  142 bits (357), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 51/182 (28%), Positives = 93/182 (51%), Gaps = 4/182 (2%)

Query: 6   GLSMFIMTTISG--CGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGI 63
            L    +  ++G   G ++ E+++  +  +    +     G+  D+ E   + +  +TGI
Sbjct: 48  ALIGTAVGVVAGLLSGSSATERRQHAMIGAGIGALSGAAIGNYQDRQERALRERTANTGI 107

Query: 64  VVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGT 122
            V R GD IT  +P  ++F  ++  L+ +F   L  +A  L+++  T+I +  HTD+IG+
Sbjct: 108 DVRRDGDNITLNLPDGITFDFNQSTLKPQFYSALNGVAKTLSEYNQTMIEVVGHTDNIGS 167

Query: 123 LKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
              N  +S++RA  + +YL  +       I   G   KYPI  N T+ GR  N+R+EI++
Sbjct: 168 DAVNQRLSEQRASSVAAYLTAQ-GVQPERIQTLGAGKKYPIADNSTEAGRAQNRRVEIRV 226

Query: 183 FP 184
            P
Sbjct: 227 VP 228


>gi|190892542|ref|YP_001979084.1| outer membrane peptidoglycan-associated lipoprotein [Rhizobium etli
           CIAT 652]
 gi|190697821|gb|ACE91906.1| outer membrane peptidoglycan-associated lipoprotein [Rhizobium etli
           CIAT 652]
 gi|327192440|gb|EGE59397.1| outer membrane peptidoglycan-associated lipoprotein [Rhizobium etli
           CNPAF512]
          Length = 221

 Score =  141 bits (356), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 57/218 (26%), Positives = 94/218 (43%), Gaps = 35/218 (16%)

Query: 1   MIKELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFG---------------- 44
           MIK+  L     + +S C        +  +  +     +    G                
Sbjct: 1   MIKKFILLAVAASYLSACTTTDPYTGEQKVSNTAGGAALGALGGALVGVAVGGGGHGKRN 60

Query: 45  -----------------SSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV-SEV 86
                            + +D+ E E + QL+ TGI V+R GD I   +P +++F   + 
Sbjct: 61  AALIGAGIGALAGGAIGNYMDQQEAELRAQLEGTGISVTRNGDNIILNMPSNITFDVDQD 120

Query: 87  FLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGV 146
            ++  F P L  +A +L KF  T+I +  HTDS G+L++N  +SQ RA  +    +    
Sbjct: 121 AVKPGFYPTLNSVAIVLRKFNRTLIDVNGHTDSTGSLQHNQDLSQRRALSVAD-YLGGQG 179

Query: 147 SSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
              R +S  GF    P+ +N ++ GR  N+R+EIQI P
Sbjct: 180 IDQRRVSAVGFGPSQPVASNASEAGRAQNRRVEIQIAP 217


>gi|332308557|ref|YP_004436408.1| OmpA/MotB domain protein [Glaciecola agarilytica 4H-3-7+YE-5]
 gi|332175886|gb|AEE25140.1| OmpA/MotB domain protein [Glaciecola agarilytica 4H-3-7+YE-5]
          Length = 215

 Score =  141 bits (356), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 54/212 (25%), Positives = 101/212 (47%), Gaps = 29/212 (13%)

Query: 1   MIKELGLSMFIM-TTISGCGL--------------------------ASREKKKVFLHKS 33
           M K+L + + +    +SGC                                 K  ++  +
Sbjct: 1   MYKKLIVGVALSGLVLSGCASNSMGNASNTQKGAGIGAIVGALIGKGTGDNDKSRYVWGA 60

Query: 34  NDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV-SEVFLEKKF 92
               +     G+ +D+ E+EF+ +L D+G+ V R GD++  Y+P  ++F      ++  F
Sbjct: 61  AVGALAGSAIGNYMDRQEEEFREELADSGVEVYREGDVLRLYMPGSITFSSGNASVDSSF 120

Query: 93  LPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFI 152
            P+L+ +A ++NK+  T + ++ HTD+ G    N  +S+ RA+ +K+  + +    NR +
Sbjct: 121 FPVLKDVALVINKYEKTTLMVEGHTDNTGADDMNQRLSEARANSVKN-YLVQNGVDNRRV 179

Query: 153 SVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           S  G     PI  N T+ GRQ N+R+E++I P
Sbjct: 180 STLGMGEYTPIADNTTQAGRQKNRRVELKIIP 211


>gi|86358413|ref|YP_470305.1| outer membrane lipoprotein [Rhizobium etli CFN 42]
 gi|86282515|gb|ABC91578.1| outer membrane lipoprotein [Rhizobium etli CFN 42]
          Length = 221

 Score =  141 bits (356), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 57/218 (26%), Positives = 94/218 (43%), Gaps = 35/218 (16%)

Query: 1   MIKELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFG---------------- 44
           MIK+  L     + +S C        +  +  +     +    G                
Sbjct: 1   MIKKFVLLAVAASYLSACTTTDPYTGEQKVSNTAGGAALGALGGALVGVAVGGGGHGKRN 60

Query: 45  -----------------SSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV-SEV 86
                            + +D+ E E + QL+ TGI V+R GD I   +P +++F   + 
Sbjct: 61  AALIGAGIGALAGGAIGNYMDQQEAELRAQLEGTGISVTRNGDNIILNMPSNITFDVDQD 120

Query: 87  FLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGV 146
            ++  F P L  +A +L KF  T+I +  HTDS G+L++N  +SQ RA  +    +    
Sbjct: 121 AVKPGFYPTLNSVAIVLRKFNRTLIDVNGHTDSTGSLQHNQDLSQRRALSVAD-YLGGQG 179

Query: 147 SSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
              R +S  GF    P+ +N ++ GR  N+R+EIQI P
Sbjct: 180 IDQRRVSAVGFGPSQPVASNASEAGRAQNRRVEIQIAP 217


>gi|91792625|ref|YP_562276.1| OmpA/MotB [Shewanella denitrificans OS217]
 gi|91714627|gb|ABE54553.1| OmpA/MotB [Shewanella denitrificans OS217]
          Length = 223

 Score =  141 bits (356), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 55/167 (32%), Positives = 87/167 (52%), Gaps = 2/167 (1%)

Query: 19  GLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPV 78
             + +++ K  L  +     V    G  +D  E + + QL+ TG+ V+R GD I   +P 
Sbjct: 56  SASKKDRAKGALIGAASGAAVGTGIGYYMDVQEAKLRKQLKSTGVSVTRSGDNIILNMPN 115

Query: 79  HVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVI 137
            V+F V E  L  +   +L  +A +  +F  T + I  +TDS G+   NL +SQ RA+ +
Sbjct: 116 DVTFGVDETVLSSRAKEVLASVALVAKEFDDTRLHITGYTDSSGSDSYNLRLSQVRANEV 175

Query: 138 KSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
             YL+Q+ V++NR +S  G     PI  N T  GR  N+R+EI + P
Sbjct: 176 GQYLMQQKVAANRVVS-SGRGESSPIADNGTPAGRAQNRRVEIVLSP 221


>gi|88860858|ref|ZP_01135494.1| putative lipoprotein [Pseudoalteromonas tunicata D2]
 gi|88817071|gb|EAR26890.1| putative lipoprotein [Pseudoalteromonas tunicata D2]
          Length = 214

 Score =  141 bits (355), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 61/206 (29%), Positives = 104/206 (50%), Gaps = 23/206 (11%)

Query: 2   IKELGL-SMFIMTTISGCG--------------------LASREKKKVFLHKSNDTDIVN 40
           +K++ + S+ I   +SGC                       S  K K  ++ +    I  
Sbjct: 8   LKKIIIPSVIIPLFLSGCAATNAEKGAAIGAVAGAVLGKSTSNHKDKRLIYGAAIGAIAG 67

Query: 41  KRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLI 99
              GS +DK E  F+ +L  +G+ V R GD +   +P +++F   + ++   F   L  I
Sbjct: 68  AAVGSYMDKQEQAFRDELAGSGVEVVREGDNLRLVMPSNITFATDQSYISTGFHDTLDAI 127

Query: 100 ATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAY 159
           A ++NK+  T ++I+ HTDS G  + N  +S++RA  +K+YL+ + +   R IS +G+  
Sbjct: 128 AKVMNKYEKTFLSIEGHTDSTGKTEYNQNLSEQRALSVKNYLLNKQILDVR-ISTQGWGE 186

Query: 160 KYPIDTNDTKVGRQNNQRIEIQIFPR 185
             PI +N+T  GR  N+R+EIQI P 
Sbjct: 187 SRPIASNETSSGRALNRRVEIQIVPN 212


>gi|222150201|ref|YP_002551158.1| porin [Agrobacterium vitis S4]
 gi|221737183|gb|ACM38146.1| porin [Agrobacterium vitis S4]
          Length = 221

 Score =  140 bits (354), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 58/218 (26%), Positives = 91/218 (41%), Gaps = 35/218 (16%)

Query: 1   MIKELGLSMFIMTTISGCGLASREKKKVFLHKSNDTD----------------------- 37
           M+K+  L     T +S C        +  +  +                           
Sbjct: 1   MLKKFILLALTATYLSACTTTDPYTGEQKMSNTAGGAMIGAGLGALGGLAVGGGGHGKRN 60

Query: 38  ----------IVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV-SEV 86
                     +     GS +D  E E + QLQ TG+ V+R GD I   +P +++F   + 
Sbjct: 61  AALIGAGIGALAGGAIGSYMDNQEAELRAQLQGTGVSVTRQGDRIILNMPSNITFPTDQD 120

Query: 87  FLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGV 146
            +   F P L  +A +L KF  T++ +  HTDS G L++N  +SQ RA+ + +  +    
Sbjct: 121 QVLPPFYPTLNSVAIVLKKFNRTLVDVNGHTDSTGGLQHNQDLSQRRAESVLN-YLGSQG 179

Query: 147 SSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
              R +S  GF    PI TN T  GR  N+R+E+ I P
Sbjct: 180 VDPRRMSAMGFGPSQPIATNATPQGRAQNRRVEVAISP 217


>gi|190573806|ref|YP_001971651.1| putative outer membrane lipoprotein [Stenotrophomonas maltophilia
           K279a]
 gi|190011728|emb|CAQ45347.1| putative outer membrane lipoprotein [Stenotrophomonas maltophilia
           K279a]
          Length = 231

 Score =  140 bits (352), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 52/176 (29%), Positives = 85/176 (48%), Gaps = 4/176 (2%)

Query: 10  FIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIG 69
                ++G   ++ E+++  L  +    +     G   D+ E   + +  +TGI V R G
Sbjct: 56  VAAGLLTG--DSATERRQHALIGAGIGALSGAAVGQYQDRQERALRERTANTGIDVQRQG 113

Query: 70  DMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLL 128
           D I   +P  ++F   +  L+ +F   L  +A  L  +  T+I +  HTDSIG+   N  
Sbjct: 114 DNIMLNLPDGITFDFGKSTLKPQFYGALNGVAGTLRDYNQTMIEVVGHTDSIGSDAVNNR 173

Query: 129 ISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           +S+ERAD +  YLI +    +  I   G    YPI  N T  GR  N+R+EI++ P
Sbjct: 174 LSKERADSVAQYLIGQ-GVQSVRIETLGAGKSYPIADNSTDAGRAKNRRVEIRVIP 228


>gi|110633615|ref|YP_673823.1| OmpA/MotB [Mesorhizobium sp. BNC1]
 gi|110284599|gb|ABG62658.1| OmpA/MotB [Chelativorans sp. BNC1]
          Length = 217

 Score =  139 bits (351), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 53/214 (24%), Positives = 96/214 (44%), Gaps = 31/214 (14%)

Query: 1   MIKELGLSMFIMTTISGCGLAS-----------------------------REKKKVFLH 31
           M+K +  +      ++GC                                    ++  L 
Sbjct: 1   MLKRVIAAAIAGALVTGCTTDPYTGQQKMSNAAGGAALGALAGAGLGLLAGGNDRRNALL 60

Query: 32  KSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEK 90
            +    +     G  +D+ E + + QLQ TG+ V+R GD I   +P +++F      ++ 
Sbjct: 61  GAGIGALAGGGIGLYMDQQEAQLRAQLQGTGVSVTRQGDYIILNMPSNITFATDSADIQP 120

Query: 91  KFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNR 150
            F   L  +A +L ++  T++ +  HTDS G+L++N+ +SQ RA  +  YLI +  + +R
Sbjct: 121 AFYQTLNSVALVLKRYNQTLVDVYGHTDSTGSLQHNMQLSQRRAASVADYLIAQ-GTDSR 179

Query: 151 FISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
             +V G     PI +N T  GR  N+R+EI++ P
Sbjct: 180 RFAVIGQGPSQPIASNATPEGRAQNRRVEIRLAP 213


>gi|253582681|ref|ZP_04859902.1| outer membrane protein [Fusobacterium varium ATCC 27725]
 gi|251835551|gb|EES64091.1| outer membrane protein [Fusobacterium varium ATCC 27725]
          Length = 216

 Score =  139 bits (351), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 56/212 (26%), Positives = 98/212 (46%), Gaps = 31/212 (14%)

Query: 3   KELGLSMFIMTTISGCGLAS-----------------------------REKKKVFLHKS 33
           K+   S  +   I+GC  +                               +  K  L  +
Sbjct: 4   KKAMSSFLLALMITGCTSSPFLDETGSVNSKTKGTAGGAAAGALIGQLIGKDTKGTLIGA 63

Query: 34  NDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKF 92
               +    +G+  D+ E E + +L++T + VS+ GD +   +P  V+F      +   F
Sbjct: 64  GVGALAGLGWGAYRDRQEQELRERLKNTEVQVSQKGDNLNLNLPGGVTFATDSSNIVPSF 123

Query: 93  LPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFI 152
              L  IAT+L ++P T I +  +TD++G+   N+ +S++RA  +++YLIQ+   S R I
Sbjct: 124 YGPLNSIATVLVQYPETRIIVNGYTDNVGSASYNITLSEKRAASVRNYLIQQ-GVSARRI 182

Query: 153 SVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           S  G+  + P  TN T  GR  N+R+E++I P
Sbjct: 183 SYVGYGMENPRATNSTAAGRAENRRVELEILP 214


>gi|254524462|ref|ZP_05136517.1| outer membrane protein [Stenotrophomonas sp. SKA14]
 gi|219722053|gb|EED40578.1| outer membrane protein [Stenotrophomonas sp. SKA14]
          Length = 231

 Score =  139 bits (351), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 52/176 (29%), Positives = 85/176 (48%), Gaps = 4/176 (2%)

Query: 10  FIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIG 69
                ++G   ++ E+++  L  +    +     G   D+ E   + +  +TGI V R G
Sbjct: 56  VAAGLLTG--DSATERRQHALIGAGIGALSGAAVGQYQDRQERALRERTANTGIDVQRQG 113

Query: 70  DMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLL 128
           D I   +P  ++F   +  L+ +F   L  +A  L  +  T+I +  HTDSIG+   N  
Sbjct: 114 DNIMLNLPDGITFDFGKATLKPQFYGSLNGVAGTLRDYNQTMIEVVGHTDSIGSDAVNNR 173

Query: 129 ISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           +S+ERAD +  YLI +    +  I   G    YPI  N T  GR  N+R+EI++ P
Sbjct: 174 LSKERADSVAQYLIGQ-GVQSVRIETLGAGKSYPIADNSTDAGRAKNRRVEIRVIP 228


>gi|254483376|ref|ZP_05096606.1| OmpA family protein [marine gamma proteobacterium HTCC2148]
 gi|214036360|gb|EEB77037.1| OmpA family protein [marine gamma proteobacterium HTCC2148]
          Length = 214

 Score =  139 bits (351), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 48/163 (29%), Positives = 81/163 (49%), Gaps = 2/163 (1%)

Query: 24  EKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV 83
           +  K   + +    IV    G+ +D  E + + +LQ TG+ V R GD I   +P +++F 
Sbjct: 51  DSGKHARNAALGCGIVGAGVGAYMDVQEAKLKEELQGTGVQVVREGDNIRLIMPGNITFE 110

Query: 84  -SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLI 142
                L   F  +L  +  +L+K+  T + +  HTD+ G+ + N  +S+ RA  +  YL 
Sbjct: 111 TDSYNLRSSFYSVLNSVGQVLSKYADTTLRVSGHTDNTGSRQYNQTLSERRAGSVADYLA 170

Query: 143 QRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPR 185
            R V   R + V+G  +  PI  N +  GR  N+R+E+ I P 
Sbjct: 171 TREVDRARML-VQGMGFDQPIADNGSAAGRAQNRRVELYILPN 212


>gi|197106951|ref|YP_002132328.1| OmpA family protein [Phenylobacterium zucineum HLK1]
 gi|196480371|gb|ACG79899.1| OmpA family protein [Phenylobacterium zucineum HLK1]
          Length = 221

 Score =  139 bits (350), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 55/219 (25%), Positives = 95/219 (43%), Gaps = 36/219 (16%)

Query: 1   MIKELGLSMFIMTTISGCGLA----------------------------------SREKK 26
           M  ++      +  +  C                                     S E +
Sbjct: 1   MKTKIAALGLSLLAVGACTTTDPYTGQTVRSNTRTGILAGAAGGALLGYLTNTNKSEEGR 60

Query: 27  KVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSE 85
              L  +    +     G+ +D+ + E + +L  +G+ V R GD I   +P  V+F V +
Sbjct: 61  TNALIGAGVGALAGGAVGAYMDRQQAELRRELAGSGVEVERRGDDIVLNMPSDVTFGVDQ 120

Query: 86  VFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRG 145
             ++ +F P+L  IA  L+++P T+I +  H DS G    N  +S+ RA  + SYL+ RG
Sbjct: 121 SDVQSRFYPVLDDIAATLSRYPQTLIDVAGHADSTGADAYNQALSERRASSVASYLVSRG 180

Query: 146 VSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           V  +R + V G+    P+ +N T+ GR  N+R+EI + P
Sbjct: 181 VLQDR-LYVVGYGESRPVASNATEQGRAQNRRVEITVRP 218


>gi|194365341|ref|YP_002027951.1| OmpA/MotB domain-containing protein [Stenotrophomonas maltophilia
           R551-3]
 gi|194348145|gb|ACF51268.1| OmpA/MotB domain protein [Stenotrophomonas maltophilia R551-3]
          Length = 231

 Score =  139 bits (350), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 51/176 (28%), Positives = 85/176 (48%), Gaps = 4/176 (2%)

Query: 10  FIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIG 69
                ++G   ++ E+++  L  +    +     G   D+ E   + +  +TGI V R G
Sbjct: 56  VAAGLLTG--DSATERRQHALIGAGIGALSGAAVGQYQDRQERALRERTANTGIDVQRQG 113

Query: 70  DMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLL 128
           D I   +P  ++F   +  L+ +F   L  +A  L  +  T+I +  HTDSIG+   N  
Sbjct: 114 DNIMLNLPDGITFDFGKATLKPQFYGSLNGVAGTLRDYNQTMIEVVGHTDSIGSDAVNNR 173

Query: 129 ISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           +S+ERAD +  YL+ +    +  I   G    YPI  N T  GR  N+R+EI++ P
Sbjct: 174 LSKERADSVAQYLVGQ-GVQSVRIETLGAGKSYPIADNSTDAGRAKNRRVEIRVIP 228


>gi|315127968|ref|YP_004069971.1| lipoprotein [Pseudoalteromonas sp. SM9913]
 gi|315016482|gb|ADT69820.1| lipoprotein [Pseudoalteromonas sp. SM9913]
          Length = 210

 Score =  139 bits (350), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 57/204 (27%), Positives = 97/204 (47%), Gaps = 22/204 (10%)

Query: 3   KELGLSMFIMTTISGCGL--------------------ASREKKKVFLHKSNDTDIVNKR 42
           K L     +   +SGC +                        K K     +    +    
Sbjct: 5   KSLLSVTVVAVLLSGCEMNNTGKGAAIGAAAGGILGKATGNHKDKRIFIGAAIGALAGAA 64

Query: 43  FGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIAT 101
            G  +DK E  F+ +L  +G+ V R GD +   +P +++F   + ++   F   L  IA+
Sbjct: 65  VGDYMDKQEAAFRDELAGSGVEVVREGDNLRLVMPSNITFATDQSYISSGFHDTLNAIAS 124

Query: 102 ILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKY 161
           ++NK+  T ++++ HTDS G    N+ +S++RA  +K+YL+ + + + R +S  G+    
Sbjct: 125 VMNKYEKTYLSVEGHTDSTGKDSYNMTLSEQRAQSVKNYLVNQQIMAAR-VSTSGYGESR 183

Query: 162 PIDTNDTKVGRQNNQRIEIQIFPR 185
           PI TNDT  GR  N+R+EIQI P 
Sbjct: 184 PIATNDTANGRAQNRRVEIQIVPN 207


>gi|197364467|ref|YP_002144104.1| outer membrane lipoprotein [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|197095944|emb|CAR61525.1| putative outer membrane protein [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. AKU_12601]
          Length = 205

 Score =  139 bits (349), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 52/180 (28%), Positives = 92/180 (51%), Gaps = 6/180 (3%)

Query: 6   GLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVV 65
           G+   +   I     + +++ K  L  +     +    G  +D  E + + +++ TG+ V
Sbjct: 29  GIGSLVGAGIGALSSSKKDRGKGALIGAA----LGGGVGYYMDVQEAKLRDKMRGTGVSV 84

Query: 66  SRIGDMITCYIPVHVSFVSEV-FLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLK 124
           +R GD I   +P +V+F S    L+      L  +A +L ++P T + +  +TDS G+  
Sbjct: 85  TRSGDNIILNMPNNVTFDSSSATLKPAGANTLTGVAMVLKEYPKTAVNVVGYTDSTGSHD 144

Query: 125 NNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
            N+ +SQ+RAD + S LI +GV ++R I   G     PI +N T  G+  N+R+EI + P
Sbjct: 145 LNMRLSQQRADSVASSLITQGVDASR-IRTSGMGPANPIASNSTAEGKAQNRRVEITLSP 203


>gi|58581150|ref|YP_200166.1| OmpA family protein [Xanthomonas oryzae pv. oryzae KACC10331]
 gi|84623073|ref|YP_450445.1| OmpA family protein [Xanthomonas oryzae pv. oryzae MAFF 311018]
 gi|58425744|gb|AAW74781.1| OmpA family protein [Xanthomonas oryzae pv. oryzae KACC10331]
 gi|84367013|dbj|BAE68171.1| OmpA family protein [Xanthomonas oryzae pv. oryzae MAFF 311018]
          Length = 241

 Score =  139 bits (349), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 49/176 (27%), Positives = 89/176 (50%), Gaps = 4/176 (2%)

Query: 10  FIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIG 69
                ++G   ++ E+++  +  +    +     G   D+ E   + +  +TGI V R G
Sbjct: 56  VAAGLLTG--DSATERRQHAMIGAGIGALSGAAIGQYQDRQERALRERTANTGIEVQRQG 113

Query: 70  DMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLL 128
           D I+  +P  ++F   +  L+ +F   L  +A+ L ++  T++ +  HTDS+G+   N  
Sbjct: 114 DNISLNLPDGITFDFGKSALKPEFYTALNGVASTLREYNQTMVEVVGHTDSVGSDAANQR 173

Query: 129 ISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           +S+ERA  +  YL  +GV   R     G   +YPI  N+T  GR  N+R+EI++ P
Sbjct: 174 LSEERAGAVAQYLTAQGVQRERM-ETMGAGKRYPIADNNTDAGRAKNRRVEIRLIP 228


>gi|325923199|ref|ZP_08184883.1| outer membrane protein/peptidoglycan-associated (lipo)protein
           [Xanthomonas gardneri ATCC 19865]
 gi|325546323|gb|EGD17493.1| outer membrane protein/peptidoglycan-associated (lipo)protein
           [Xanthomonas gardneri ATCC 19865]
          Length = 249

 Score =  139 bits (349), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 50/176 (28%), Positives = 89/176 (50%), Gaps = 4/176 (2%)

Query: 10  FIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIG 69
                ++G   ++ E+++  +  +    +     G   D+ E   + +  +TGI V R G
Sbjct: 64  VAAGLLTG--DSATERRQHAMVGAGIGALSGAAVGQYQDRQERALRERTANTGIEVQRQG 121

Query: 70  DMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLL 128
           D IT  +P  ++F   +  L+ +F   L  +A+ L ++  T++ +  HTDS+G+   N  
Sbjct: 122 DNITLNLPDGITFDFGKSALKPQFYSALNGVASTLREYNQTMVEVVGHTDSVGSDAVNQR 181

Query: 129 ISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           +S+ERA  +  YL  +GV   R     G   +YPI  N+T  GR  N+R+EI++ P
Sbjct: 182 LSEERAGAVAQYLTAQGVQRERM-ETMGAGKRYPIADNNTDAGRAQNRRVEIRLIP 236


>gi|84685261|ref|ZP_01013160.1| OmpA family protein [Maritimibacter alkaliphilus HTCC2654]
 gi|84666993|gb|EAQ13464.1| OmpA family protein [Rhodobacterales bacterium HTCC2654]
          Length = 225

 Score =  139 bits (349), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 45/205 (21%), Positives = 79/205 (38%), Gaps = 24/205 (11%)

Query: 5   LGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRF--------------------- 43
             L +  +  ++GC    + +       +    +V                         
Sbjct: 22  FVLPLVSVLALTGCSTVGQREGAGIATGAAVGGLVGAAIPGNRAATAAAGAIGGAIVGGL 81

Query: 44  -GSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV-SEVFLEKKFLPMLQLIAT 101
            G+ LDK   + +  L ++ I V   G  +   +P  + F      +     P L+ +A 
Sbjct: 82  VGNQLDKQAGDLRSSLSNSSIQVINTGSYLKVVMPQGILFPTDSADVSPALYPDLRALAE 141

Query: 102 ILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKY 161
            L ++P++ + +  HTD+ G    NL +SQ RA  +   +IQ        +   G     
Sbjct: 142 NLREYPNSSVQVVGHTDNTGQASYNLTLSQRRAQAVL-GVIQSNGVGAARLQAVGKGDSE 200

Query: 162 PIDTNDTKVGRQNNQRIEIQIFPRG 186
           P+ TN T  GR  N+R+E+ I PRG
Sbjct: 201 PVATNLTPEGRAQNRRVEVLIIPRG 225


>gi|21230892|ref|NP_636809.1| outer membrane protein [Xanthomonas campestris pv. campestris str.
           ATCC 33913]
 gi|66769109|ref|YP_243871.1| outer membrane protein [Xanthomonas campestris pv. campestris str.
           8004]
 gi|188992257|ref|YP_001904267.1| OmpA family outer membrane lipoprotein [Xanthomonas campestris pv.
           campestris str. B100]
 gi|21112502|gb|AAM40733.1| outer membrane protein [Xanthomonas campestris pv. campestris str.
           ATCC 33913]
 gi|66574441|gb|AAY49851.1| outer membrane protein [Xanthomonas campestris pv. campestris str.
           8004]
 gi|167734017|emb|CAP52223.1| OmpA family outer membrane lipoprotein [Xanthomonas campestris pv.
           campestris]
          Length = 241

 Score =  138 bits (348), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 50/176 (28%), Positives = 89/176 (50%), Gaps = 4/176 (2%)

Query: 10  FIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIG 69
                ++G   ++ E+++  +  +    +     G   D+ E   + +  +TGI V R G
Sbjct: 56  VAAGLLTG--DSATERRQHAMIGAGIGALSGAAVGQYQDRQERALRERTANTGIDVQRQG 113

Query: 70  DMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLL 128
           D IT  +P  ++F   +  L+ +F   L  +A+ L ++  T++ +  HTDS+G+   N  
Sbjct: 114 DNITLNLPDGITFDFGKSALKPQFYTALNGVASTLREYNQTMVEVVGHTDSVGSDAVNQR 173

Query: 129 ISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           +S+ERA+ +  YL  +GV   R     G   +YPI  N T  GR  N+R+EI++ P
Sbjct: 174 LSEERANAVAQYLTAQGVQRERM-ETMGAGKRYPIADNSTDAGRAQNRRVEIRLIP 228


>gi|213963523|ref|ZP_03391776.1| inner membrane lipoprotein YiaD [Capnocytophaga sputigena Capno]
 gi|213953803|gb|EEB65132.1| inner membrane lipoprotein YiaD [Capnocytophaga sputigena Capno]
          Length = 229

 Score =  138 bits (348), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 48/223 (21%), Positives = 89/223 (39%), Gaps = 37/223 (16%)

Query: 1   MIKELGLSMFIMTTISGCGLASREKKK------------------------------VFL 30
           M K + L++     ++GC   +   K                                 +
Sbjct: 1   MKKFVVLALSAAVLLTGCEAYNNTNKAQRGAVVGAAGGALLGAILGNNVGNGQNSELGAV 60

Query: 31  HKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVH----VSFVSEV 86
             +          G  +DK   + + ++   G  V R+ D I      +        ++ 
Sbjct: 61  LGTVVGGAAGAVIGHQMDKQAKKIEEEIP--GADVKRVDDGIVVTFDENNGGVYFDTNKY 118

Query: 87  FLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGV 146
            + +K    L  +A IL ++P T + +  HTDS+G  + NL +SQ RA  + +Y   +G+
Sbjct: 119 NINEKSKQTLDKLAAILKEYPDTNVLVAGHTDSVGKDEYNLGLSQRRAQAVTNYFKSKGL 178

Query: 147 SSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGNIK 189
           + +R  + + +  K PI +NDT  GR  N+R+ + I P   +K
Sbjct: 179 AGSR-FTTKWYGEKNPIASNDTAEGRAKNRRVNVVIVPNEKMK 220


>gi|319787272|ref|YP_004146747.1| OmpA/MotB domain protein [Pseudoxanthomonas suwonensis 11-1]
 gi|317465784|gb|ADV27516.1| OmpA/MotB domain protein [Pseudoxanthomonas suwonensis 11-1]
          Length = 226

 Score =  138 bits (348), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 54/176 (30%), Positives = 103/176 (58%), Gaps = 4/176 (2%)

Query: 10  FIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIG 69
                ++G   ++ E+++  L  +    +     G+  D+ ++  + +LQ TG+ V+R G
Sbjct: 51  VAAGLLTG--NSAVERRQHALIGAGIGGLAGGSVGAYQDRQQNALRAKLQGTGVSVTRNG 108

Query: 70  DMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLL 128
           D IT  +P +V+F  +   L+ +F P+L  +A +L ++  TV+ +  HTDS+G  + N  
Sbjct: 109 DNITLNMPGNVTFGFNSANLDPQFYPVLSSVAEVLREYDKTVVEVAGHTDSVGGDEVNQR 168

Query: 129 ISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           +S++RA+ +  +L+ + ++  RFI+V G   +YPI +NDT+ GR  N+R+EI + P
Sbjct: 169 LSEQRANAVTQFLVSQNINPQRFITV-GAGKRYPIASNDTEAGRAANRRVEITLVP 223


>gi|13470497|ref|NP_102066.1| hypothetical protein mlr0220 [Mesorhizobium loti MAFF303099]
 gi|14021239|dbj|BAB47852.1| mlr0220 [Mesorhizobium loti MAFF303099]
          Length = 216

 Score =  138 bits (348), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 54/215 (25%), Positives = 94/215 (43%), Gaps = 32/215 (14%)

Query: 1   MIKELGLSMFIMTTISGCGLAS------------------------------REKKKVFL 30
           M K + +++     +S C                                     ++  L
Sbjct: 1   MKKTVLVAVATALLVSACTTTDPYTGDQKISNTAAGAGLGALAGASLGLLAGGNDRRNAL 60

Query: 31  HKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV-SEVFLE 89
             +    +     G+++D+ E E + QL+ TG+ V+R GD I   +P  ++F   +  ++
Sbjct: 61  IGAGIGALAGGAIGATMDQNEAELRRQLEGTGVSVTRSGDQIILNMPSDITFNVDQDAVK 120

Query: 90  KKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSN 149
             F P+L  +A +L KF  T + +  HTDS G  ++N  +SQ RA  + +  +       
Sbjct: 121 PGFYPVLNSVALVLKKFKQTTVDVFGHTDSTGGDQHNFDLSQRRALAVAN-YLSGQGVDQ 179

Query: 150 RFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           R  +V GF    PI +N T  GR+ N+R+EIQ+ P
Sbjct: 180 RRFAVTGFGKTRPIASNATAAGREQNRRVEIQLSP 214


>gi|188575664|ref|YP_001912593.1| OmpA family protein [Xanthomonas oryzae pv. oryzae PXO99A]
 gi|188520116|gb|ACD58061.1| OmpA family protein [Xanthomonas oryzae pv. oryzae PXO99A]
          Length = 241

 Score =  138 bits (348), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 49/176 (27%), Positives = 89/176 (50%), Gaps = 4/176 (2%)

Query: 10  FIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIG 69
                ++G   ++ E+++  +  +    +     G   D+ E   + +  +TGI V R G
Sbjct: 56  VAAGLLTG--DSATERRQHAMIGAGIGALSGAAIGQYQDRQERALRERTANTGIEVQRQG 113

Query: 70  DMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLL 128
           D I+  +P  ++F   +  L+ +F   L  +A+ L ++  T++ +  HTDS+G+   N  
Sbjct: 114 DNISLNLPDGITFDFGKSALKPEFYTALNGVASTLREYNQTMVEVVGHTDSVGSDAANQR 173

Query: 129 ISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           +S+ERA  +  YL  +GV   R     G   +YPI  N+T  GR  N+R+EI++ P
Sbjct: 174 LSEERAGAVAQYLTAQGVQRERM-ETMGAGKRYPIADNNTDAGRAKNRRVEIRLIP 228


>gi|163740474|ref|ZP_02147868.1| OmpA domain protein [Phaeobacter gallaeciensis 2.10]
 gi|161386332|gb|EDQ10707.1| OmpA domain protein [Phaeobacter gallaeciensis 2.10]
          Length = 216

 Score =  138 bits (348), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 41/182 (22%), Positives = 79/182 (43%), Gaps = 2/182 (1%)

Query: 6   GLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVV 65
            L   ++    G      ++    +  +          G+ LD  E E +  + + GI +
Sbjct: 35  ALIGGLIGAGVGAAANDSDRGLGAVTGALVGAAAGSVIGNQLDAQERELRQSISNDGISI 94

Query: 66  SRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLK 124
              GD +   +P  ++F      +       L  +A+ L ++P++ + +  HTDS G   
Sbjct: 95  VNTGDRLIVSLPNDLTFATDSAAVSPAVRSDLNKVASSLVRYPNSQVQVIGHTDSDGDAG 154

Query: 125 NNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
            N  +S+ RA+ +   +   GV  NR + + G     P+ +N T  G+  N+R+EI + P
Sbjct: 155 YNQGLSERRANAVADQIQAGGVPYNR-VQIIGRGESQPVASNLTAEGKARNRRVEIVVIP 213

Query: 185 RG 186
           +G
Sbjct: 214 QG 215


>gi|294787848|ref|ZP_06753092.1| OmpA family protein [Simonsiella muelleri ATCC 29453]
 gi|294484141|gb|EFG31824.1| OmpA family protein [Simonsiella muelleri ATCC 29453]
          Length = 217

 Score =  138 bits (348), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 62/216 (28%), Positives = 92/216 (42%), Gaps = 30/216 (13%)

Query: 1   MIKELGLSM-FIMTTISGC---GLASREKK------------------------KVFLHK 32
           M+K++ L+       +SGC        ++                         K   + 
Sbjct: 3   MMKQITLATTLAALGLSGCVTNATTGEKQASKTAVYGMGAAVTCGIIGAITHGSKGARNS 62

Query: 33  SNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKK 91
           +     +    G  +D  E + + QL DTG+ V R G+ I   +P +V+F      L   
Sbjct: 63  AAACGALGMGVGGYMDYQEKKLREQLADTGVEVQREGNQIKLTMPENVTFATGRYDLSVN 122

Query: 92  FLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRF 151
               L   A  L  +  T I+I  HTDS G    N+ +SQ RA+ +  YLI +GVSS+R 
Sbjct: 123 AQNSLNGAAQTLATYNETTISIIGHTDSTGNDSINIPLSQNRANAVAQYLISKGVSSSR- 181

Query: 152 ISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGN 187
           IS  G     PI +N T  GR  N+R+EI I P+  
Sbjct: 182 ISTAGHGASQPIASNSTAEGRAQNRRVEILINPQAK 217


>gi|289670151|ref|ZP_06491226.1| OmpA family outer membrane lipoprotein [Xanthomonas campestris pv.
           musacearum NCPPB4381]
          Length = 241

 Score =  138 bits (347), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 49/176 (27%), Positives = 89/176 (50%), Gaps = 4/176 (2%)

Query: 10  FIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIG 69
                ++G   ++ E+++  +  +    +     G   D+ E   + +  +TGI V R G
Sbjct: 56  VAAGLLTG--DSATERRQHAMVGAGIGALSGAAIGQYQDRQERALRERTANTGIEVQRQG 113

Query: 70  DMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLL 128
           D I+  +P  ++F   +  L+ +F   L  +A+ L ++  T++ +  HTDS+G+   N  
Sbjct: 114 DNISLNLPDGITFDFGKSALKPEFYTALNGVASTLREYNQTMVEVVGHTDSVGSDAVNQR 173

Query: 129 ISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           +S+ERA  +  YL  +GV   R     G   +YPI  N+T  GR  N+R+EI++ P
Sbjct: 174 LSEERAGAVAQYLTAQGVQRERM-ETMGAGKRYPIADNNTDAGRAKNRRVEIRLIP 228


>gi|260460699|ref|ZP_05808949.1| OmpA/MotB domain protein [Mesorhizobium opportunistum WSM2075]
 gi|259033276|gb|EEW34537.1| OmpA/MotB domain protein [Mesorhizobium opportunistum WSM2075]
          Length = 216

 Score =  138 bits (347), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 54/215 (25%), Positives = 93/215 (43%), Gaps = 32/215 (14%)

Query: 1   MIKELGLSMFIMTTISGCGLAS------------------------------REKKKVFL 30
           M K + + +     +S C                                     ++  L
Sbjct: 1   MKKTVLVVVATALLVSACTTTDPYTGDQKISNTAAGAGLGALAGASLGLLAGGNDRRNAL 60

Query: 31  HKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV-SEVFLE 89
             +    +     G+++D+ E E + QL+ TG+ V+R GD I   +P  ++F   +  ++
Sbjct: 61  IGAGIGALAGGAIGATMDQNEAELRRQLEGTGVSVTRSGDQIILNMPSDITFNSDQDAVK 120

Query: 90  KKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSN 149
             F  +L  +A +L KF  T + +  HTDS G  ++N  +SQ RA  + +YL  +     
Sbjct: 121 PGFYQVLNSVALVLKKFKQTTVDVFGHTDSTGGDQHNFDLSQRRALAVANYLAGQ-GVDQ 179

Query: 150 RFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           R  +V GF    P+ +N T  GR  N+R+EIQ+ P
Sbjct: 180 RRFAVTGFGKTRPVASNATSEGRAQNRRVEIQLSP 214


>gi|56415540|ref|YP_152615.1| outer membrane lipoprotein [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|56129797|gb|AAV79303.1| putative outer membrane protein [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. ATCC 9150]
          Length = 216

 Score =  138 bits (347), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 52/180 (28%), Positives = 92/180 (51%), Gaps = 6/180 (3%)

Query: 6   GLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVV 65
           G+   +   I     + +++ K  L  +     +    G  +D  E + + +++ TG+ V
Sbjct: 40  GIGSLVGAGIGALSSSKKDRGKGALIGAA----LGGGVGYYMDVQEAKLRDKMRGTGVSV 95

Query: 66  SRIGDMITCYIPVHVSFVSEV-FLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLK 124
           +R GD I   +P +V+F S    L+      L  +A +L ++P T + +  +TDS G+  
Sbjct: 96  TRSGDNIILNMPNNVTFDSSSATLKPAGANTLTGVAMVLKEYPKTAVNVVGYTDSTGSHD 155

Query: 125 NNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
            N+ +SQ+RAD + S LI +GV ++R I   G     PI +N T  G+  N+R+EI + P
Sbjct: 156 LNMRLSQQRADSVASSLITQGVDASR-IRTSGMGPANPIASNSTAEGKAQNRRVEITLSP 214


>gi|257470656|ref|ZP_05634746.1| Outer membrane protein [Fusobacterium ulcerans ATCC 49185]
          Length = 217

 Score =  138 bits (347), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 57/215 (26%), Positives = 99/215 (46%), Gaps = 31/215 (14%)

Query: 3   KELGLSMFIMTTISGCGLAS-----------------------------REKKKVFLHKS 33
           K+   S+ +   I+GC  +                               +  K  L  +
Sbjct: 4   KKAMSSLLLALIITGCTSSPFLDETGSVSGKTKGTAGGAAAGALIGQLIGKDTKGTLIGA 63

Query: 34  NDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKF 92
               +    +G+  D+ E E + +L++T + VS+ GD +   +P  V+F      +   F
Sbjct: 64  GVGALAGLGWGAYRDRQEQELRERLKNTEVQVSQNGDNLNLNLPGGVTFATDSSNIVSSF 123

Query: 93  LPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFI 152
              L  IAT+L ++P T I +  +TD++G+   N+ +S+ RA  +++YLIQ+   S R I
Sbjct: 124 YGPLNSIATVLVQYPETRIIVNGYTDNVGSASYNVSLSERRAASVRNYLIQQ-GVSARRI 182

Query: 153 SVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGN 187
           S  G+  + P  TN T  GR  N+R+E++I P  N
Sbjct: 183 SYVGYGMENPRATNSTAAGRAENRRVELEILPMSN 217


>gi|166712665|ref|ZP_02243872.1| OmpA family protein [Xanthomonas oryzae pv. oryzicola BLS256]
          Length = 241

 Score =  138 bits (347), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 49/176 (27%), Positives = 89/176 (50%), Gaps = 4/176 (2%)

Query: 10  FIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIG 69
                ++G   ++ E+++  +  +    +     G   D+ E   + +  +TGI V R G
Sbjct: 56  VAAGLLTG--DSATERRQHAMVGAGIGALSGAAIGQYQDRQERALRERTANTGIEVQRQG 113

Query: 70  DMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLL 128
           D I+  +P  ++F   +  L+ +F   L  +A+ L ++  T++ +  HTDS+G+   N  
Sbjct: 114 DNISLNLPDGITFDFGKSALKPEFYTALNGVASTLREYNQTMVEVVGHTDSVGSDAANQR 173

Query: 129 ISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           +S+ERA  +  YL  +GV   R     G   +YPI  N+T  GR  N+R+EI++ P
Sbjct: 174 LSEERAGAVAQYLTAQGVQRERM-ETMGAGKRYPIADNNTDAGRAKNRRVEIRLIP 228


>gi|222086409|ref|YP_002544943.1| outer membrane lipoprotein [Agrobacterium radiobacter K84]
 gi|221723857|gb|ACM27013.1| outer membrane lipoprotein [Agrobacterium radiobacter K84]
          Length = 222

 Score =  138 bits (347), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 55/218 (25%), Positives = 94/218 (43%), Gaps = 35/218 (16%)

Query: 1   MIKELGLSMFIMTTISGCGLAS---------------------------------REKKK 27
           MIK++ +       ++ C                                       ++ 
Sbjct: 1   MIKKIAILAISAAFLNACTTTDPYTGEQKVSNTAGGAALGAGVGAVAGLLIGHSPASRRN 60

Query: 28  VFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV-SEV 86
             L  +    +     G+ +D+ E E + QLQ TG+ V+R+GD I   +P  ++F     
Sbjct: 61  AALIGAGVGALAGAGIGNYMDQQESELRAQLQGTGVSVTRVGDRIILNMPSAITFDIDRD 120

Query: 87  FLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGV 146
            ++ +F   L  +A +L KF  T+I +  HTDS G+L++N  +S+ RA  + S  +    
Sbjct: 121 EIKPEFFATLNSVAIVLRKFNRTLIDVNGHTDSTGSLQHNQDLSERRAGSVAS-YLGSQG 179

Query: 147 SSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
              R +S  GF    P+ +N  + GR  N+R+EIQI P
Sbjct: 180 IDQRRVSAVGFGPTQPVASNANESGRAQNRRVEIQIAP 217


>gi|317059511|ref|ZP_07923996.1| outer membrane protein [Fusobacterium sp. 3_1_5R]
 gi|313685187|gb|EFS22022.1| outer membrane protein [Fusobacterium sp. 3_1_5R]
          Length = 204

 Score =  138 bits (347), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 58/166 (34%), Positives = 93/166 (56%), Gaps = 2/166 (1%)

Query: 23  REKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF 82
            +  K  L  +    +    +G+  D+ E   +  L++T + V R G+ I+ Y+P  V+F
Sbjct: 40  GKDTKGTLIGAGMGALAGLGWGAYRDQQEAALRASLKNTAVQVQRDGENISLYLPGGVTF 99

Query: 83  -VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYL 141
                 +   F   L  IA +L ++P T I +Q HTDS G+ ++N+ +S  RA+ +K YL
Sbjct: 100 ASDSAQISGNFYSALNSIAQVLVQYPETQILVQGHTDSTGSFQHNMDLSNRRANSVKHYL 159

Query: 142 IQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGN 187
           I +GV+SNR +S +GF    P+  N T  GRQ N+R+EI+I P+ N
Sbjct: 160 IGQGVASNRLMS-QGFGPNNPVADNSTPDGRQMNRRVEIKIAPKYN 204


>gi|163737113|ref|ZP_02144531.1| OmpA/MotB [Phaeobacter gallaeciensis BS107]
 gi|161389717|gb|EDQ14068.1| OmpA/MotB [Phaeobacter gallaeciensis BS107]
          Length = 219

 Score =  137 bits (346), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 41/182 (22%), Positives = 79/182 (43%), Gaps = 2/182 (1%)

Query: 6   GLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVV 65
            L   ++    G      ++    +  +          G+ LD  E E +  + + GI +
Sbjct: 38  ALIGGLIGAGVGAAANDSDRGLGAVTGALVGAAAGSVIGNQLDAQERELRQSISNDGISI 97

Query: 66  SRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLK 124
              GD +   +P  ++F      +       L  +A+ L ++P++ + +  HTDS G   
Sbjct: 98  VNTGDRLIVSLPNDLTFATDSAAVSPAVRSDLNKVASSLVRYPNSQVQVIGHTDSDGDAG 157

Query: 125 NNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
            N  +S+ RA+ +   +   GV  NR + + G     P+ +N T  G+  N+R+EI + P
Sbjct: 158 YNQGLSERRANAVADQIQAGGVPYNR-VQIIGRGESQPVASNLTAEGKARNRRVEIVVIP 216

Query: 185 RG 186
           +G
Sbjct: 217 QG 218


>gi|257452971|ref|ZP_05618270.1| Outer membrane protein [Fusobacterium sp. 3_1_5R]
          Length = 217

 Score =  137 bits (346), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 58/166 (34%), Positives = 93/166 (56%), Gaps = 2/166 (1%)

Query: 23  REKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF 82
            +  K  L  +    +    +G+  D+ E   +  L++T + V R G+ I+ Y+P  V+F
Sbjct: 53  GKDTKGTLIGAGMGALAGLGWGAYRDQQEAALRASLKNTAVQVQRDGENISLYLPGGVTF 112

Query: 83  -VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYL 141
                 +   F   L  IA +L ++P T I +Q HTDS G+ ++N+ +S  RA+ +K YL
Sbjct: 113 ASDSAQISGNFYSALNSIAQVLVQYPETQILVQGHTDSTGSFQHNMDLSNRRANSVKHYL 172

Query: 142 IQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGN 187
           I +GV+SNR +S +GF    P+  N T  GRQ N+R+EI+I P+ N
Sbjct: 173 IGQGVASNRLMS-QGFGPNNPVADNSTPDGRQMNRRVEIKIAPKYN 217


>gi|21242231|ref|NP_641813.1| OmpA family protein [Xanthomonas axonopodis pv. citri str. 306]
 gi|21107654|gb|AAM36349.1| OmpA family protein [Xanthomonas axonopodis pv. citri str. 306]
          Length = 241

 Score =  137 bits (346), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 50/176 (28%), Positives = 88/176 (50%), Gaps = 4/176 (2%)

Query: 10  FIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIG 69
                ++G   ++ E+++  +  +    +     G   D+ E   + +  +TGI V R G
Sbjct: 56  VAAGLLTG--DSATERRQHAMVGAGIGALSGAAIGQYQDRQERALRERTANTGIEVQRQG 113

Query: 70  DMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLL 128
           D IT  +P  ++F   +  L+ +F   L  +A+ L ++  T++ +  HTDS+G+   N  
Sbjct: 114 DNITLNLPDGITFDFGKSALKPQFYSALNGVASTLREYNQTMVEVVGHTDSVGSDAVNQR 173

Query: 129 ISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           +S+ERA  +  YL  +GV   R     G   +YPI  N T  GR  N+R+EI++ P
Sbjct: 174 LSEERAGAVAQYLTAQGVQRERM-ETMGAGKRYPIADNSTDAGRAQNRRVEIRLIP 228


>gi|317060136|ref|ZP_07924621.1| outer membrane protein [Fusobacterium sp. D12]
 gi|313685812|gb|EFS22647.1| outer membrane protein [Fusobacterium sp. D12]
          Length = 193

 Score =  137 bits (346), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 52/166 (31%), Positives = 89/166 (53%), Gaps = 2/166 (1%)

Query: 23  REKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF 82
            +  K  L  +    +    +G+  D+ E   +  L++T + V R G+ I+ Y+P  V+F
Sbjct: 29  GKDTKGTLIGAGVGALAGLGWGAYRDQQEAALRASLKNTAVQVQRDGENISLYLPGGVTF 88

Query: 83  -VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYL 141
                 +   F   L  IA +L ++P T I +Q HTDS G+ ++N+ +S  RA+ +K YL
Sbjct: 89  ASDSAQISGNFYSALNSIAQVLVQYPETQILVQGHTDSTGSFQHNMDLSNRRANSVKQYL 148

Query: 142 IQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGN 187
           I +   ++  ++ +GF    P+  N T  GRQ N+R+EI+I P+ N
Sbjct: 149 IGQ-GVASNRLTSQGFGPNNPVADNSTPEGRQMNRRVEIKIAPKYN 193


>gi|78047093|ref|YP_363268.1| OmpA family outer membrane lipoprotein [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|294626580|ref|ZP_06705178.1| OmpA family outer membrane lipoprotein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|294665669|ref|ZP_06730945.1| OmpA family outer membrane lipoprotein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
 gi|78035523|emb|CAJ23169.1| OmpA family outer membrane lipoprotein [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|292599147|gb|EFF43286.1| OmpA family outer membrane lipoprotein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|292604564|gb|EFF47939.1| OmpA family outer membrane lipoprotein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
          Length = 241

 Score =  137 bits (346), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 49/176 (27%), Positives = 88/176 (50%), Gaps = 4/176 (2%)

Query: 10  FIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIG 69
                ++G   ++ E+++  +  +    +     G   D+ E   + +  +TGI V R G
Sbjct: 56  VAAGLLTG--DSATERRQHAMVGAGIGALSGAAIGQYQDRQERALRERTANTGIEVQRQG 113

Query: 70  DMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLL 128
           D I+  +P  ++F   +  L+ +F   L  +A+ L ++  T++ +  HTDS+G+   N  
Sbjct: 114 DNISLNLPDGITFDFGKSALKPQFYTALNGVASTLREYNQTMVEVVGHTDSVGSDAVNQR 173

Query: 129 ISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           +S+ERA  +  YL  +GV   R     G   +YPI  N T  GR  N+R+EI++ P
Sbjct: 174 LSEERASAVAQYLTAQGVQRERM-ETMGAGKRYPIADNTTDAGRAKNRRVEIRLIP 228


>gi|325914015|ref|ZP_08176371.1| outer membrane protein/peptidoglycan-associated (lipo)protein
           [Xanthomonas vesicatoria ATCC 35937]
 gi|325539784|gb|EGD11424.1| outer membrane protein/peptidoglycan-associated (lipo)protein
           [Xanthomonas vesicatoria ATCC 35937]
          Length = 241

 Score =  137 bits (345), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 50/176 (28%), Positives = 88/176 (50%), Gaps = 4/176 (2%)

Query: 10  FIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIG 69
                ++G   ++ E+++  +  +    +     G   D+ E   + +  +TGI V R G
Sbjct: 56  VAAGLLTG--DSATERRQHAMVGAGIGALSGAAVGQYQDRQERALRERTANTGIDVQRQG 113

Query: 70  DMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLL 128
           D IT  +P  ++F   +  L+ +F   L  +A+ L ++  T++ +  HTDS+G+   N  
Sbjct: 114 DNITLNLPDGITFDFGKSALKPQFYSALNGVASTLREYNQTMVEVVGHTDSVGSDAVNQR 173

Query: 129 ISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           +S+ERA  +  YL  +GV   R     G   +YPI  N T  GR  N+R+EI++ P
Sbjct: 174 LSEERAGAVAQYLTAQGVQRERM-ETMGAGKRYPIADNSTDAGRAQNRRVEIRLIP 228


>gi|315917803|ref|ZP_07914043.1| outer membrane protein [Fusobacterium gonidiaformans ATCC 25563]
 gi|313691678|gb|EFS28513.1| outer membrane protein [Fusobacterium gonidiaformans ATCC 25563]
          Length = 204

 Score =  137 bits (345), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 57/166 (34%), Positives = 93/166 (56%), Gaps = 2/166 (1%)

Query: 23  REKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF 82
            +  K  L  +    +    +G+  D+ E   +  L++T + V R G+ I+ Y+P  V+F
Sbjct: 40  GKDTKGTLIGAGVGALAGLGWGAYRDQQEAALRASLKNTAVQVQRDGENISLYLPGGVTF 99

Query: 83  -VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYL 141
                 +   F   L  IA +L ++P T I +Q HTD+ G+ ++N+ +S  RA+ +K YL
Sbjct: 100 ASDSAQISGNFYSALNSIAQVLVQYPETQILVQGHTDNTGSFQHNMDLSNRRANSVKQYL 159

Query: 142 IQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGN 187
           I +GV+SNR +S +GF    P+  N T  GRQ N+R+EI+I P+ N
Sbjct: 160 IGQGVASNRLMS-QGFGPNNPVADNSTPDGRQMNRRVEIKIAPKYN 204


>gi|289662994|ref|ZP_06484575.1| OmpA family outer membrane lipoprotein [Xanthomonas campestris pv.
           vasculorum NCPPB702]
          Length = 241

 Score =  137 bits (345), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 49/176 (27%), Positives = 90/176 (51%), Gaps = 4/176 (2%)

Query: 10  FIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIG 69
                ++G   ++ E+++  +  +    +     G   D+ E   + +  +TGI V R G
Sbjct: 56  VAAGLLTG--DSATERRQHAMVGAGIGALSGAAIGQYQDRQERALRERTANTGIEVQRQG 113

Query: 70  DMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLL 128
           D I+  +P  ++F   +  L+ +F   L  +A+ L ++  T++ +  HTDS+G+   N  
Sbjct: 114 DNISLNLPDGITFDFGKSALKPEFYTALNGVASTLREYNQTMVEVVGHTDSVGSDAVNQR 173

Query: 129 ISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           +S+ERA  +  YL  +GV   R  +  G   +YPI  N+T  GR  N+R+EI++ P
Sbjct: 174 LSEERAGAVAQYLTAQGVQRERMDT-MGAGKRYPIADNNTDAGRAKNRRVEIRLIP 228


>gi|296329053|ref|ZP_06871559.1| proteobacterial sortase system OmpA family protein [Fusobacterium
           nucleatum subsp. nucleatum ATCC 23726]
 gi|296153857|gb|EFG94669.1| proteobacterial sortase system OmpA family protein [Fusobacterium
           nucleatum subsp. nucleatum ATCC 23726]
          Length = 208

 Score =  137 bits (345), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 53/204 (25%), Positives = 86/204 (42%), Gaps = 23/204 (11%)

Query: 3   KELGLSMFIMTTISGCG---------------------LASREKKKVFLHKSNDTDIVNK 41
           K++  S  +  ++  C                          +  K  L  +    ++  
Sbjct: 4   KKIIASCMLALSLVSCTGLEAGNGAYTAGGAALGAVAGQVIGKDTKGTLIGAAVGSLLGM 63

Query: 42  RFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIA 100
            +G+  D  E E + +LQ T   V + G+ +   +P  V+F      +   F   L  IA
Sbjct: 64  GWGAYRDNQERELKAKLQGTQAQVRKDGNALVINLPGGVTFASDSANITSGFYSALNGIA 123

Query: 101 TILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYK 160
             LN +P T I +  +TD+ G   +N  +SQ RA+ +  YLI +   S+  I   GF   
Sbjct: 124 QSLNNYPETRIQVNGYTDNTGKDAHNQELSQRRANAVAQYLIAQ-GVSSNRIVANGFGSS 182

Query: 161 YPIDTNDTKVGRQNNQRIEIQIFP 184
            PI +N T  GR  N+R+EI+I P
Sbjct: 183 NPIASNSTPEGRLQNRRVEIKILP 206


>gi|257466649|ref|ZP_05630960.1| Outer membrane protein [Fusobacterium gonidiaformans ATCC 25563]
          Length = 217

 Score =  137 bits (345), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 57/166 (34%), Positives = 93/166 (56%), Gaps = 2/166 (1%)

Query: 23  REKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF 82
            +  K  L  +    +    +G+  D+ E   +  L++T + V R G+ I+ Y+P  V+F
Sbjct: 53  GKDTKGTLIGAGVGALAGLGWGAYRDQQEAALRASLKNTAVQVQRDGENISLYLPGGVTF 112

Query: 83  -VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYL 141
                 +   F   L  IA +L ++P T I +Q HTD+ G+ ++N+ +S  RA+ +K YL
Sbjct: 113 ASDSAQISGNFYSALNSIAQVLVQYPETQILVQGHTDNTGSFQHNMDLSNRRANSVKQYL 172

Query: 142 IQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGN 187
           I +GV+SNR +S +GF    P+  N T  GRQ N+R+EI+I P+ N
Sbjct: 173 IGQGVASNRLMS-QGFGPNNPVADNSTPDGRQMNRRVEIKIAPKYN 217


>gi|227824113|ref|YP_002828086.1| putative outer membrane protein, OmpA/MotB domain protein
           [Sinorhizobium fredii NGR234]
 gi|227343115|gb|ACP27333.1| putative outer membrane protein, OmpA/MotB domain protein
           [Sinorhizobium fredii NGR234]
          Length = 221

 Score =  137 bits (345), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 56/218 (25%), Positives = 95/218 (43%), Gaps = 35/218 (16%)

Query: 1   MIKELGLSMFIMTTISGCGLA---------------------------------SREKKK 27
           MIK+  +       +SGC                                    S  ++ 
Sbjct: 1   MIKKCAILAVAAVYLSGCTTTDPYTGEQKMSNTAGGALIGAGLGAATGLLVGGSSAGRRD 60

Query: 28  VFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSE-V 86
             L  +    +     G+ +D+ E E + QLQ TGI V+R GD I   +P +++F ++  
Sbjct: 61  AALVGAGIGALGGGLIGNYMDQQESELRAQLQGTGISVTRQGDRIILNMPSNITFATDRD 120

Query: 87  FLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGV 146
            +   F P L  +A +L K+  T+I +  HTDS G+  +N  +S+ RA  + +  +    
Sbjct: 121 QVIPPFYPTLDSVAIVLRKYNKTLIDVDGHTDSTGSAAHNQDLSERRAASVAN-YLGSRG 179

Query: 147 SSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
              R IS  G+  + P+ +N ++ GR  N+R+EI I P
Sbjct: 180 IDQRRISTMGYGMERPVASNSSEAGRAQNRRVEISIAP 217


>gi|325294095|ref|YP_004279959.1| porin [Agrobacterium sp. H13-3]
 gi|325061948|gb|ADY65639.1| porin [Agrobacterium sp. H13-3]
          Length = 220

 Score =  137 bits (345), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 57/218 (26%), Positives = 91/218 (41%), Gaps = 35/218 (16%)

Query: 1   MIKELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFG---------------- 44
           MIK++ +     T +S C        +  +  +     +    G                
Sbjct: 1   MIKKIAIVALCGTYLSACTTTDPYTGEQKMSNTAGGAGIGAVVGALGGLAVGGSPVGRRN 60

Query: 45  -----------------SSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEV 86
                            + +D  E E + QLQ TG+ V+R GD I   +P +++F   + 
Sbjct: 61  AALIGAGIGALAGGAIGNYMDGQESELRAQLQGTGVSVTRRGDSIVLNMPSNITFATDQD 120

Query: 87  FLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGV 146
            +   F   L  +A +LNKF  T+I I  HTDS G+ ++N  +S+ RA  + +  +    
Sbjct: 121 QVIPPFYQTLDSVAIVLNKFNRTLIDINGHTDSTGSQQHNQALSERRAASVAN-YLGARG 179

Query: 147 SSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
              R IS  GF    PI +N T  GR  N+R+E+ I P
Sbjct: 180 VDQRRISTLGFGPSQPIASNATPDGRAQNRRVEVLISP 217


>gi|254475762|ref|ZP_05089148.1| OmpA/MotB [Ruegeria sp. R11]
 gi|214030005|gb|EEB70840.1| OmpA/MotB [Ruegeria sp. R11]
          Length = 219

 Score =  137 bits (345), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 39/168 (23%), Positives = 76/168 (45%), Gaps = 2/168 (1%)

Query: 20  LASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVH 79
               ++       +          G+ LD  E E +  + + GI +   GD +   +P  
Sbjct: 53  TNDSDRGLGAATGAIVGAAAGSVIGNQLDAQERELRQSISNDGITIVNTGDRLIVSLPND 112

Query: 80  VSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIK 138
           ++F      +       L  +A  L ++P++++ +  HTDS G+   N  +S+ RA+ + 
Sbjct: 113 LTFATDSSAISPAVRSDLNKVAASLVRYPNSLVQVIGHTDSDGSASYNQALSERRANAVA 172

Query: 139 SYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRG 186
             +   GV  NR +++ G     P+ +N T  G+  N+R+EI + P+G
Sbjct: 173 DQIQAGGVPYNR-LAIIGRGEDQPVASNLTPEGKARNRRVEIVVIPQG 219


>gi|320173827|gb|EFW49008.1| putative outer membrane lipoprotein [Shigella dysenteriae CDC
           74-1112]
          Length = 195

 Score =  137 bits (345), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 53/195 (27%), Positives = 93/195 (47%), Gaps = 12/195 (6%)

Query: 1   MIKELGLSMFI---MTTISGCGLASREKKKVFLHKSNDTDIVNKRFG-------SSLDKA 50
           M K + L   +      +SGC       ++     +    + +             +D  
Sbjct: 1   MKKRVYLIAAVVSGALAVSGCTTNPYTGEREAGKSAIGAGLDSLVGAALGGGVGYYMDVQ 60

Query: 51  EDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEV-FLEKKFLPMLQLIATILNKFPST 109
           E + + +++ TG+ V+R GD I   +P +V+F S    L+      L  +A +L ++P T
Sbjct: 61  EAKLRDKMRGTGVSVTRSGDNIILNMPNNVTFDSSSATLKPAGANTLTGVAMVLKEYPKT 120

Query: 110 VIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTK 169
            + +  +TDS G    N+ +SQ+RAD + S LI +GV ++R I  +G     PI +N T 
Sbjct: 121 AVNVIGYTDSTGGHDLNMRLSQQRADSVASALITQGVDASR-IRTQGLGPANPIASNSTA 179

Query: 170 VGRQNNQRIEIQIFP 184
            G+  N+R+EI + P
Sbjct: 180 EGKAQNRRVEITLSP 194


>gi|237744199|ref|ZP_04574680.1| outer membrane protein [Fusobacterium sp. 7_1]
 gi|256027684|ref|ZP_05441518.1| Outer membrane protein [Fusobacterium sp. D11]
 gi|260494220|ref|ZP_05814351.1| type VI secretion system OmpA/MotB [Fusobacterium sp. 3_1_33]
 gi|289765644|ref|ZP_06525022.1| outer membrane protein [Fusobacterium sp. D11]
 gi|229431428|gb|EEO41640.1| outer membrane protein [Fusobacterium sp. 7_1]
 gi|260198366|gb|EEW95882.1| type VI secretion system OmpA/MotB [Fusobacterium sp. 3_1_33]
 gi|289717199|gb|EFD81211.1| outer membrane protein [Fusobacterium sp. D11]
          Length = 212

 Score =  137 bits (345), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 59/208 (28%), Positives = 91/208 (43%), Gaps = 27/208 (12%)

Query: 3   KELGLSMFIMTTISGCGLAS-------------------------REKKKVFLHKSNDTD 37
           K++  S  +  ++ GC                              +  K  L  +    
Sbjct: 4   KKIIASCMLALSLVGCTGFEAGNGGYTTGGAAGGAAVGALAGQIIGKDTKGTLIGAAVGS 63

Query: 38  IVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPML 96
           +V   +G+  D  E E + +LQ T   V + G+ +   +P  V+F      +   F   L
Sbjct: 64  LVGMGWGAYRDNQERELKAKLQGTQAQVKKEGNALVINLPGGVTFASDSANISSGFYSAL 123

Query: 97  QLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRG 156
             IA  LN +P T I +  +TD+ G   +N  +SQ RA+ +  YLI +GVSS+R I   G
Sbjct: 124 NGIAQSLNNYPETRIQVNGYTDNTGKDAHNQELSQRRANAVAQYLIAQGVSSSRII-ANG 182

Query: 157 FAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           F    PI +N T  GR  N+R+EI+I P
Sbjct: 183 FGSSNPIASNSTPDGRLQNRRVEIKILP 210


>gi|19704600|ref|NP_604162.1| Outer membrane protein [Fusobacterium nucleatum subsp. nucleatum
           ATCC 25586]
 gi|19714896|gb|AAL95461.1| Outer membrane protein [Fusobacterium nucleatum subsp. nucleatum
           ATCC 25586]
          Length = 202

 Score =  137 bits (344), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 50/163 (30%), Positives = 78/163 (47%), Gaps = 2/163 (1%)

Query: 23  REKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF 82
            +  K  L  +    ++   +G+  D  E E + +LQ T   V + G+ +   +P  V+F
Sbjct: 39  GKDTKGTLIGAAVGSLLGMGWGAYRDNQERELKAKLQGTQAQVRKDGNALVINLPGGVTF 98

Query: 83  -VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYL 141
                 +   F   L  IA  LN +P T I +  +TD+ G   +N  +SQ RA+ +  YL
Sbjct: 99  ASDSANITSGFYSALNGIAQSLNNYPETRIQVNGYTDNTGKDAHNQELSQRRANAVAQYL 158

Query: 142 IQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           I +   S+  I   GF    PI +N T  GR  N+R+EI+I P
Sbjct: 159 IAQ-GVSSNRIVANGFGSSNPIASNSTPEGRLQNRRVEIKILP 200


>gi|325928737|ref|ZP_08189907.1| outer membrane protein/peptidoglycan-associated (lipo)protein
           [Xanthomonas perforans 91-118]
 gi|325540905|gb|EGD12477.1| outer membrane protein/peptidoglycan-associated (lipo)protein
           [Xanthomonas perforans 91-118]
          Length = 229

 Score =  137 bits (344), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 49/176 (27%), Positives = 88/176 (50%), Gaps = 4/176 (2%)

Query: 10  FIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIG 69
                ++G   ++ E+++  +  +    +     G   D+ E   + +  +TGI V R G
Sbjct: 44  VAAGLLTG--DSATERRQHAMVGAGIGALSGAAIGQYQDRQERALRERTANTGIEVQRQG 101

Query: 70  DMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLL 128
           D I+  +P  ++F   +  L+ +F   L  +A+ L ++  T++ +  HTDS+G+   N  
Sbjct: 102 DNISLNLPDGITFDFGKSALKPQFYTALNGVASTLREYNQTMVEVVGHTDSVGSDAVNQR 161

Query: 129 ISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           +S+ERA  +  YL  +GV   R     G   +YPI  N T  GR  N+R+EI++ P
Sbjct: 162 LSEERASAVAQYLTAQGVQRERM-ETMGAGKRYPIADNTTDAGRAKNRRVEIRLIP 216


>gi|332533226|ref|ZP_08409093.1| putative lipoprotein [Pseudoalteromonas haloplanktis ANT/505]
 gi|332037305|gb|EGI73760.1| putative lipoprotein [Pseudoalteromonas haloplanktis ANT/505]
          Length = 210

 Score =  137 bits (344), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 59/204 (28%), Positives = 99/204 (48%), Gaps = 22/204 (10%)

Query: 3   KELGLSMFIMTTISGCGL--------------------ASREKKKVFLHKSNDTDIVNKR 42
           K L     +   +SGC +                     S  K K     +    +    
Sbjct: 5   KSLLSVTVVAVLLSGCEMNNTGKGAAIGAAAGGVLGKATSNHKDKRIFIGAAIGALAGAA 64

Query: 43  FGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIAT 101
            G+ +DK E+ F+ +L  +G+ V R GD +   +P +++F   + ++   F   L  IA 
Sbjct: 65  VGNYMDKQEEAFRDELAGSGVEVVREGDNLRLVMPSNITFATDQSYISSGFNDTLDAIAK 124

Query: 102 ILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKY 161
           ++NK+  T ++I+ HTDS G    N+ +S+ERA  +K+YL+ + + + R +S  G+    
Sbjct: 125 VMNKYEKTYLSIEGHTDSTGKDSYNMNLSRERAQSVKNYLVNQQIMAER-VSTMGYGETR 183

Query: 162 PIDTNDTKVGRQNNQRIEIQIFPR 185
           PI TND+  GR  N+R+EIQI P 
Sbjct: 184 PIATNDSANGRAQNRRVEIQIVPN 207


>gi|332085086|gb|EGI90266.1| inner membrane lipoprotein yiaD [Shigella boydii 5216-82]
          Length = 238

 Score =  137 bits (344), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 53/180 (29%), Positives = 92/180 (51%), Gaps = 2/180 (1%)

Query: 6   GLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVV 65
           GL   +   I     + +++ K  L  +     +    G  +D  E + + +++ TG+ V
Sbjct: 59  GLGSLVGAGIGALSSSKKDRGKGALIGATAGAALGGGVGYYMDVQEAKLRDKMRGTGVSV 118

Query: 66  SRIGDMITCYIPVHVSFVSEV-FLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLK 124
           +R GD I   +P +V+F S    L+      L  +A +L ++P T + +  +TDS G   
Sbjct: 119 TRSGDNIILNMPNNVTFDSSSATLKPAGANTLTGVAMVLKEYPKTAVNVIGYTDSTGGHD 178

Query: 125 NNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
            N+ +SQ+RAD + S LI +GV ++R I  +G     PI +N T  G+  N+R+EI + P
Sbjct: 179 LNMRLSQQRADSVASALITQGVDASR-IRTQGLGPANPIASNSTAEGKAQNRRVEITLSP 237


>gi|224824498|ref|ZP_03697605.1| OmpA/MotB domain protein [Lutiella nitroferrum 2002]
 gi|224602991|gb|EEG09167.1| OmpA/MotB domain protein [Lutiella nitroferrum 2002]
          Length = 218

 Score =  136 bits (342), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 53/219 (24%), Positives = 96/219 (43%), Gaps = 33/219 (15%)

Query: 1   MIKE----LGLSMFIMTTISGCGLASREKK---------------------------KVF 29
           M K     L  ++ +   ++ C    +  +                           K  
Sbjct: 1   MFKHSKTLLTAAVALSVGLAACTTNPQTGQSQMSKTAMYGLGAAAACGIAGAATHGSKGA 60

Query: 30  LHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV-SEVFL 88
            + +    IV    G+ +D  E + + +L +T + V R+GD I   +P +++F  +   L
Sbjct: 61  RNAALGCGIVGAGVGAYMDYQEKQLRDKLANTQVGVDRVGDQIKLTMPDNITFAVNSAEL 120

Query: 89  EKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSS 148
           +      L  ++ +L ++P T I +  HTD+ G +  N  +SQ RA  +  +L  RGV+ 
Sbjct: 121 QPSVRTALTDVSNVLTQYPDTTITVAGHTDNTGNVAYNQTLSQRRAQSVAGFLQSRGVAG 180

Query: 149 NRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGN 187
           +R I+  G+    PI +N T  GR  N+R+EI I P+ +
Sbjct: 181 SR-INPVGYGQNQPIASNTTAEGRAKNRRVEILINPKAS 218


>gi|254302883|ref|ZP_04970241.1| possible outer membrane protein [Fusobacterium nucleatum subsp.
           polymorphum ATCC 10953]
 gi|148323075|gb|EDK88325.1| possible outer membrane protein [Fusobacterium nucleatum subsp.
           polymorphum ATCC 10953]
          Length = 212

 Score =  136 bits (342), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 53/163 (32%), Positives = 83/163 (50%), Gaps = 2/163 (1%)

Query: 23  REKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF 82
            +  K  L  +    ++   +G+  D  E E + +LQ T   V + G+ +   +P  V+F
Sbjct: 49  GKDTKGTLIGAAVGSLLGMGWGAYRDNQEKELKAKLQGTQAEVKKDGNALVINLPGGVTF 108

Query: 83  -VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYL 141
                 +   F   L  IA  LN +P T I +  +TDS G   +N  +SQ RA+ +  YL
Sbjct: 109 ASDSANITSSFYSALNGIAQSLNNYPETRIQVNGYTDSTGNDAHNQELSQRRANAVAQYL 168

Query: 142 IQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           + +GVSS+R +   GF    PI +N T+ GR  N+R+EI+I P
Sbjct: 169 VAQGVSSSRIV-ANGFGSSNPIASNSTQEGRLQNRRVEIKILP 210


>gi|261378300|ref|ZP_05982873.1| OmpA family protein [Neisseria cinerea ATCC 14685]
 gi|269145394|gb|EEZ71812.1| OmpA family protein [Neisseria cinerea ATCC 14685]
          Length = 225

 Score =  136 bits (342), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 51/182 (28%), Positives = 80/182 (43%), Gaps = 2/182 (1%)

Query: 4   ELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGI 63
           +  L       + G   A     K   + +     +    G  +D  E   +  L  T +
Sbjct: 34  KTALYGLGGAAVCGIMGALTHGGKGARNSALVCGALGAGIGGYMDYQEQRLRQSLAGTQV 93

Query: 64  VVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGT 122
            V R G+ I   +P +V+F      L       L   A  L ++P T + I  HTD+ G+
Sbjct: 94  QVQRQGNQIKLVMPENVTFATGSAVLSDNAQFALNTAAQTLVQYPDTTLTINGHTDNTGS 153

Query: 123 LKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
              N  +SQ RA  +  YL  RGV+++R ++V G+    P+ +N T  GR  N+R+EI I
Sbjct: 154 DAVNNPLSQHRAQTVAYYLQSRGVAASR-LAVYGYGSHMPVASNATAEGRAQNRRVEILI 212

Query: 183 FP 184
            P
Sbjct: 213 NP 214


>gi|256822902|ref|YP_003146865.1| OmpA/MotB domain-containing protein [Kangiella koreensis DSM 16069]
 gi|256796441|gb|ACV27097.1| OmpA/MotB domain protein [Kangiella koreensis DSM 16069]
          Length = 221

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 54/211 (25%), Positives = 96/211 (45%), Gaps = 29/211 (13%)

Query: 2   IKELGLSMFIMTTISGCGL----ASREKKKVFLHKSNDTDIVNKRFGS------------ 45
           +K L  ++       GC         E+    +       I     G+            
Sbjct: 8   MKTLTAAVVAGVMGVGCTTLNPYTGEEQTSKTVKYGAIGAITCGLIGATRDSKSARNAAL 67

Query: 46  -----------SLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSE-VFLEKKFL 93
                       +D  E E + +L  TG+ V R G+ I   +P  ++F ++   ++  F 
Sbjct: 68  GCGAIGAGIGAYMDSQEKELREELAGTGVGVQRDGEQIHLIMPGDITFQTDRYAIDSGFY 127

Query: 94  PMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFIS 153
           P+L  ++ +L KF  T + +   TDS+G+   N  +S++RA+ + SYL QR + +NR + 
Sbjct: 128 PVLDSVSKVLYKFKDTNLEVAGFTDSVGSDSYNQELSEKRANSVASYLRQREIPNNR-LR 186

Query: 154 VRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           V G+  +YP+  N+T+ GR  N+R+E+ I P
Sbjct: 187 VVGYGERYPVAPNETEAGRSKNRRVELTITP 217


>gi|237742260|ref|ZP_04572741.1| outer membrane protein [Fusobacterium sp. 4_1_13]
 gi|256845531|ref|ZP_05550989.1| type VI secretion system OmpA/MotB [Fusobacterium sp. 3_1_36A2]
 gi|294785172|ref|ZP_06750460.1| OmpA family protein [Fusobacterium sp. 3_1_27]
 gi|229429908|gb|EEO40120.1| outer membrane protein [Fusobacterium sp. 4_1_13]
 gi|256719090|gb|EEU32645.1| type VI secretion system OmpA/MotB [Fusobacterium sp. 3_1_36A2]
 gi|294486886|gb|EFG34248.1| OmpA family protein [Fusobacterium sp. 3_1_27]
          Length = 212

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 52/208 (25%), Positives = 88/208 (42%), Gaps = 27/208 (12%)

Query: 3   KELGLSMFIMTTISGCGLAS-------------------------REKKKVFLHKSNDTD 37
           K++  S  +  ++ GC                              +  K  L  +    
Sbjct: 4   KKIIASCMLALSLVGCTGFEAGNGGYTAGGAAGGAAVGALAGQIIGKDTKGTLIGAAVGS 63

Query: 38  IVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPML 96
           ++   +G+  D  E E + +LQ T   V + G+ +   +P  V+F      +   F   L
Sbjct: 64  LLGMGWGAYRDNQERELKAKLQGTQAQVRKDGNALVINLPGGVTFASDSANISSGFYSAL 123

Query: 97  QLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRG 156
             IA  LN +P T I +  +TD+ G   +N  +SQ RA+ +  YLI +   ++  I   G
Sbjct: 124 NGIAQSLNNYPETRIQVNGYTDNTGKDAHNQELSQRRANAVAQYLIAQ-GVASNRIVANG 182

Query: 157 FAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           F    P+ +N T+ GR  N+R+EI+I P
Sbjct: 183 FGSSNPVASNSTQEGRLQNRRVEIKILP 210


>gi|269968226|ref|ZP_06182255.1| putative lipoprotein [Vibrio alginolyticus 40B]
 gi|269827149|gb|EEZ81454.1| putative lipoprotein [Vibrio alginolyticus 40B]
          Length = 281

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 51/221 (23%), Positives = 98/221 (44%), Gaps = 39/221 (17%)

Query: 2   IKELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFG----------------- 44
           +K++ +++ ++  ++GC    R+      +++N T                         
Sbjct: 60  LKKMPIALALVLALTGCQATQRQNATTGEYETNSTTQGALIGAIAGAAIGLATGDDAKER 119

Query: 45  -------------------SSLDKAEDEFQMQLQDTGIVVSRIG-DMITCYIPVHVSFVS 84
                                 D+ E E +  L ++G+ V R+G + +   +   + F S
Sbjct: 120 RQHALIGAAAGGATGAGVGYYFDQQEAELRRALLNSGVQVQRVGENQLLLRMENGIGFSS 179

Query: 85  EVF-LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQ 143
             + L+      L+ +A IL ++P T + I  +TDS G+   N  +S+ RA+ ++ +L+ 
Sbjct: 180 SSYQLDASIHNTLRGVARILVEYPDTSLVIDGYTDSTGSESYNQTLSERRAESVRQFLVS 239

Query: 144 RGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           + V+  R I  RG+  + PI +N T  GR  N+R+EIQI P
Sbjct: 240 QNVAPGRAI-ARGYGERNPICSNQTSEGRACNRRVEIQILP 279


>gi|254229577|ref|ZP_04922989.1| rickettsia 17 kDa surface antigen family [Vibrio sp. Ex25]
 gi|151937860|gb|EDN56706.1| rickettsia 17 kDa surface antigen family [Vibrio sp. Ex25]
          Length = 269

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 51/221 (23%), Positives = 98/221 (44%), Gaps = 39/221 (17%)

Query: 2   IKELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFG----------------- 44
           +K++ +++ ++  ++GC    R+      +++N T                         
Sbjct: 48  LKKMPIALALVLALTGCQATQRQNATTGEYETNSTTQGALIGAIAGAAIGLATGDDAKER 107

Query: 45  -------------------SSLDKAEDEFQMQLQDTGIVVSRIG-DMITCYIPVHVSFVS 84
                                 D+ E E +  L ++G+ V R+G + +   +   + F S
Sbjct: 108 RQHALIGAAAGGATGAGVGYYFDQQEAELRRALLNSGVQVQRVGENQLLLRMENGIGFSS 167

Query: 85  EVF-LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQ 143
             + L+      L+ +A IL ++P T + I  +TDS G+   N  +S+ RA+ ++ +L+ 
Sbjct: 168 SSYQLDASIHNTLRGVARILVEYPDTSLVIDGYTDSTGSESYNQTLSERRAESVRQFLVS 227

Query: 144 RGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           + V+  R I  RG+  + PI +N T  GR  N+R+EIQI P
Sbjct: 228 QNVAPGRAI-ARGYGERNPICSNQTSEGRACNRRVEIQILP 267


>gi|317064862|ref|ZP_07929347.1| outer membrane protein [Fusobacterium ulcerans ATCC 49185]
 gi|313690538|gb|EFS27373.1| outer membrane protein [Fusobacterium ulcerans ATCC 49185]
          Length = 211

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 56/210 (26%), Positives = 97/210 (46%), Gaps = 31/210 (14%)

Query: 8   SMFIMTTISGCGLAS-----------------------------REKKKVFLHKSNDTDI 38
           S+ +   I+GC  +                               +  K  L  +    +
Sbjct: 3   SLLLALIITGCTSSPFLDETGSVSGKTKGTAGGAAAGALIGQLIGKDTKGTLIGAGVGAL 62

Query: 39  VNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQ 97
               +G+  D+ E E + +L++T + VS+ GD +   +P  V+F      +   F   L 
Sbjct: 63  AGLGWGAYRDRQEQELRERLKNTEVQVSQNGDNLNLNLPGGVTFATDSSNIVSSFYGPLN 122

Query: 98  LIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGF 157
            IAT+L ++P T I +  +TD++G+   N+ +S+ RA  +++YLIQ+   S R IS  G+
Sbjct: 123 SIATVLVQYPETRIIVNGYTDNVGSASYNVSLSERRAASVRNYLIQQ-GVSARRISYVGY 181

Query: 158 AYKYPIDTNDTKVGRQNNQRIEIQIFPRGN 187
             + P  TN T  GR  N+R+E++I P  N
Sbjct: 182 GMENPRATNSTAAGRAENRRVELEILPMSN 211


>gi|239993109|ref|ZP_04713633.1| Outer membrane protein and related peptidoglycan-associated
           (lipo)protein [Alteromonas macleodii ATCC 27126]
          Length = 213

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 56/208 (26%), Positives = 96/208 (46%), Gaps = 25/208 (12%)

Query: 1   MIKELGLSMFIM-TTISGCGLASREKKKVFLHKSNDTDIVNKRFG--------------- 44
           M K L +S+     T++GC       +K     +    ++ K  G               
Sbjct: 1   MKKTLAVSLIAASLTVAGCATDPNNTQKGAAIGAVVGALLGKATGDNDKSRYAWGAAVGA 60

Query: 45  -------SSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPML 96
                  + +DK E+E + +L DTG+ V R GD +   +P  ++F      +   F P+L
Sbjct: 61  IAGGAIGNYMDKQEEELRNELSDTGVQVVREGDNLRLIMPGDITFATDSSSISPNFNPVL 120

Query: 97  QLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRG 156
           Q +A ++N +  TV+ I+ HTD  G+ + N  +S+ RA  +K+ LI   V+  R I+  G
Sbjct: 121 QDVAKVVNNYEKTVLMIKGHTDDTGSEQYNQSLSERRAGAVKNLLINYSVNPTR-ITTVG 179

Query: 157 FAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
                P   N++   R  N+R+E++I P
Sbjct: 180 MGEYAPKVPNNSAANRSMNRRVEMEIQP 207


>gi|317046265|ref|YP_004113913.1| OmpA/MotB domain-containing protein [Pantoea sp. At-9b]
 gi|316947882|gb|ADU67357.1| OmpA/MotB domain protein [Pantoea sp. At-9b]
          Length = 220

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 47/180 (26%), Positives = 89/180 (49%), Gaps = 2/180 (1%)

Query: 6   GLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVV 65
           GL   +   +     + +++ K  L  +     +    G  +D  E + + +++ TG+ V
Sbjct: 40  GLGAVLGAGVGMMSSSKKDRGKGALIGAASGAALGGGIGYYMDVQEAKLRDKMRGTGVSV 99

Query: 66  SRIGDMITCYIPVHVSFVSEV-FLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLK 124
           +R GD I   +P +V+F S    L+      L  +A +L ++P T + +  +TDS GT  
Sbjct: 100 TRQGDNIVLNMPNNVTFDSSSSNLKPAGANTLTGVAMVLKEYPKTAVNVTGYTDSTGTRA 159

Query: 125 NNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
            N+ +SQ+RA+ + S LI +       +  +G     P+ +N T+ G+  N+R+EI + P
Sbjct: 160 LNMRLSQQRAESVASALIVQ-GVEANRLRTQGLGPDNPVASNSTEAGKAQNRRVEITLTP 218


>gi|15889974|ref|NP_355655.1| porin [Agrobacterium tumefaciens str. C58]
 gi|15157937|gb|AAK88440.1| porin [Agrobacterium tumefaciens str. C58]
          Length = 220

 Score =  135 bits (340), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 58/218 (26%), Positives = 92/218 (42%), Gaps = 35/218 (16%)

Query: 1   MIKELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFG---------------- 44
           MIK++ +     T +S C        +  +  +     +    G                
Sbjct: 1   MIKKIAIVALCGTYLSACTTTDPYTGEQKMSNTAGGAGIGAVVGALGGLAVGGSPVGRRN 60

Query: 45  -----------------SSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEV 86
                            + +D  E E + QLQ TG+ V+R GD I   +P +++F   + 
Sbjct: 61  AALIGAGIGALAGGAIGNYMDGQEAELRAQLQGTGVSVTRRGDSIVLNMPSNITFATDQD 120

Query: 87  FLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGV 146
            +   F   L  +A +LNKF  T+I I  HTDS G+L++N  +S+ RA  + +  +    
Sbjct: 121 QVIPPFYQTLDSVAIVLNKFNRTLIDINGHTDSTGSLQHNQALSERRAASVAN-YLGARG 179

Query: 147 SSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
              R IS  GF    PI +N T  GR  N+R+E+ I P
Sbjct: 180 VDQRRISTLGFGPSQPIASNATSDGRAQNRRVEVLISP 217


>gi|77361745|ref|YP_341320.1| lipoprotein [Pseudoalteromonas haloplanktis TAC125]
 gi|76876656|emb|CAI87878.1| putative lipoprotein [Pseudoalteromonas haloplanktis TAC125]
          Length = 209

 Score =  135 bits (340), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 57/204 (27%), Positives = 95/204 (46%), Gaps = 22/204 (10%)

Query: 3   KELGLSMFIMTTISGC--------------------GLASREKKKVFLHKSNDTDIVNKR 42
           K L     +   +SGC                          K K     +    +    
Sbjct: 5   KSLLSVTVVAVLLSGCEMNNTGKGAAIGAAAGGVLGKATGNHKDKRIFIGAAIGALAGAA 64

Query: 43  FGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIAT 101
            G  +DK E  F+ +L  +G+ V R GD +   +P +++F   + ++   F   L  IA 
Sbjct: 65  VGDYMDKQETAFRDELAGSGVEVVREGDNLRLVMPSNITFATDQSYISSGFHNTLSAIAK 124

Query: 102 ILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKY 161
           ++NK+  T ++++ HTDS G    N+ +SQ+RA  +K+YL+ + + + R IS  G+    
Sbjct: 125 VMNKYEKTYLSVEGHTDSTGKDSYNMSLSQQRAQSVKNYLVNQQIMAER-ISTTGYGETR 183

Query: 162 PIDTNDTKVGRQNNQRIEIQIFPR 185
           PI +ND+  GR  N+R+EIQI P 
Sbjct: 184 PISSNDSANGRAQNRRVEIQIVPN 207


>gi|108524622|ref|YP_619844.1| hypothetical protein pQKH54_47 [Plasmid QKH54]
 gi|99644193|emb|CAJ43326.1| hypothetical protein [Plasmid QKH54]
          Length = 220

 Score =  135 bits (340), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 51/214 (23%), Positives = 90/214 (42%), Gaps = 31/214 (14%)

Query: 2   IKELGLSMFIMTTISGCGLASRE-----------------------------KKKVFLHK 32
           +K+L  +  I   +SGC     +                               +  L  
Sbjct: 1   MKKLVSATLIAAALSGCASMKNDDGSLNKTTSYGGLAALAGGVAGALINHNNPGQGALIG 60

Query: 33  SNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKK 91
           +         +G  +DK E E +  ++ +G+ V R GD +   +P  ++F   +  ++  
Sbjct: 61  AAIAGSAGAGYGYYVDKQEAELRESMKGSGVEVEREGDQLKLVMPGSITFATGKSEIQPS 120

Query: 92  FLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRF 151
           F   L  +A    +F  + + +  HTDS+G+ + N ++S  RAD +  +L   GV  +R 
Sbjct: 121 FQYTLNQLAASFRQFQDSDLIVTGHTDSVGSYEANQVLSARRADSVSQFLRSNGVDPSR- 179

Query: 152 ISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPR 185
           +   G     PI  NDT  GR  N+R+EI++ PR
Sbjct: 180 LQTFGAGSSSPIAPNDTTEGRAQNRRVEIKLVPR 213


>gi|332143465|ref|YP_004429203.1| Outer membrane protein and related peptidoglycan-associated
           (lipo)protein [Alteromonas macleodii str. 'Deep
           ecotype']
 gi|327553487|gb|AEB00206.1| Outer membrane protein and related peptidoglycan-associated
           (lipo)protein [Alteromonas macleodii str. 'Deep
           ecotype']
          Length = 213

 Score =  135 bits (340), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 57/208 (27%), Positives = 96/208 (46%), Gaps = 25/208 (12%)

Query: 1   MIKELGLSMFIM-TTISGCGLASREKKKVFLHKSNDTDIVNKRFG--------------- 44
           M K L +S+     TI+GC       +K     +    ++ K  G               
Sbjct: 1   MKKTLAVSLIAASLTIAGCATDPNNTQKGAAIGAVVGALLGKATGDNDKSRYAWGAAVGA 60

Query: 45  -------SSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPML 96
                  + +DK E+E + +L DTG+ V R GD +   +P  ++F      +   F P+L
Sbjct: 61  IAGGAIGNYMDKQEEELRTELSDTGVQVVREGDNLRLIMPGDITFATDSASISPNFNPVL 120

Query: 97  QLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRG 156
           Q +A ++N +  TV+ I+ HTD  G+ + N  +S+ RA  +K+ LI   V+  R I+  G
Sbjct: 121 QDVAKVVNNYEKTVLMIKGHTDDTGSEQYNQSLSERRAGAVKNLLINYSVNPTR-ITTVG 179

Query: 157 FAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
                P   N++   R  N+R+E++I P
Sbjct: 180 MGEYSPKVPNNSAANRSMNRRVEMEIQP 207


>gi|253582159|ref|ZP_04859382.1| outer membrane protein OmpF [Fusobacterium varium ATCC 27725]
 gi|251835698|gb|EES64236.1| outer membrane protein OmpF [Fusobacterium varium ATCC 27725]
          Length = 186

 Score =  135 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 44/184 (23%), Positives = 86/184 (46%), Gaps = 6/184 (3%)

Query: 2   IKELGLSMF--IMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQ 59
           +K++ L +   ++  ++GC    ++  K  + +  + + + +    S    E+       
Sbjct: 1   MKKVLLMLSASLIVILTGCSSVDKQPLKELVIEETENEFIMEDIDVSKKTLEEII--VFN 58

Query: 60  DTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTD 118
           + G+ + R G+ +   +P  V F  ++  ++ K    L  +A  L + P   I I  +TD
Sbjct: 59  EKGVTIRREGNNLVLSMPELVLFDFNKYEVKNKVKGSLNALAKALEENPDIRIKIDGYTD 118

Query: 119 SIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRI 178
            IG+   NL +S +RA+ IK   +         IS+ G+  + PI +N T+ GR  N+R+
Sbjct: 119 FIGSEGYNLELSVKRANAIKD-YLTNRGVKPSNISIEGYGKQNPIASNQTETGRAKNRRV 177

Query: 179 EIQI 182
           E  I
Sbjct: 178 EFII 181


>gi|311695446|gb|ADP98319.1| OmpA/MotB domain protein [marine bacterium HP15]
          Length = 218

 Score =  135 bits (339), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 53/217 (24%), Positives = 98/217 (45%), Gaps = 34/217 (15%)

Query: 1   MIKELGLSMFIMTTISGC--------------------------------GLASREKKKV 28
           M K + + M     + GC                                  +  ++ K 
Sbjct: 1   MKKMILVFMVATFGLGGCMTYDPYTGEEKTSNATKGSIIGAIGGAAIGAATSSKSDRGKG 60

Query: 29  FLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV-SEVF 87
            L  +     +    G  +DK E E + +L+ TG+ V R GD I   +P +++F  +E  
Sbjct: 61  ALIGAASGAAIGGGVGYYMDKQEAELRRKLEGTGVRVVRNGDEIELVMPGNITFDLNESS 120

Query: 88  LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVS 147
           ++  F   L+ +A +L ++  T+I I+ HTDS G+   N L+S+ RA  ++ +L+ +   
Sbjct: 121 IKPSFSGTLESVALVLKEYDKTIIQIEGHTDSSGSDSYNQLLSERRASSVRDFLLNQ-GI 179

Query: 148 SNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
             +     G+  +YP+ +NDT  GR+ N+R+E+ + P
Sbjct: 180 EPKRTRAVGYGERYPVASNDTAAGREQNRRVELTLVP 216


>gi|315497454|ref|YP_004086258.1| ompa/motb domain protein [Asticcacaulis excentricus CB 48]
 gi|315415466|gb|ADU12107.1| OmpA/MotB domain protein [Asticcacaulis excentricus CB 48]
          Length = 222

 Score =  135 bits (339), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 57/220 (25%), Positives = 95/220 (43%), Gaps = 37/220 (16%)

Query: 1   MIKELGLSMFIMTTI-SGCGLASREKKKVFLHKSNDTDIVNKRFGS-------------- 45
           M  +  +++  +  + + C        +V    +    I+    G+              
Sbjct: 1   MRNKALIALAGVALMTAACTTTDPVTGEVVRDNTKTNAIIGAAVGAGLGYATNTNKGEQG 60

Query: 46  --------------------SLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VS 84
                                +DK + E + +L  T + V+R GD I   +P  V+F   
Sbjct: 61  RKNAVIGAGIGALAGAAVGQYMDKQQAELRRELAGTNVTVTRNGDNIILNMPSDVTFGSG 120

Query: 85  EVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQR 144
              ++  F P+L  +A+ILNK+PST + I  H DS G+   N  +S++RA+   +YL  R
Sbjct: 121 SASIDASFYPVLNDVASILNKYPSTYVDIVGHADSTGSDAINEPLSEDRANSTAAYLTSR 180

Query: 145 GVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           GV + R   V G   + PI +N T  GR  N+R+EI + P
Sbjct: 181 GVVNQRLF-VAGMGSRQPIASNATPEGRAKNRRVEITLRP 219


>gi|253771615|ref|YP_003034446.1| outer membrane lipoprotein [Escherichia coli 'BL21-Gold(DE3)pLysS
           AG']
 gi|254163475|ref|YP_003046583.1| putative outer membrane lipoprotein [Escherichia coli B str.
           REL606]
 gi|297520666|ref|ZP_06939052.1| putative outer membrane lipoprotein [Escherichia coli OP50]
 gi|300928223|ref|ZP_07143762.1| OmpA family protein [Escherichia coli MS 187-1]
 gi|242379069|emb|CAQ33870.1| predicted outer membrane lipoprotein [Escherichia coli BL21(DE3)]
 gi|253322659|gb|ACT27261.1| OmpA/MotB domain protein [Escherichia coli 'BL21-Gold(DE3)pLysS
           AG']
 gi|253975376|gb|ACT41047.1| predicted outer membrane lipoprotein [Escherichia coli B str.
           REL606]
 gi|253979532|gb|ACT45202.1| predicted outer membrane lipoprotein [Escherichia coli BL21(DE3)]
 gi|300463768|gb|EFK27261.1| OmpA family protein [Escherichia coli MS 187-1]
          Length = 219

 Score =  135 bits (339), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 53/180 (29%), Positives = 91/180 (50%), Gaps = 2/180 (1%)

Query: 6   GLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVV 65
           GL   +   I     + +++ K  L        +    G  +D  E + + +++ TG+ V
Sbjct: 40  GLGSLVGAGIGALSSSKKDRGKGALIGVAAGAALGGGVGYYMDVQEAKLRDKMRGTGVSV 99

Query: 66  SRIGDMITCYIPVHVSFVSEV-FLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLK 124
           +R GD I   +P +V+F S    L+      L  +A +L ++P T + +  +TDS G   
Sbjct: 100 TRSGDNIILNMPNNVTFDSSSATLKPAGANTLTGVAMVLKEYPKTAVNVIGYTDSTGGHD 159

Query: 125 NNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
            N+ +SQ+RAD + S LI +GV ++R I  +G     PI +N T  G+  N+R+EI + P
Sbjct: 160 LNMRLSQQRADSVASALITQGVDASR-IRTQGLGPANPIASNSTAEGKAQNRRVEITLSP 218


>gi|34763092|ref|ZP_00144063.1| Outer membrane protein [Fusobacterium nucleatum subsp. vincentii
           ATCC 49256]
 gi|27887226|gb|EAA24326.1| Outer membrane protein [Fusobacterium nucleatum subsp. vincentii
           ATCC 49256]
          Length = 202

 Score =  134 bits (338), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 48/163 (29%), Positives = 79/163 (48%), Gaps = 2/163 (1%)

Query: 23  REKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF 82
            +  K  L  +    ++   +G+  D  E E + +LQ T   V + G+ +   +P  V+F
Sbjct: 39  GKDTKGTLIGAAVGSLLGMGWGAYRDNQERELKAKLQGTQAQVRKDGNALVINLPGGVTF 98

Query: 83  -VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYL 141
                 +   F   L  IA  LN +P T I +  +TD+ G   +N  +SQ RA+ +  YL
Sbjct: 99  ASDSANISSGFYSALNGIAQSLNNYPETRIQVNGYTDNTGKDAHNQELSQRRANAVAQYL 158

Query: 142 IQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           I +   ++  I   GF    P+ +N T+ GR  N+R+EI+I P
Sbjct: 159 IAQ-GVASNRIVANGFGSSNPVASNSTQEGRLQNRRVEIKILP 200


>gi|262274025|ref|ZP_06051837.1| Flagellar motor rotation protein MotB [Grimontia hollisae CIP
           101886]
 gi|262221835|gb|EEY73148.1| Flagellar motor rotation protein MotB [Grimontia hollisae CIP
           101886]
          Length = 208

 Score =  134 bits (338), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 57/207 (27%), Positives = 96/207 (46%), Gaps = 23/207 (11%)

Query: 1   MIKELGLSMF--IMTTISGCGL-------------------ASREKKKVFLHKSNDTDIV 39
           M K + +         + GC                         K K     +    + 
Sbjct: 1   MRKSIPVVTLVTASLMLGGCATNTGKGAAIGAATGAILGKATGNHKDKRIFIGAAIGALA 60

Query: 40  NKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSE-VFLEKKFLPMLQL 98
               G  +D+ E  F+ +L  +GI V R GD I   +P +++F +    +   F   L  
Sbjct: 61  GAAVGQYMDRQEAAFREELAGSGIEVVREGDNIRLVMPSNITFGTNQSGISPGFYQSLDA 120

Query: 99  IATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFA 158
           +A ++N++  T ++I+ HTDS G    N+ +S++RA+ +KSYL++  V++ R + V G+ 
Sbjct: 121 VARVMNEYDKTFLSIEGHTDSTGDAAYNMTLSEKRAESVKSYLLRSAVNAKR-LYVTGYG 179

Query: 159 YKYPIDTNDTKVGRQNNQRIEIQIFPR 185
              PI +NDT  GR  N+R+EIQI P 
Sbjct: 180 ETQPIASNDTSTGRAQNRRVEIQIVPN 206


>gi|237703321|ref|ZP_04533802.1| OmpA family protein [Escherichia sp. 3_2_53FAA]
 gi|226902585|gb|EEH88844.1| OmpA family protein [Escherichia sp. 3_2_53FAA]
 gi|315285303|gb|EFU44748.1| OmpA family protein [Escherichia coli MS 110-3]
 gi|323954903|gb|EGB50683.1| OmpA family protein [Escherichia coli H263]
          Length = 219

 Score =  134 bits (338), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 53/180 (29%), Positives = 93/180 (51%), Gaps = 2/180 (1%)

Query: 6   GLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVV 65
           GL   +   I     + +++ K  L  +     +    G  +D  E + + +++ TG+ V
Sbjct: 40  GLGSLVGAGIGALSSSKKDRGKGALIGAAAGTALGGGVGYYMDVQEAKLRDKMRGTGVSV 99

Query: 66  SRIGDMITCYIPVHVSFVSEV-FLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLK 124
           +R GD I   +P +V+F S    L+      L  +A +L ++P T + +  +TDS G+  
Sbjct: 100 TRSGDNIILNMPNNVTFDSSSATLKPAGANTLTGVAMVLKEYPKTAVNVIGYTDSTGSHD 159

Query: 125 NNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
            N+ +SQ+RAD + S LI +GV ++R I  +G     PI +N T  G+  N+R+EI + P
Sbjct: 160 LNMRLSQQRADSVASALITQGVDASR-IRTQGLGPANPIASNSTAEGKAQNRRVEITLSP 218


>gi|221640526|ref|YP_002526788.1| OmpA/MotB domain-containing protein [Rhodobacter sphaeroides KD131]
 gi|221161307|gb|ACM02287.1| OmpA/MotB domain protein precursor [Rhodobacter sphaeroides KD131]
          Length = 228

 Score =  134 bits (338), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 45/176 (25%), Positives = 78/176 (44%), Gaps = 3/176 (1%)

Query: 10  FIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIG 69
            I+  + G   AS  K +  +  +    I+    GS+LD+   + +  + ++ + V+  G
Sbjct: 53  AILGGLVG-ASASDNKLEKAVVGAAVGGILGGAVGSALDRQAADLRNSIGNSQVSVTNTG 111

Query: 70  DMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLL 128
             +   +P  + F      L       L  +A  L ++P++ IA+  HTDS G+   N  
Sbjct: 112 SELVVTMPQDILFATDSANLRPDLQRDLGAVAQNLLRYPNSTIAVVGHTDSTGSAAYNQD 171

Query: 129 ISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           +S  RA  +   LI      +  +S  G     PI +N T  GR  N+R++I I P
Sbjct: 172 LSMRRAQSVAGVLIGN-GVPSYRVSAIGRGEDQPIASNLTPEGRAQNRRVDIIIRP 226


>gi|225024888|ref|ZP_03714080.1| hypothetical protein EIKCOROL_01776 [Eikenella corrodens ATCC
           23834]
 gi|224942346|gb|EEG23555.1| hypothetical protein EIKCOROL_01776 [Eikenella corrodens ATCC
           23834]
          Length = 219

 Score =  134 bits (338), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 56/213 (26%), Positives = 95/213 (44%), Gaps = 30/213 (14%)

Query: 1   MIKELG-LSMFIMTTISGCGLASREKK---------------------------KVFLHK 32
           M+K L  L++     ++GC       +                           K   + 
Sbjct: 1   MMKRLTVLTLAATFALNGCVTDPVTGQQTISKTALFGLGGAAACGAVGALTHGSKGARNA 60

Query: 33  SNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKK 91
           +    +V    G+ +D  E+  + +L +T + V R GD I   +P  V+F  +   L   
Sbjct: 61  ALGCGVVGAGVGAYMDVQENRLRQELANTPVEVQRQGDQIKLTMPSGVTFATNSSSLSPD 120

Query: 92  FLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRF 151
            +  L  +A +L ++P T I +  HTD+ G  + N  +S+ RA  +  YL  RGV+++R 
Sbjct: 121 AVNSLNTVANVLTQYPETTITVAGHTDNTGNDRINNPLSKNRARSVAGYLTGRGVAASR- 179

Query: 152 ISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           IS  G+  + P+  N T+ GR  N+R+EI I P
Sbjct: 180 ISTVGYGSRSPVADNSTESGRAQNRRVEILINP 212


>gi|256819127|ref|YP_003140406.1| OmpA/MotB domain-containing protein [Capnocytophaga ochracea DSM
           7271]
 gi|256580710|gb|ACU91845.1| OmpA/MotB domain protein [Capnocytophaga ochracea DSM 7271]
          Length = 230

 Score =  134 bits (338), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 43/223 (19%), Positives = 88/223 (39%), Gaps = 37/223 (16%)

Query: 1   MIKELGLSMFIMTTISGCGLASREKKK------------------------------VFL 30
           M K + L++     ++GC   +   K                                 +
Sbjct: 1   MKKIVVLALSAAVLLTGCEAYNNSNKAQRGAVIGAAGGALLGAILGNNVGNGQNSELGAV 60

Query: 31  HKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVH----VSFVSEV 86
             +          G+ +DK   + + ++   G  V R+ D I      +        ++ 
Sbjct: 61  LGTVVGGAAGAVIGNQMDKQAKKIEEEIP--GADVKRVDDGIVVTFDENNGGVYFDTNKY 118

Query: 87  FLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGV 146
            +  K    L  ++ IL ++P T + +  HTD++G  + NL +SQ RA  + +Y   +G+
Sbjct: 119 NINNKSRQTLDKLSAILKEYPDTNVIVAGHTDNVGKDEYNLGLSQRRAQAVTNYFKSKGL 178

Query: 147 SSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGNIK 189
             +R  + + +  + P+ +N+T  GR  N+R+ + I P   +K
Sbjct: 179 VGSR-FTTKWYGERNPVASNETADGRAKNRRVNVVIVPNEKMK 220


>gi|119472020|ref|ZP_01614278.1| putative lipoprotein [Alteromonadales bacterium TW-7]
 gi|119445155|gb|EAW26447.1| putative lipoprotein [Alteromonadales bacterium TW-7]
          Length = 210

 Score =  134 bits (338), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 61/204 (29%), Positives = 96/204 (47%), Gaps = 22/204 (10%)

Query: 3   KELGLSMFIMTTISGCGL--------------------ASREKKKVFLHKSNDTDIVNKR 42
           K L     +   +SGC +                        K K     +    +    
Sbjct: 5   KSLLSVTVVAVLLSGCEMNNTGKGAAIGAAAGGVLGKATGNHKDKRIFIGAAIGALAGAA 64

Query: 43  FGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIAT 101
            G  +DK E+ F+ +L  +G+ V R GD +   IP +++F   + ++   F   L  IA 
Sbjct: 65  VGDYMDKQEEAFRDELAGSGVEVVREGDNLRLVIPSNITFATDQSYISTGFNDTLNAIAK 124

Query: 102 ILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKY 161
           ++NK+  T ++++ HTDS G    N+ +S+ERA  +K+YL  + + + R IS  GF    
Sbjct: 125 VMNKYEKTYLSVEGHTDSTGQDSYNMNLSRERAQSVKAYLANQDIMAAR-ISTSGFGETR 183

Query: 162 PIDTNDTKVGRQNNQRIEIQIFPR 185
           PI TNDT  GR  N+R+EIQI P 
Sbjct: 184 PIATNDTANGRAQNRRVEIQIVPN 207


>gi|77464614|ref|YP_354118.1| OmpA family protein [Rhodobacter sphaeroides 2.4.1]
 gi|126463454|ref|YP_001044568.1| OmpA/MotB domain-containing protein [Rhodobacter sphaeroides ATCC
           17029]
 gi|332559507|ref|ZP_08413829.1| OmpA/MotB domain-containing protein [Rhodobacter sphaeroides WS8N]
 gi|77389032|gb|ABA80217.1| OmpA family protein [Rhodobacter sphaeroides 2.4.1]
 gi|126105118|gb|ABN77796.1| OmpA/MotB domain protein [Rhodobacter sphaeroides ATCC 17029]
 gi|332277219|gb|EGJ22534.1| OmpA/MotB domain-containing protein [Rhodobacter sphaeroides WS8N]
          Length = 228

 Score =  134 bits (337), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 45/176 (25%), Positives = 77/176 (43%), Gaps = 3/176 (1%)

Query: 10  FIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIG 69
            I+  + G   AS  K +  +  +    I+    GS+LD+   + +  + ++ + V+  G
Sbjct: 53  AILGGLVG-ASASDNKLEKAVVGAAVGGILGGAVGSALDRQAADLRNSIGNSQVSVTNTG 111

Query: 70  DMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLL 128
             +   +P  + F      L       L  +A  L ++P++ IA+  HTDS G    N  
Sbjct: 112 SELVVTMPQDILFATDSANLRPDLQRDLGAVAQNLLRYPNSTIAVVGHTDSTGAAAYNQD 171

Query: 129 ISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           +S  RA  +   LI      +  +S  G     PI +N T  GR  N+R++I I P
Sbjct: 172 LSMRRAQSVAGVLIGN-GVPSYRVSAIGRGEDQPIASNLTPEGRAQNRRVDIIIRP 226


>gi|294678012|ref|YP_003578627.1| OmpA family protein [Rhodobacter capsulatus SB 1003]
 gi|294476832|gb|ADE86220.1| OmpA family protein [Rhodobacter capsulatus SB 1003]
          Length = 224

 Score =  134 bits (337), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 46/185 (24%), Positives = 82/185 (44%), Gaps = 2/185 (1%)

Query: 2   IKELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDT 61
           ++   ++  ++  + G      EK +     +    ++    G+ LDK   E +  L   
Sbjct: 40  MRGGAITGALIGGVLGATSNGDEKLEKAAAGAIVGGLIGGAIGNQLDKQAQELRRDLDTN 99

Query: 62  GIVVSRIGDMITCYIPVHVSFV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSI 120
           G+ V R G+ +   +P  V F      +       L  ++  LN++P T + +  HTDS 
Sbjct: 100 GVSVVRQGNQLIVTMPQDVLFAVDSAAVRPDLQRDLYTLSGSLNRYPDTTVDVVGHTDSD 159

Query: 121 GTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEI 180
           G    N  +SQ+RA+ +   LI  GV S R +   G   + P+ +N +  G+  N+R+E 
Sbjct: 160 GDAAYNQRLSQDRANAVARILIGAGVPSYRVV-AYGRGEEQPVASNLSAAGKAQNRRVEF 218

Query: 181 QIFPR 185
            I P 
Sbjct: 219 IIRPN 223


>gi|220933311|ref|YP_002512210.1| OmpA/MotB domain protein [Thioalkalivibrio sp. HL-EbGR7]
 gi|219994621|gb|ACL71223.1| OmpA/MotB domain protein [Thioalkalivibrio sp. HL-EbGR7]
          Length = 218

 Score =  134 bits (337), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 54/217 (24%), Positives = 103/217 (47%), Gaps = 35/217 (16%)

Query: 2   IKELGLSMFIMTTI--SGCGL-------------------------------ASREKKKV 28
           +K+  L + + + +  +GC                                  SR++ + 
Sbjct: 1   MKKSLLVLALASVVGFTGCTTLDPYTGEQRTSRATQGALIGAAAGAVIGNVTGSRDRTRR 60

Query: 29  FLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV-SEVF 87
            +  +    +     G+ +D+ E E + +L+ TG+ V+R GD +   +P +++F  +   
Sbjct: 61  AMIGAGIGALAGAAVGNYMDQQEAELRRELEGTGVSVTRDGDNLILNMPGNITFDVNRDE 120

Query: 88  LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVS 147
           ++ +F P+L  +A +L K+  T I +  HTDS GT+++N+ +S  RAD +  YL+ +   
Sbjct: 121 VKSEFYPVLNSVAKVLKKYDKTAIEVAGHTDSTGTVEHNMALSLRRADSVAGYLLGQ-GI 179

Query: 148 SNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
            N  I+  GF    PI  N+T  GR  N+R+E+ + P
Sbjct: 180 QNVRIATIGFGPHRPIADNNTAQGRSLNRRVELTLIP 216


>gi|304311338|ref|YP_003810936.1| Putative outer membrane protein [gamma proteobacterium HdN1]
 gi|301797071|emb|CBL45284.1| Putative outer membrane protein [gamma proteobacterium HdN1]
          Length = 208

 Score =  134 bits (336), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 51/208 (24%), Positives = 93/208 (44%), Gaps = 25/208 (12%)

Query: 1   MIKELGLSMFIMTTISGCGL---ASREKKKVFLHKSNDTDIVNKRFGS------------ 45
           M K++   +     ++GC         K       +    ++     S            
Sbjct: 1   MKKQIVAMLVGSLLLAGCTTDPYTGESKVSKAAIGAGVGAVLGAAVSSKKDRAKGAAIGA 60

Query: 46  --------SLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSE-VFLEKKFLPML 96
                     D+ E + +  L +TG+ V+R  + I   +P  +SF S    L   F P+L
Sbjct: 61  ALGGGTGVYFDRQEAKLRETLNNTGVSVTRTPEGIKLNMPGAISFPSNQSGLMPSFYPVL 120

Query: 97  QLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRG 156
           + +A +L +F +T I +  HTDS G  + N  +S++RA+ + ++L  +GV+  R   V G
Sbjct: 121 ESVALVLKEFNNTAIKVSGHTDSTGGAELNQRLSEQRAESVAAFLSGQGVARARM-QVYG 179

Query: 157 FAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           +  +YP+  N ++ G+  N+R+EI I  
Sbjct: 180 YGPRYPVADNKSEAGKAANRRVEIDILN 207


>gi|307293986|ref|ZP_07573830.1| OmpA/MotB domain protein [Sphingobium chlorophenolicum L-1]
 gi|306880137|gb|EFN11354.1| OmpA/MotB domain protein [Sphingobium chlorophenolicum L-1]
          Length = 226

 Score =  134 bits (336), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 43/140 (30%), Positives = 73/140 (52%), Gaps = 2/140 (1%)

Query: 46  SLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILN 104
            +D  E + + Q   +G+ V R GD +   +P  ++F      ++ +F P L  +A++L 
Sbjct: 80  YMDAQEKKLREQTAGSGVDVIRDGDNLVLRMPSGITFATDSSAVQPQFQPTLNDVASVLA 139

Query: 105 KFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPID 164
           ++P T I +  HTDS GT   N  +S+ RA  +    +      +  I+ RGF    PI 
Sbjct: 140 QYPKTYIDVYGHTDSDGTDVYNQGLSERRAQAVGD-YLTSHGVQSARIATRGFGETQPIA 198

Query: 165 TNDTKVGRQNNQRIEIQIFP 184
           +N T  G+ +N+R+EI+I P
Sbjct: 199 SNATAEGKASNRRVEIKIAP 218


>gi|315224547|ref|ZP_07866374.1| OmpA family protein [Capnocytophaga ochracea F0287]
 gi|314945568|gb|EFS97590.1| OmpA family protein [Capnocytophaga ochracea F0287]
          Length = 230

 Score =  133 bits (335), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 43/223 (19%), Positives = 90/223 (40%), Gaps = 37/223 (16%)

Query: 1   MIKELGLSMFIMTTISGCGLASREKKK------------------------------VFL 30
           M K + L++ +   ++GC   +   K                                 +
Sbjct: 1   MKKIVVLALSVAVLLTGCEAYNNSNKAQRGAVIGAAGGALLGAILGNNVGNGQNSELGAV 60

Query: 31  HKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVH----VSFVSEV 86
             +          G+ +DK   + + ++   G  V R+ D I      +        ++ 
Sbjct: 61  LGTVVGGAAGAVIGNQMDKQAKKIEEEIP--GADVKRVDDGIVVTFDENNGGVYFDTNKY 118

Query: 87  FLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGV 146
            +  K    L  ++ IL ++P T + +  HTD++G  + NL +SQ RA  + +Y   +G+
Sbjct: 119 NINNKSRQTLDKLSAILKEYPDTNVIVAGHTDNVGKDEYNLGLSQRRAQAVTNYFKSKGL 178

Query: 147 SSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGNIK 189
           + +R  + + +  + P+ +N+T  GR  N+R+ + I P   +K
Sbjct: 179 AGSR-FTTKWYGERNPVASNETADGRAKNRRVNVVIVPNEKMK 220


>gi|294012887|ref|YP_003546347.1| OmpA-family protein [Sphingobium japonicum UT26S]
 gi|292676217|dbj|BAI97735.1| OmpA-family protein [Sphingobium japonicum UT26S]
          Length = 226

 Score =  133 bits (335), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 42/140 (30%), Positives = 73/140 (52%), Gaps = 2/140 (1%)

Query: 46  SLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILN 104
            +D  E + + +   +G+ V R GD +   +P  ++F      ++ +F P L  +A++L 
Sbjct: 80  YMDAQERKLREETAGSGVDVIRDGDNLVLRMPSGITFATDSSAVQPQFQPTLNDVASVLA 139

Query: 105 KFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPID 164
           ++P T I +  HTDS GT   N  +S+ RA  +    +      +  I+ RGF    PI 
Sbjct: 140 QYPKTYIDVYGHTDSDGTDTYNQALSERRAQAVGD-YLTTHGVQSARIATRGFGETQPIA 198

Query: 165 TNDTKVGRQNNQRIEIQIFP 184
           +N T  G+ +N+R+EI+I P
Sbjct: 199 SNATAEGKASNRRVEIKIAP 218


>gi|257463423|ref|ZP_05627818.1| Outer membrane porin F [Fusobacterium sp. D12]
 gi|317060987|ref|ZP_07925472.1| outer membrane porin F [Fusobacterium sp. D12]
 gi|313686663|gb|EFS23498.1| outer membrane porin F [Fusobacterium sp. D12]
          Length = 193

 Score =  133 bits (335), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 43/186 (23%), Positives = 80/186 (43%), Gaps = 10/186 (5%)

Query: 1   MIKELGLSMFIM-TTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQL- 58
           M K LG+++ +    ++ CG  S    +    + N    +       +D A+   +  + 
Sbjct: 11  MKKYLGMTVLLASFVLAACGKTSNTSVRDLSTEGNQNFAI-----EDIDTAKKPLEDIIV 65

Query: 59  -QDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSH 116
               G+ + R G+ +   +P  + F   +  ++    P L+ +A  L       I I  +
Sbjct: 66  FNQDGVTIRREGNNLILSMPELILFDFDKYEVKDGIKPSLRTLANALGANSDIKIKIDGY 125

Query: 117 TDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQ 176
           TD IG+   NL +S  RA  I    +    +    IS+ G+  + P+ +N T+ GR  N+
Sbjct: 126 TDFIGSEGYNLELSVNRAKAI-KSYLVNHGAIENNISIEGYGKQNPVASNATESGRARNR 184

Query: 177 RIEIQI 182
           R+E  I
Sbjct: 185 RVEFII 190


>gi|90022262|ref|YP_528089.1| OmpA family protein [Saccharophagus degradans 2-40]
 gi|89951862|gb|ABD81877.1| OmpA/MotB [Saccharophagus degradans 2-40]
          Length = 225

 Score =  133 bits (335), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 54/183 (29%), Positives = 103/183 (56%), Gaps = 2/183 (1%)

Query: 3   KELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTG 62
           K  G+       I     + +++ +  +  +     +    G  +DK E E + QLQ TG
Sbjct: 42  KGAGIGAVTGAIIGAATSSDKDRDRGIITGAVAGAAIGGGVGYYMDKQEAELRHQLQGTG 101

Query: 63  IVVSRIGDMITCYIPVHVSFVS-EVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIG 121
           + V R G+ +   +P +++F + +  +  +F  +L  +A +L K+  T I +  HTD+ G
Sbjct: 102 VQVRREGNNLFLVMPGNITFDTAQYSIRSQFYEVLDSVAVVLKKYDKTAILVSGHTDNRG 161

Query: 122 TLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQ 181
           +   N  +S++RA  +K+YL+Q+GV++ R  SV G+ Y+YP+ +ND+  GR+ N+R+E++
Sbjct: 162 SSDYNQTLSEQRAGSVKAYLMQKGVAAGRVNSV-GYGYRYPVASNDSAAGREQNRRVELK 220

Query: 182 IFP 184
           + P
Sbjct: 221 LEP 223


>gi|260599847|ref|YP_003212418.1| putative outer membrane lipoprotein [Cronobacter turicensis z3032]
 gi|260219024|emb|CBA34379.1| Inner membrane lipoprotein yiaD [Cronobacter turicensis z3032]
          Length = 220

 Score =  133 bits (335), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 51/219 (23%), Positives = 89/219 (40%), Gaps = 36/219 (16%)

Query: 1   MIKELGLSMFI---MTTISGCGLASREKKKVFL---HKSNDTDIVNKRFG---------- 44
           M K +     I      +SGC       ++        +    +V    G          
Sbjct: 1   MKKRIIFVAAIVSGALALSGCTTNPYTGEREAGKSGIGAGIGSLVGAGVGVLSSSKKDRG 60

Query: 45  ------------------SSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSE- 85
                               +D  E + + ++Q TG+ V+R GD I   +P +V+F S  
Sbjct: 61  KGALIGAAAGAALGGGVGYYMDVQEAKLRQKMQGTGVSVTRSGDNIILNMPNNVTFDSSQ 120

Query: 86  VFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRG 145
             L+      L  +A +L ++P T + +  +TDS G    N+ +SQ+RA+ + S LI + 
Sbjct: 121 ANLKPAGANTLTGVAMVLKEYPKTAVNVVGYTDSTGGQALNMKLSQQRAESVASALITQ- 179

Query: 146 VSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
             +   I   G     P+ +N T+ G+  N+R+EI + P
Sbjct: 180 GVAANRIRTSGMGPANPVASNSTEEGKAQNRRVEITLSP 218


>gi|192360671|ref|YP_001983282.1| OmpA family protein [Cellvibrio japonicus Ueda107]
 gi|190686836|gb|ACE84514.1| OmpA family protein [Cellvibrio japonicus Ueda107]
          Length = 217

 Score =  133 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 52/219 (23%), Positives = 104/219 (47%), Gaps = 36/219 (16%)

Query: 2   IKELGLSMFIMTTISGCGLAS---------------------------------REKKKV 28
           +K + +++ +  T+ GC                                     +++++ 
Sbjct: 1   MKYI-IALLLSFTMIGCTTTDPYTGEQKTSKTAKGAGIGAVAGAVLGAATGDNAKDRRER 59

Query: 29  FLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEV-F 87
            L  +    ++    G+ +D+ E + + +LQ TG+ V R G+ +   +P +++F +    
Sbjct: 60  ALKGAAIGGVIGGGVGNYMDRQEAKLRAELQGTGVQVRREGNNLYLIMPGNITFATSSAD 119

Query: 88  LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVS 147
           +   F P+L  +A ++ +F  T I +  HTDS G+   N  +S+ RAD +  YL  + V+
Sbjct: 120 IRSDFFPVLNSVAKVVAEFNQTSIRVTGHTDSTGSDSINQPLSERRADSVAMYLRSQKVA 179

Query: 148 SNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRG 186
           S R I   G+  +YP+ +NDT  GR+ N+R+E+++ P  
Sbjct: 180 SAR-IQAYGYGSRYPVASNDTPTGREQNRRVELELIPNE 217


>gi|262394500|ref|YP_003286354.1| outer membrane protein [Vibrio sp. Ex25]
 gi|262338094|gb|ACY51889.1| outer membrane protein [Vibrio sp. Ex25]
          Length = 222

 Score =  133 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 51/221 (23%), Positives = 98/221 (44%), Gaps = 39/221 (17%)

Query: 2   IKELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFG----------------- 44
           +K++ +++ ++  ++GC    R+      +++N T                         
Sbjct: 1   MKKMPIALALVLALTGCQATQRQNATTGEYETNSTTQGALIGAIAGAAIGLATGDDAKER 60

Query: 45  -------------------SSLDKAEDEFQMQLQDTGIVVSRIG-DMITCYIPVHVSFVS 84
                                 D+ E E +  L ++G+ V R+G + +   +   + F S
Sbjct: 61  RQHALIGAAAGGATGAGVGYYFDQQEAELRRALLNSGVQVQRVGENQLLLRMENGIGFSS 120

Query: 85  EVF-LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQ 143
             + L+      L+ +A IL ++P T + I  +TDS G+   N  +S+ RA+ ++ +L+ 
Sbjct: 121 SSYQLDASIHNTLRGVARILVEYPDTSLVIDGYTDSTGSESYNQTLSERRAESVRQFLVS 180

Query: 144 RGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           + V+  R I  RG+  + PI +N T  GR  N+R+EIQI P
Sbjct: 181 QNVAPGRAI-ARGYGERNPICSNQTSEGRACNRRVEIQILP 220


>gi|156936282|ref|YP_001440198.1| putative outer membrane lipoprotein [Cronobacter sakazakii ATCC
           BAA-894]
 gi|156534536|gb|ABU79362.1| hypothetical protein ESA_04181 [Cronobacter sakazakii ATCC BAA-894]
          Length = 220

 Score =  133 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 50/219 (22%), Positives = 89/219 (40%), Gaps = 36/219 (16%)

Query: 1   MIKELGLSMFI---MTTISGCGLASREKKKVFL---HKSNDTDIVNKRFG---------- 44
           M K +     +      +SGC       ++        +    +V    G          
Sbjct: 1   MKKRIIFVAAMVSGALALSGCTTNPYTGEREAGKSGIGAGIGSLVGAGVGVLSSSKKDRG 60

Query: 45  ------------------SSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSE- 85
                               +D  E + + ++Q TG+ V+R GD I   +P +V+F S  
Sbjct: 61  KGALIGAAAGAALGGGVGYYMDVQEAKLRQKMQGTGVSVTRSGDNIILNMPNNVTFDSSQ 120

Query: 86  VFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRG 145
             L+      L  +A +L ++P T + +  +TDS G    N+ +SQ+RA+ + S LI + 
Sbjct: 121 ANLKPAGANTLTGVAMVLKEYPKTAVNVVGYTDSTGGQALNMKLSQQRAESVASALITQ- 179

Query: 146 VSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
             +   I   G     P+ +N T+ G+  N+R+EI + P
Sbjct: 180 GVAANRIRTSGMGPANPVASNSTEEGKAQNRRVEITLSP 218


>gi|126736820|ref|ZP_01752555.1| OmpA domain protein [Roseobacter sp. SK209-2-6]
 gi|126721405|gb|EBA18108.1| OmpA domain protein [Roseobacter sp. SK209-2-6]
          Length = 205

 Score =  133 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 37/166 (22%), Positives = 73/166 (43%), Gaps = 2/166 (1%)

Query: 22  SREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVS 81
             ++    +  +          G+ LD  E E +  L +  I +   GD +    P  ++
Sbjct: 40  DSDRGLGAVTGALVGATAGGVIGNQLDAQERELRQSLANDSISIVNTGDRLILSFPNDLT 99

Query: 82  F-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSY 140
           F      +       L+ +A  L ++P++ + +  HTDS G    N  +S+ RA+ +   
Sbjct: 100 FATDSAAISPVVQADLRSVAGSLVRYPNSTVQVIGHTDSDGDASYNQGLSERRANAVADQ 159

Query: 141 LIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRG 186
           +   GV  +R + + G   + P+ +N T  G+  N+R+E+ I P+ 
Sbjct: 160 IQAGGVPYHR-LRIIGLGEEQPVASNLTPEGKARNRRVEVVIIPQA 204


>gi|168260613|ref|ZP_02682586.1| inner membrane lipoprotein YiaD [Salmonella enterica subsp.
           enterica serovar Hadar str. RI_05P066]
 gi|205350258|gb|EDZ36889.1| inner membrane lipoprotein YiaD [Salmonella enterica subsp.
           enterica serovar Hadar str. RI_05P066]
          Length = 220

 Score =  133 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 55/219 (25%), Positives = 95/219 (43%), Gaps = 36/219 (16%)

Query: 1   MIKELGLSMFI---MTTISGCGLASREKKKVFL---HKSNDTDIVNKRFGS--------- 45
           M K + +   I      +SGC       ++        +    +V    G+         
Sbjct: 1   MKKRVFVIAAIVSGALAVSGCTTNPYTGEREAGKSGIGAGIGSLVGAGIGALSSSKKDRG 60

Query: 46  -------------------SLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEV 86
                               +D  E + + +++ TG+ V+R GD I   +P +V+F S  
Sbjct: 61  KGALIGAAAGAALGGGVGYYMDVQEAKLRDKMRGTGVSVTRSGDNIILNMPNNVTFDSSS 120

Query: 87  -FLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRG 145
             L+      L  +A +L ++P T + +  +TDS G+   N+ +SQ+RAD + S LI +G
Sbjct: 121 ATLKPAGADTLTGVAMVLKEYPKTAVNVVGYTDSTGSHDLNMRLSQQRADSVASSLITQG 180

Query: 146 VSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           V ++R I   G     PI +N T  G+  N+R+EI + P
Sbjct: 181 VDASR-IRTSGMGPANPIASNSTAEGKAQNRRVEITLSP 218


>gi|28898041|ref|NP_797646.1| putative lipoprotein [Vibrio parahaemolyticus RIMD 2210633]
 gi|308094661|ref|ZP_05890745.2| outer membrane protein [Vibrio parahaemolyticus AN-5034]
 gi|308095662|ref|ZP_05907484.2| outer membrane protein [Vibrio parahaemolyticus Peru-466]
 gi|308125455|ref|ZP_05775378.2| outer membrane protein [Vibrio parahaemolyticus K5030]
 gi|308126686|ref|ZP_05911817.2| outer membrane protein [Vibrio parahaemolyticus AQ4037]
 gi|28806255|dbj|BAC59530.1| putative lipoprotein [Vibrio parahaemolyticus RIMD 2210633]
 gi|308088657|gb|EFO38352.1| outer membrane protein [Vibrio parahaemolyticus Peru-466]
 gi|308091164|gb|EFO40859.1| outer membrane protein [Vibrio parahaemolyticus AN-5034]
 gi|308107632|gb|EFO45172.1| outer membrane protein [Vibrio parahaemolyticus AQ4037]
 gi|308115580|gb|EFO53120.1| outer membrane protein [Vibrio parahaemolyticus K5030]
          Length = 222

 Score =  133 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 51/221 (23%), Positives = 98/221 (44%), Gaps = 39/221 (17%)

Query: 2   IKELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFG----------------- 44
           +K++ +++ ++  ++GC    R+      +++N T                         
Sbjct: 1   MKKMSIALALVLALTGCQATQRQNATTGEYETNSTTQGALIGAIAGAAIGLATGDNAKER 60

Query: 45  -------------------SSLDKAEDEFQMQLQDTGIVVSRIG-DMITCYIPVHVSFVS 84
                                 D+ E E +  L ++G+ V R+G + +   +   + F S
Sbjct: 61  RKHALIGAAAGGATGAGVGYYFDQQEAELRRALLNSGVQVQRVGENQLLLRMENGIGFSS 120

Query: 85  EVF-LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQ 143
             + L+      L+ +A IL ++P T + I  +TDS G+   N  +S+ RA+ ++ +L+ 
Sbjct: 121 SSYQLDASIHNTLRGVARILVEYPDTSLVIDGYTDSTGSESYNQTLSERRAESVRQFLVS 180

Query: 144 RGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           + V+  R I  RG+  + PI +N T  GR  N+R+EIQI P
Sbjct: 181 QKVAPGRAI-ARGYGERNPICSNQTSEGRACNRRVEIQILP 220


>gi|320182069|gb|EFW56974.1| Outer membrane protein A precursor [Shigella boydii ATCC 9905]
          Length = 219

 Score =  133 bits (334), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 55/219 (25%), Positives = 94/219 (42%), Gaps = 36/219 (16%)

Query: 1   MIKELGLSMFI---MTTISGCGLASRE---KKKVFLHKSNDTDIVNKRFGS--------- 45
           M K + L   +      +SGC         +       +    +V    G+         
Sbjct: 1   MKKRVYLIAAVVSGALAVSGCTTTPYTGERETGKSAIGAGLGSLVGAGIGALSSSKKDRG 60

Query: 46  -------------------SLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEV 86
                               +D  E + + +++ TG+ V+R GD I   +P +V+F S  
Sbjct: 61  KGALIGAAAGAALGGGMGYYMDVQEAKLRDKMRGTGVSVTRSGDNIILNMPNNVTFDSSS 120

Query: 87  -FLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRG 145
             L+      L  +A +L ++P T + +  +TDS G    N+ +SQ+RAD + S LI +G
Sbjct: 121 ATLKPAGANTLTGVAMVLKEYPKTAVNVIGYTDSTGGHDLNMRLSQQRADSVASALITQG 180

Query: 146 VSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           V ++R I  +G     PI +N T  G+  N+R+EI + P
Sbjct: 181 VDASR-IRTQGLGPANPIASNSTAEGKAQNRRVEITLSP 218


>gi|237738475|ref|ZP_04568956.1| outer membrane porin F [Fusobacterium mortiferum ATCC 9817]
 gi|229420355|gb|EEO35402.1| outer membrane porin F [Fusobacterium mortiferum ATCC 9817]
          Length = 185

 Score =  133 bits (334), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 49/188 (26%), Positives = 93/188 (49%), Gaps = 6/188 (3%)

Query: 2   IKELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDT 61
           +K++ + + ++  I+GC     + K++   K ++T  + +   ++    ED       + 
Sbjct: 1   MKKIFMVLSLVGVIAGCTSTQGQFKEIT-IKESETQYILEDVTTTEKPLEDII--VFNEE 57

Query: 62  GIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSI 120
           G+V+ + G+ +   +PV + F      +++     L  +   L +     + I  HTD I
Sbjct: 58  GVVIRKDGNNLVLSMPVEILFDFDSSKVKEGVKESLNTLGKALAENKDIKLKIDGHTDYI 117

Query: 121 GTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEI 180
           GT + NL +S +RA+ IK+YLI R   S   IS+ G+  + P+  N T+ GR  N+R+E 
Sbjct: 118 GTEQYNLNLSLKRANSIKNYLIGR-GVSANNISIEGYGKQNPVANNSTEAGRAKNRRVEF 176

Query: 181 QIFPRGNI 188
            I  R  +
Sbjct: 177 -IISRDKV 183


>gi|114800290|ref|YP_762003.1| OmpA family protein [Hyphomonas neptunium ATCC 15444]
 gi|114740464|gb|ABI78589.1| OmpA family protein [Hyphomonas neptunium ATCC 15444]
          Length = 211

 Score =  133 bits (334), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 50/209 (23%), Positives = 83/209 (39%), Gaps = 26/209 (12%)

Query: 1   MIKELGLSMFIMT-TISGCGLASR-----------------------EKKKVFLHKSNDT 36
           M   + ++  +M   +  C                            + K+     +   
Sbjct: 1   MKTSVLIAAALMLPLVQACETGPSQRVLTTGAAGAILGAGAGMMAGGDDKRNAAIGAAVG 60

Query: 37  DIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV-SEVFLEKKFLPM 95
            +     G  +D+ E++ + Q   TGI V R GD I   +P  +SF      ++  F   
Sbjct: 61  AVAGASVGVYMDRQEEKLRQQTAGTGIEVERQGDQIALTMPSGISFQQGSAQIQPAFYQT 120

Query: 96  LQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVR 155
           L  +A  LN++PST + I+ H  S G    N  +SQ+RAD +    +         +S  
Sbjct: 121 LNDVAATLNEYPSTAVDIRGHASSEGARDFNQRLSQQRADAV-RSYLTNQGVQGVRMSAV 179

Query: 156 GFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           G    YP+  N T+ GR  N+R+EI + P
Sbjct: 180 GMGIDYPVADNSTEAGRSQNRRVEIILTP 208


>gi|167990874|ref|ZP_02571973.1| inner membrane lipoprotein YiaD [Salmonella enterica subsp.
           enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|205330659|gb|EDZ17423.1| inner membrane lipoprotein YiaD [Salmonella enterica subsp.
           enterica serovar 4,[5],12:i:- str. CVM23701]
          Length = 220

 Score =  132 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 55/219 (25%), Positives = 95/219 (43%), Gaps = 36/219 (16%)

Query: 1   MIKELGLSMFI---MTTISGCGLASREKKKVFL---HKSNDTDIVNKRFGS--------- 45
           M K + +   I      +SGC       ++        +    +V    G+         
Sbjct: 1   MKKRVFVIAAIVSGALAVSGCTTNPYTGEREAGKSGIGAGIGSLVGAGIGAFSSSKKDRG 60

Query: 46  -------------------SLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEV 86
                               +D  E + + +++ TG+ V+R GD I   +P +V+F S  
Sbjct: 61  KGALIGAAAGAALGGGVGYYMDVQEAKLRDKMRGTGVSVTRSGDNIILNMPNNVTFDSSS 120

Query: 87  -FLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRG 145
             L+      L  +A +L ++P T + +  +TDS G+   N+ +SQ+RAD + S LI +G
Sbjct: 121 ATLKPAGANTLTGVAMVLKEYPKTAVNVVGYTDSTGSHDLNMRLSQQRADSVASSLITQG 180

Query: 146 VSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           V ++R I   G     PI +N T  G+  N+R+EI + P
Sbjct: 181 VDASR-IRTSGMGPANPIASNSTAEGKAQNRRVEITLSP 218


>gi|261856649|ref|YP_003263932.1| OmpA/MotB domain protein [Halothiobacillus neapolitanus c2]
 gi|261837118|gb|ACX96885.1| OmpA/MotB domain protein [Halothiobacillus neapolitanus c2]
          Length = 216

 Score =  132 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 54/215 (25%), Positives = 93/215 (43%), Gaps = 33/215 (15%)

Query: 2   IKELGLSMFIM--TTISGCG-----------------------------LASREKKKVFL 30
           +K+ G+    +  T ++GC                                S  K    L
Sbjct: 1   MKKFGMLGLAVGLTVLAGCAQNPYQGQYGKTAGGATIGAGIGALAGNLIAGSGNKTGGTL 60

Query: 31  HKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVS-EVFLE 89
             +     V    G+ +DK   + Q Q+ +TG+ V R GD I    P  ++F +    L+
Sbjct: 61  IGAAVGAGVGGLIGNQMDKQAAQLQQQMANTGVEVQRQGDGIHLQAPEAITFNTNSATLK 120

Query: 90  KKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSN 149
            +F+P+LQ +A  +N++P T++ ++ +TDS G+   N  +S  RA  + S  + +     
Sbjct: 121 PQFMPVLQQLAQSVNQYPGTIVRVEGNTDSTGSASYNQQLSLNRAQSVAS-ALSQYGVPY 179

Query: 150 RFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
             I   G+    PI +N T  GR  N+R++I I P
Sbjct: 180 NRIQAVGYGMTRPIASNATAAGRAQNRRVDILIVP 214


>gi|255067217|ref|ZP_05319072.1| OmpA family protein [Neisseria sicca ATCC 29256]
 gi|255048585|gb|EET44049.1| OmpA family protein [Neisseria sicca ATCC 29256]
          Length = 261

 Score =  132 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 50/185 (27%), Positives = 84/185 (45%), Gaps = 2/185 (1%)

Query: 4   ELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGI 63
           +  +       + G   A     K   + +     +    G  +D  E + +  L++T I
Sbjct: 69  KTAMYGLGGAAVCGIVGALTHGGKGARNSALACGAIGAGVGGYMDYQEKKLRENLKNTNI 128

Query: 64  VVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGT 122
            V R G+ I   +P +V+F      L  +    L   +  L ++P T + I  HTD+ G 
Sbjct: 129 EVERQGNQIKLVMPENVTFATGSAALSDQARNALATASETLVQYPDTTLTINGHTDNTGN 188

Query: 123 LKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
              N  +S+ RA  +  YL  RGV+ +R ++  G+  ++PI +N T  GR  N+R+EI I
Sbjct: 189 DAINEPLSRNRALAVADYLQSRGVNGSR-LTTAGYGSRHPIASNATAEGRAQNRRVEILI 247

Query: 183 FPRGN 187
            P  N
Sbjct: 248 NPDQN 252


>gi|259417844|ref|ZP_05741763.1| OmpA/MotB [Silicibacter sp. TrichCH4B]
 gi|259346750|gb|EEW58564.1| OmpA/MotB [Silicibacter sp. TrichCH4B]
          Length = 221

 Score =  132 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 43/169 (25%), Positives = 77/169 (45%), Gaps = 2/169 (1%)

Query: 20  LASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVH 79
            +  +K +  +  +    +     G  LDK E E +  L +  I +   GD +   +P  
Sbjct: 54  TSDDDKAETIIGTAAVGALAGGLIGRELDKQEAELRQSLDNDSISIVNTGDRLIVSLPND 113

Query: 80  VSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIK 138
           ++F      +       L+ +A  L ++P +V+ +  HTDS G    N  +S+ RA+ + 
Sbjct: 114 LTFATDSSAISSVVRSDLRKVAGSLQRYPGSVVQVIGHTDSDGAASYNYSLSERRANAVA 173

Query: 139 SYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGN 187
             +   GVS NR   + G     P+ +N T  G+  N+R+EI I P+ +
Sbjct: 174 DEIAAGGVSYNRM-RIIGRGEDQPVASNLTAEGKARNRRVEIVIIPQAS 221


>gi|209809526|ref|YP_002265064.1| outer membrane protein, OmpA family [Aliivibrio salmonicida
           LFI1238]
 gi|208011088|emb|CAQ81507.1| outer membrane protein, OmpA family [Aliivibrio salmonicida
           LFI1238]
          Length = 222

 Score =  132 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 51/221 (23%), Positives = 96/221 (43%), Gaps = 39/221 (17%)

Query: 2   IKELGLSMFIMTTISGC-------GLASREKKKVFLHKSNDTDIVNKRFG---------- 44
           +K++ +++ ++  ++GC             +       +    +     G          
Sbjct: 1   MKKITIALALLIGLTGCQATQRQNATTGETETNSATKGALAGILAGVAVGLATGDNAKER 60

Query: 45  -------------------SSLDKAEDEFQMQLQDTGIVVSRIGDM-ITCYIPVHVSFVS 84
                                 D  E   + +L+ +G+ V R+GD  +   +   V F S
Sbjct: 61  RKNALIGAAAGGAVGGGVGYYFDSQEQALRDELKSSGVQVERVGDNELKLIMDNGVGFQS 120

Query: 85  EVF-LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQ 143
             + L+      L  +A IL ++P T + I  HTDS G    N  +S++RA+ +++YLI+
Sbjct: 121 SSYQLDASIYNTLNGVARILVEYPDTALQIDGHTDSSGNDTKNQTLSEQRAESVRTYLIK 180

Query: 144 RGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           + V++ R ++ RG+  +YP+  N T  GR  N+R+EI I P
Sbjct: 181 QKVAAGR-VNARGYGERYPVFDNSTSQGRACNRRVEITILP 220


>gi|323491313|ref|ZP_08096498.1| putative outer membrane protein [Vibrio brasiliensis LMG 20546]
 gi|323314439|gb|EGA67518.1| putative outer membrane protein [Vibrio brasiliensis LMG 20546]
          Length = 222

 Score =  132 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 57/221 (25%), Positives = 99/221 (44%), Gaps = 39/221 (17%)

Query: 2   IKELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFG----------------- 44
           +K++ L++ +   +SGC    R+       ++N                           
Sbjct: 1   MKKITLALAVAIALSGCQATQRQNATTGETETNSATQGALIGAIAGAAVGLATGDDAKER 60

Query: 45  -------------------SSLDKAEDEFQMQLQDTGIVVSRIG-DMITCYIPVHVSFVS 84
                                 D+ E   + QL ++G+ V R+G + +   +   + F S
Sbjct: 61  RKHALIGAAGGAAVGGGVGYYFDQQEAALRKQLLNSGVQVERVGENQLLLRLENGIGFQS 120

Query: 85  EVF-LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQ 143
             + L+      L+ +A IL ++P T + I  HTDS G+   N ++S+ RA+ ++SYL+ 
Sbjct: 121 SSYQLDSSIHNTLRGVAQILVEYPDTSLVIDGHTDSTGSDTTNQVLSERRAESVRSYLVS 180

Query: 144 RGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           +GV++ R I  RG   +YP+ TN T  GR  N+R+EIQI P
Sbjct: 181 QGVAAGRAI-ARGNGERYPLCTNSTTEGRACNRRVEIQILP 220


>gi|262068012|ref|ZP_06027624.1| OmpA family protein [Fusobacterium periodonticum ATCC 33693]
 gi|291378280|gb|EFE85798.1| OmpA family protein [Fusobacterium periodonticum ATCC 33693]
          Length = 212

 Score =  132 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 48/163 (29%), Positives = 76/163 (46%), Gaps = 2/163 (1%)

Query: 23  REKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF 82
            +  K  L  +    ++   +G+  D    E +  L+ T   V   G+ +   +P  V+F
Sbjct: 49  GKDTKGTLIGAAVGSLLGMGWGAYKDNQARELKAALKGTQAEVRNDGNALVVNLPGGVTF 108

Query: 83  -VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYL 141
                 +   F   L  +A  L K+P T I +  +TDS G   +NL +SQ RA+ +  Y 
Sbjct: 109 ASDSANISSGFYSALNGVAQTLVKYPETRIQVNGYTDSTGGDAHNLDLSQRRANAVAQYF 168

Query: 142 IQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           I +   S+  I   GF    PI +N T  GRQ N+R+E++I P
Sbjct: 169 IAQ-GVSSNRIVANGFGSSNPIASNATPEGRQANRRVEVRILP 210


>gi|126724952|ref|ZP_01740795.1| OmpA family protein [Rhodobacterales bacterium HTCC2150]
 gi|126706116|gb|EBA05206.1| OmpA family protein [Rhodobacterales bacterium HTCC2150]
          Length = 218

 Score =  132 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 51/217 (23%), Positives = 87/217 (40%), Gaps = 32/217 (14%)

Query: 1   MIKELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFG---------------- 44
           M  ++ L++     ++GC  A+  ++      +N    +    G                
Sbjct: 3   MKSKMALALASTLVLAGCDTAANNERNGPNANANVGAAIGGMLGGFVGLKSDDNKLLKGV 62

Query: 45  --------------SSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV-SEVFLE 89
                          SLD+   + +  L +  + +   GD +   +P  + F     F+ 
Sbjct: 63  VGAGIGAAIGGAIGQSLDRQAADLEKSLDNDDVSIVNEGDRLVVTLPQDILFDVDSDFVS 122

Query: 90  KKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSN 149
                 L  +A  LN +P++ I I  HTD+ G+  +N  +S  RA  +   LI  GV++ 
Sbjct: 123 SSLRGDLYKVANNLNSYPNSTIQIIGHTDNSGSAAHNQDLSARRAGSVSGILIDGGVAAG 182

Query: 150 RFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRG 186
           R +S  G     P+ TN T  GR  N+R+EI I P G
Sbjct: 183 RVVS-FGRGEDQPVATNLTAEGRAENRRVEIIILPTG 218


>gi|146276251|ref|YP_001166410.1| OmpA/MotB domain-containing protein [Rhodobacter sphaeroides ATCC
           17025]
 gi|145554492|gb|ABP69105.1| OmpA/MotB domain protein [Rhodobacter sphaeroides ATCC 17025]
          Length = 228

 Score =  132 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 43/176 (24%), Positives = 77/176 (43%), Gaps = 3/176 (1%)

Query: 10  FIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIG 69
            I+  + G   AS  K +  +  +    I+    GS+LD+   + +  + ++ + V+  G
Sbjct: 53  AILGGLVG-ASASDNKLEKAVVGAAVGGILGGAVGSALDRQAADLRNSIGNSQVSVTNTG 111

Query: 70  DMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLL 128
             +   +P  + F      L       L  +A  L ++P++ I +  HTDS G+   N  
Sbjct: 112 SELVVTMPQDILFATDSANLRPDLQRDLAAVAQNLLRYPNSTIMVVGHTDSTGSAAYNQD 171

Query: 129 ISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           +S  RA  +   LI      +  ++  G     PI +N T  GR  N+R++I I P
Sbjct: 172 LSMRRAQSVAGVLIGN-GVPSYRVASLGRGEDQPIASNLTPEGRAQNRRVDIIIRP 226


>gi|261252822|ref|ZP_05945395.1| outer membrane protein [Vibrio orientalis CIP 102891]
 gi|260936213|gb|EEX92202.1| outer membrane protein [Vibrio orientalis CIP 102891]
          Length = 222

 Score =  132 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 56/221 (25%), Positives = 99/221 (44%), Gaps = 39/221 (17%)

Query: 2   IKELGLSMFIMTTISGC-------GLASREKKKVFLHKSNDTDIVNKRFG---------- 44
           +K++ L++ +   ++GC             +       +    +     G          
Sbjct: 1   MKKMTLALAVAIALTGCQATQRQNATTGESETNSATKGALIGALTGVAVGLATGDNADER 60

Query: 45  -------------------SSLDKAEDEFQMQLQDTGIVVSRIG-DMITCYIPVHVSFVS 84
                                 D+ E   + +L D+G+ V R+G + +   +   + F S
Sbjct: 61  RKHALIGAAGGAAVGGGVGYYFDQQEAALRKELLDSGVQVERVGENQLMLRLENGIGFQS 120

Query: 85  EVF-LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQ 143
             + L+      L+ +A IL ++P T + I  HTDS G+   N ++S+ RA+ ++SYL+ 
Sbjct: 121 SSYALDPSIHNTLRGVARILVEYPDTSLVIDGHTDSTGSDTTNQVLSERRAESVRSYLVS 180

Query: 144 RGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           +GV++ R +  RG   +YPI TNDT  GR  N+R+EIQI P
Sbjct: 181 QGVAAGRAV-ARGNGERYPICTNDTTTGRACNRRVEIQILP 220


>gi|16762663|ref|NP_458280.1| outer membrane lipoprotein [Salmonella enterica subsp. enterica
           serovar Typhi str. CT18]
 gi|16766931|ref|NP_462546.1| outer membrane lipoprotein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|29144150|ref|NP_807492.1| outer membrane lipoprotein [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|62182147|ref|YP_218564.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. SC-B67]
 gi|161505818|ref|YP_001572930.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|161616710|ref|YP_001590675.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|167549121|ref|ZP_02342880.1| inner membrane lipoprotein YiaD [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA29]
 gi|168232486|ref|ZP_02657544.1| inner membrane lipoprotein YiaD [Salmonella enterica subsp.
           enterica serovar Kentucky str. CDC 191]
 gi|168235246|ref|ZP_02660304.1| inner membrane lipoprotein YiaD [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. SL480]
 gi|168241813|ref|ZP_02666745.1| inner membrane lipoprotein YiaD [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL486]
 gi|168465059|ref|ZP_02698951.1| inner membrane lipoprotein YiaD [Salmonella enterica subsp.
           enterica serovar Newport str. SL317]
 gi|168818532|ref|ZP_02830532.1| inner membrane lipoprotein YiaD [Salmonella enterica subsp.
           enterica serovar Weltevreden str. HI_N05-537]
 gi|194446335|ref|YP_002042894.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|194450414|ref|YP_002047675.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|194470919|ref|ZP_03076903.1| inner membrane lipoprotein YiaD [Salmonella enterica subsp.
           enterica serovar Kentucky str. CVM29188]
 gi|194738075|ref|YP_002116578.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|197250152|ref|YP_002148575.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
 gi|197264832|ref|ZP_03164906.1| inner membrane lipoprotein YiaD [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA23]
 gi|198245549|ref|YP_002217605.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Dublin str. CT_02021853]
 gi|200387506|ref|ZP_03214118.1| inner membrane lipoprotein YiaD [Salmonella enterica subsp.
           enterica serovar Virchow str. SL491]
 gi|204928737|ref|ZP_03219936.1| inner membrane lipoprotein YiaD [Salmonella enterica subsp.
           enterica serovar Javiana str. GA_MM04042433]
 gi|213426937|ref|ZP_03359687.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Typhi str. E02-1180]
 gi|213580286|ref|ZP_03362112.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-0664]
 gi|213622354|ref|ZP_03375137.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-2068]
 gi|213646868|ref|ZP_03376921.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Typhi str. J185]
 gi|213852846|ref|ZP_03382378.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Typhi str. M223]
 gi|224585444|ref|YP_002639243.1| outer membrane lipoprotein [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|238910327|ref|ZP_04654164.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Tennessee str. CDC07-0191]
 gi|289811587|ref|ZP_06542216.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Typhi str. AG3]
 gi|289824292|ref|ZP_06543885.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-3139]
 gi|25512154|pir||AC0982 probable outer membrane protein STY4157 [imported] - Salmonella
           enterica subsp. enterica serovar Typhi (strain CT18)
 gi|16422210|gb|AAL22505.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|16504969|emb|CAD07983.1| putative outer membrane protein [Salmonella enterica subsp.
           enterica serovar Typhi]
 gi|29139787|gb|AAO71352.1| putative outer membrane protein [Salmonella enterica subsp.
           enterica serovar Typhi str. Ty2]
 gi|62129780|gb|AAX67483.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. SC-B67]
 gi|160867165|gb|ABX23788.1| hypothetical protein SARI_03994 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
 gi|161366074|gb|ABX69842.1| hypothetical protein SPAB_04529 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194404998|gb|ACF65220.1| inner membrane lipoprotein YiaD [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|194408718|gb|ACF68937.1| inner membrane lipoprotein YiaD [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|194457283|gb|EDX46122.1| inner membrane lipoprotein YiaD [Salmonella enterica subsp.
           enterica serovar Kentucky str. CVM29188]
 gi|194713577|gb|ACF92798.1| inner membrane lipoprotein YiaD [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|195632363|gb|EDX50847.1| inner membrane lipoprotein YiaD [Salmonella enterica subsp.
           enterica serovar Newport str. SL317]
 gi|197213855|gb|ACH51252.1| inner membrane lipoprotein YiaD [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
 gi|197243087|gb|EDY25707.1| inner membrane lipoprotein YiaD [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA23]
 gi|197291562|gb|EDY30914.1| inner membrane lipoprotein YiaD [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. SL480]
 gi|197940065|gb|ACH77398.1| inner membrane lipoprotein YiaD [Salmonella enterica subsp.
           enterica serovar Dublin str. CT_02021853]
 gi|199604604|gb|EDZ03149.1| inner membrane lipoprotein YiaD [Salmonella enterica subsp.
           enterica serovar Virchow str. SL491]
 gi|204322170|gb|EDZ07368.1| inner membrane lipoprotein YiaD [Salmonella enterica subsp.
           enterica serovar Javiana str. GA_MM04042433]
 gi|205325701|gb|EDZ13540.1| inner membrane lipoprotein YiaD [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA29]
 gi|205333235|gb|EDZ19999.1| inner membrane lipoprotein YiaD [Salmonella enterica subsp.
           enterica serovar Kentucky str. CDC 191]
 gi|205338706|gb|EDZ25470.1| inner membrane lipoprotein YiaD [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL486]
 gi|205344463|gb|EDZ31227.1| inner membrane lipoprotein YiaD [Salmonella enterica subsp.
           enterica serovar Weltevreden str. HI_N05-537]
 gi|224469972|gb|ACN47802.1| putative outer membrane protein [Salmonella enterica subsp.
           enterica serovar Paratyphi C strain RKS4594]
 gi|267995894|gb|ACY90779.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 14028S]
 gi|312914671|dbj|BAJ38645.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Typhimurium str. T000240]
 gi|320088065|emb|CBY97827.1| Inner membrane lipoprotein yiaD Flags: Precursor [Salmonella
           enterica subsp. enterica serovar Weltevreden str.
           2007-60-3289-1]
 gi|321226700|gb|EFX51750.1| putative outer membrane protein [Salmonella enterica subsp.
           enterica serovar Typhimurium str. TN061786]
 gi|322613966|gb|EFY10902.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315996572]
 gi|322620335|gb|EFY17203.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-1]
 gi|322625340|gb|EFY22167.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-3]
 gi|322629993|gb|EFY26766.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-4]
 gi|322634183|gb|EFY30918.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-1]
 gi|322635916|gb|EFY32625.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-2]
 gi|322643166|gb|EFY39740.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 531954]
 gi|322644613|gb|EFY41149.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Montevideo str. NC_MB110209-0054]
 gi|322650855|gb|EFY47247.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Montevideo str. OH_2009072675]
 gi|322652981|gb|EFY49316.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Montevideo str. CASC_09SCPH15965]
 gi|322659944|gb|EFY56184.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 19N]
 gi|322663277|gb|EFY59481.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 81038-01]
 gi|322668763|gb|EFY64916.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Montevideo str. MD_MDA09249507]
 gi|322674434|gb|EFY70527.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 414877]
 gi|322678358|gb|EFY74419.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 366867]
 gi|322680864|gb|EFY76898.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 413180]
 gi|322687200|gb|EFY83173.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 446600]
 gi|322716635|gb|EFZ08206.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. A50]
 gi|323132006|gb|ADX19436.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 4/74]
 gi|323192159|gb|EFZ77392.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609458-1]
 gi|323200663|gb|EFZ85737.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556150-1]
 gi|323201373|gb|EFZ86439.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609460]
 gi|323206773|gb|EFZ91727.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 507440-20]
 gi|323211797|gb|EFZ96629.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556152]
 gi|323216156|gb|EGA00884.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB101509-0077]
 gi|323220379|gb|EGA04833.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB102109-0047]
 gi|323226236|gb|EGA10451.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB110209-0055]
 gi|323228356|gb|EGA12487.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB111609-0052]
 gi|323234177|gb|EGA18265.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009083312]
 gi|323237162|gb|EGA21229.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009085258]
 gi|323244681|gb|EGA28685.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315731156]
 gi|323249162|gb|EGA33080.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2009159199]
 gi|323250719|gb|EGA34599.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008282]
 gi|323257594|gb|EGA41281.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008283]
 gi|323262303|gb|EGA45864.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008284]
 gi|323266142|gb|EGA49633.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008285]
 gi|323268777|gb|EGA52235.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008287]
 gi|326625391|gb|EGE31736.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Dublin str. 3246]
 gi|326629887|gb|EGE36230.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 9]
 gi|332990496|gb|AEF09479.1| putative outer membrane lipoprotein [Salmonella enterica subsp.
           enterica serovar Typhimurium str. UK-1]
          Length = 220

 Score =  132 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 55/219 (25%), Positives = 95/219 (43%), Gaps = 36/219 (16%)

Query: 1   MIKELGLSMFI---MTTISGCGLASREKKKVFL---HKSNDTDIVNKRFGS--------- 45
           M K + +   I      +SGC       ++        +    +V    G+         
Sbjct: 1   MKKRVFVIAAIVSGALAVSGCTTNPYTGEREAGKSGIGAGIGSLVGAGIGALSSSKKDRG 60

Query: 46  -------------------SLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEV 86
                               +D  E + + +++ TG+ V+R GD I   +P +V+F S  
Sbjct: 61  KGALIGAAAGAALGGGVGYYMDVQEAKLRDKMRGTGVSVTRSGDNIILNMPNNVTFDSSS 120

Query: 87  -FLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRG 145
             L+      L  +A +L ++P T + +  +TDS G+   N+ +SQ+RAD + S LI +G
Sbjct: 121 ATLKPAGANTLTGVAMVLKEYPKTAVNVVGYTDSTGSHDLNMRLSQQRADSVASSLITQG 180

Query: 146 VSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           V ++R I   G     PI +N T  G+  N+R+EI + P
Sbjct: 181 VDASR-IRTSGMGPANPIASNSTAEGKAQNRRVEITLSP 218


>gi|254785154|ref|YP_003072582.1| OmpA family protein [Teredinibacter turnerae T7901]
 gi|237683675|gb|ACR10939.1| OmpA family protein [Teredinibacter turnerae T7901]
          Length = 216

 Score =  132 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 50/166 (30%), Positives = 95/166 (57%), Gaps = 2/166 (1%)

Query: 20  LASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVH 79
            + +++ +  +  +     V    G  +D+ E + + QLQ +G+ V R G+ I   +P +
Sbjct: 50  SSDKDRDRGLITGAVAGAAVGGGVGYYMDRQESKLRQQLQGSGVQVQRDGNTINLIMPGN 109

Query: 80  VSFVSEV-FLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIK 138
           ++F ++   ++ +F  +L  +A +L +F  TVI +  HTDS G+   N  +S+ RA+ ++
Sbjct: 110 ITFATDSFDIKPEFHSVLDSVAQVLKEFKKTVIVVSGHTDSTGSATYNQQLSENRANSVR 169

Query: 139 SYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           SYL+ R V+S R +   G+  + PI +N T  GRQ N+R+E+++ P
Sbjct: 170 SYLLNRSVASGR-VQAVGYGPRMPIASNKTAQGRQQNRRVELKLEP 214


>gi|99082288|ref|YP_614442.1| OmpA/MotB [Ruegeria sp. TM1040]
 gi|99038568|gb|ABF65180.1| OmpA/MotB [Ruegeria sp. TM1040]
          Length = 221

 Score =  132 bits (332), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 42/169 (24%), Positives = 76/169 (44%), Gaps = 2/169 (1%)

Query: 20  LASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVH 79
            A  +K +  +  +    +     G  LDK E E +  L +  I +   GD +   +P  
Sbjct: 54  TADDDKAETIIGTAAVGALAGGLIGRELDKQEAELRQSLDNDSISIVNTGDRLIVSLPND 113

Query: 80  VSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIK 138
           ++F      +       L+ +A  L ++P +++ +  HTDS G    N  +S+ RA+ + 
Sbjct: 114 LTFATDSAAISSVVRSDLRKVAGSLQRYPGSIVQVIGHTDSDGAASYNYSLSERRANAVA 173

Query: 139 SYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGN 187
             +   GVS  R   + G     P+ +N T  G+  N+R+EI I P+ +
Sbjct: 174 DEIAAGGVSYGRM-RIIGRGEDQPVASNLTPEGKARNRRVEIVIIPQAS 221


>gi|90416505|ref|ZP_01224436.1| ompA family protein [marine gamma proteobacterium HTCC2207]
 gi|90331704|gb|EAS46932.1| ompA family protein [marine gamma proteobacterium HTCC2207]
          Length = 220

 Score =  132 bits (332), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 50/211 (23%), Positives = 91/211 (43%), Gaps = 33/211 (15%)

Query: 6   GLSMFIMTTISGCGL----ASREKKKVFLHKSNDTDIVNKR------------------- 42
             S+ I+ ++S C         +K       ++    V                      
Sbjct: 8   LFSLAILVSLSACTTFDPYTGEQKTTKTAIGASIGAGVGAVVAYLDNKDEDSRKRNKRIL 67

Query: 43  --------FGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFL 93
                    G  +D  E + + QL+ +G+ V R+GD I   +P +++F  +   +   F 
Sbjct: 68  AAAGGGAAIGYYMDAQEAKLRQQLRGSGVSVERVGDNINLIMPGNITFASNSADINASFY 127

Query: 94  PMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFIS 153
            +L  +A +L ++  T++ +  HTDS G    N  +S+ RA  +  YL+ + +   R  +
Sbjct: 128 SVLDSVALVLEEYDKTLVVVAGHTDSDGGAAFNEDLSERRAQSVSGYLVSQSILPIRLET 187

Query: 154 VRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           V GF  + PI  ND+  G+Q N+R+EI + P
Sbjct: 188 V-GFGERQPIAGNDSAAGKQLNRRVEITLLP 217


>gi|237740687|ref|ZP_04571168.1| outer membrane protein [Fusobacterium sp. 2_1_31]
 gi|229422704|gb|EEO37751.1| outer membrane protein [Fusobacterium sp. 2_1_31]
          Length = 212

 Score =  132 bits (332), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 50/163 (30%), Positives = 80/163 (49%), Gaps = 2/163 (1%)

Query: 23  REKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF 82
            +  K  L  +    ++   +G+  D    E +  L+ T   V   G+ +   +P  V+F
Sbjct: 49  GKDTKGTLIGAAVGSLLGMGWGAYKDNQARELRAALKGTQAEVRNDGNALVVNLPGGVTF 108

Query: 83  -VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYL 141
                 +   F   L  +A  L ++P T I +  +TDS G   +N  +SQ RA+ +  YL
Sbjct: 109 ASDSANISSGFYSALNGVAQTLVRYPETRIQVNGYTDSTGGDAHNQELSQRRANSVAQYL 168

Query: 142 IQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           I +GVSS+R +   GF    PI +N T  GRQ N+R+E++I P
Sbjct: 169 ISQGVSSSRIV-ANGFGSSNPIASNATPEGRQANRRVEVRILP 210


>gi|327395890|dbj|BAK13312.1| inner membrane lipoprotein YiaD precursor [Pantoea ananatis
           AJ13355]
          Length = 237

 Score =  132 bits (331), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 49/180 (27%), Positives = 91/180 (50%), Gaps = 2/180 (1%)

Query: 6   GLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVV 65
           GL   +   +     + +++ K  L  +     +    G  +D  E + + +++ TG+ V
Sbjct: 57  GLGALVGAGVGVLSSSKKDRGKGALIGAASGAALGGGVGYYMDVQEAKLRDKMKGTGVSV 116

Query: 66  SRIGDMITCYIPVHVSFVSEVF-LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLK 124
           +R GD I   +P +V+F S    L+      L  +A +L ++P T + +  HTDS G+  
Sbjct: 117 TRQGDNIVLNMPNNVTFDSSSSSLKPAGANTLTGVAMVLKEYPKTAVNVVGHTDSTGSRA 176

Query: 125 NNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
            N+ +SQ+RA+ + S LI +   ++  +  RG     P+ TN T+ G+  N+R+EI + P
Sbjct: 177 LNMRLSQQRAESVASALIVQ-GVASDRLHTRGAGPDSPVATNSTEAGKAQNRRVEITLSP 235


>gi|194099378|ref|YP_002002478.1| hypothetical protein NGK_1853 [Neisseria gonorrhoeae NCCP11945]
 gi|239999626|ref|ZP_04719550.1| hypothetical protein Ngon3_09112 [Neisseria gonorrhoeae 35/02]
 gi|240014801|ref|ZP_04721714.1| hypothetical protein NgonD_09194 [Neisseria gonorrhoeae DGI18]
 gi|240017250|ref|ZP_04723790.1| hypothetical protein NgonFA_08817 [Neisseria gonorrhoeae FA6140]
 gi|240081113|ref|ZP_04725656.1| hypothetical protein NgonF_07349 [Neisseria gonorrhoeae FA19]
 gi|240113325|ref|ZP_04727815.1| hypothetical protein NgonM_07083 [Neisseria gonorrhoeae MS11]
 gi|240116327|ref|ZP_04730389.1| hypothetical protein NgonPID1_08846 [Neisseria gonorrhoeae PID18]
 gi|240118614|ref|ZP_04732676.1| hypothetical protein NgonPID_09178 [Neisseria gonorrhoeae PID1]
 gi|240121324|ref|ZP_04734286.1| hypothetical protein NgonPI_06069 [Neisseria gonorrhoeae PID24-1]
 gi|240124157|ref|ZP_04737113.1| hypothetical protein NgonP_09504 [Neisseria gonorrhoeae PID332]
 gi|240126226|ref|ZP_04739112.1| hypothetical protein NgonSK_08443 [Neisseria gonorrhoeae SK-92-679]
 gi|240128827|ref|ZP_04741488.1| hypothetical protein NgonS_09423 [Neisseria gonorrhoeae SK-93-1035]
 gi|293398468|ref|ZP_06642646.1| hypothetical protein NGNG_01123 [Neisseria gonorrhoeae F62]
 gi|193934668|gb|ACF30492.1| Conserved hypothetical protein [Neisseria gonorrhoeae NCCP11945]
 gi|291610939|gb|EFF40036.1| hypothetical protein NGNG_01123 [Neisseria gonorrhoeae F62]
 gi|317164880|gb|ADV08421.1| hypothetical protein NGTW08_1460 [Neisseria gonorrhoeae
           TCDC-NG08107]
          Length = 225

 Score =  132 bits (331), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 50/182 (27%), Positives = 79/182 (43%), Gaps = 2/182 (1%)

Query: 4   ELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGI 63
           +  +       + G   A     K   + +     +    G  +D  E   +  L  T I
Sbjct: 34  KSAMYGLGGAAVCGIVGALTHSGKGARNSALACGAIGAGVGGYMDYQEQRLRQNLAGTQI 93

Query: 64  VVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGT 122
            + R G+ I   +P  V+F      L       L   A  L ++P T + I  HTD+ G+
Sbjct: 94  EIQRQGNQIRLVMPESVTFATGSAALGGSAQYALNTAAQTLVQYPDTTLTINGHTDNTGS 153

Query: 123 LKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
              N  +SQ RA  +  YL  RGV+++R ++V G+    P+ +N T  GR  N+R+EI I
Sbjct: 154 DAVNNPLSQHRAQAVAYYLQTRGVAASR-LTVYGYGSHMPVASNATVEGRAQNRRVEILI 212

Query: 183 FP 184
            P
Sbjct: 213 NP 214


>gi|312174309|emb|CBX82562.1| putative outer membrane lipoprotein yiaD precursor [Erwinia
           amylovora ATCC BAA-2158]
          Length = 221

 Score =  132 bits (331), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 48/220 (21%), Positives = 97/220 (44%), Gaps = 37/220 (16%)

Query: 1   MIKELGLSMFIMT----TISGC-------------------------------GLASREK 25
           M K+  +++ ++      ++GC                                 + +++
Sbjct: 1   MKKKSVMTLALLLSGTVALTGCTTNPYTGEREAGKSGIGAGIGAALGAGVGMLSSSKKDR 60

Query: 26  KKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSE 85
            K  L  +     +    G  +D  E + + +++ TG+ V+R GD I   +P +V+F S 
Sbjct: 61  GKGALIGATAGAALGGGAGYYMDVQEAKLRDKMKGTGVSVTRSGDNIVLNMPNNVTFDSS 120

Query: 86  V-FLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQR 144
              L+      L  +A +L ++P T + +  +TDS G+ + N+ +SQ+RAD + S LI +
Sbjct: 121 SSTLKPAGANTLTGVAMVLKEYPKTAVNVVGYTDSSGSRQLNMNLSQQRADGVGSALIAQ 180

Query: 145 GVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
              +   +   G     P+ +N +  G+  N+R+EI + P
Sbjct: 181 -GVAANRVRTNGMGSDNPVASNSSAEGKAQNRRVEITLSP 219


>gi|205354747|ref|YP_002228548.1| outer membrane lipoprotein [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|207858882|ref|YP_002245533.1| outer membrane lipoprotein [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|205274528|emb|CAR39567.1| putative outer membrane protein [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 287/91]
 gi|206710685|emb|CAR35045.1| putative outer membrane protein [Salmonella enterica subsp.
           enterica serovar Enteritidis str. P125109]
 gi|261248795|emb|CBG26648.1| putative outer membrane protein [Salmonella enterica subsp.
           enterica serovar Typhimurium str. D23580]
 gi|301160182|emb|CBW19704.1| putative outer membrane protein [Salmonella enterica subsp.
           enterica serovar Typhimurium str. SL1344]
          Length = 209

 Score =  132 bits (331), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 52/180 (28%), Positives = 92/180 (51%), Gaps = 2/180 (1%)

Query: 6   GLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVV 65
           G+   +   I     + +++ K  L  +     +    G  +D  E + + +++ TG+ V
Sbjct: 29  GIGSLVGAGIGALSSSKKDRGKGALIGAAAGAALGGGVGYYMDVQEAKLRDKMRGTGVSV 88

Query: 66  SRIGDMITCYIPVHVSFVSEV-FLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLK 124
           +R GD I   +P +V+F S    L+      L  +A +L ++P T + +  +TDS G+  
Sbjct: 89  TRSGDNIILNMPNNVTFDSSSATLKPAGANTLTGVAMVLKEYPKTAVNVVGYTDSTGSHD 148

Query: 125 NNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
            N+ +SQ+RAD + S LI +GV ++R I   G     PI +N T  G+  N+R+EI + P
Sbjct: 149 LNMRLSQQRADSVASSLITQGVDASR-IRTSGMGPANPIASNSTAEGKAQNRRVEITLSP 207


>gi|89092082|ref|ZP_01165037.1| hypothetical protein MED92_07941 [Oceanospirillum sp. MED92]
 gi|89083817|gb|EAR63034.1| hypothetical protein MED92_07941 [Oceanospirillum sp. MED92]
          Length = 218

 Score =  132 bits (331), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 53/214 (24%), Positives = 90/214 (42%), Gaps = 34/214 (15%)

Query: 2   IKELGLSMFIMTTISGCG--------------------------------LASREKKKVF 29
           +K+L         ++GC                                  +  ++ K  
Sbjct: 1   MKKLVSVAVAGLLLAGCQTIDPYTGEQKVGNTTKGAGIGAVAGAVLGMAVSSKDDRGKGA 60

Query: 30  LHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV-SEVFL 88
           L  +     V    G  +D+ E   + +L+ TG+ V RIGD I   +P +++F  +   +
Sbjct: 61  LTGALVGGAVGGGIGYYMDQQEALLRQELEGTGVRVERIGDSIRLIMPGNITFALNSDQI 120

Query: 89  EKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSS 148
              F  +L  +A +L KF  T + +   TDS G+ + N  +S+ RA  +  YL+     S
Sbjct: 121 APSFYSVLDSVAKVLVKFDQTELNVDGFTDSTGSFEYNQQLSERRAARVGDYLVS-SGIS 179

Query: 149 NRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
              I+ +G+  +YPI  N T  GR  N+R+EI I
Sbjct: 180 RLRINAKGYGERYPIADNKTAAGRAQNRRVEINI 213


>gi|332704885|ref|ZP_08424973.1| OmpA/MotB domain protein [Desulfovibrio africanus str. Walvis Bay]
 gi|332555034|gb|EGJ52078.1| OmpA/MotB domain protein [Desulfovibrio africanus str. Walvis Bay]
          Length = 222

 Score =  132 bits (331), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 57/219 (26%), Positives = 99/219 (45%), Gaps = 37/219 (16%)

Query: 2   IKELGLSMFI-----MTTISGCGLAS------------------------------REKK 26
           +K++ + + +         +GC                                   ++ 
Sbjct: 1   MKKIAIKILLVCMCSALFAAGCTTDPYTGERQVSRTAIGAGAGAAAGAAGGAIFGGGDRG 60

Query: 27  KVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV-SE 85
           K  L  +    +     G  +D  E + + +LQ TG+ V+R GDMI   +P +V+F    
Sbjct: 61  KRVLIGAGIGALAGGAVGGYMDYQESKLRQRLQGTGVSVTRQGDMIILNMPGNVTFDTGS 120

Query: 86  VFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRG 145
             ++ +F  +L  +A +L ++  T + +  HTDS G++  N+ +SQ+RA  +  YLI +G
Sbjct: 121 AGIKPQFFEVLNSVAIVLKEYEKTYVDVLGHTDSTGSMNLNMRLSQDRAQSVAQYLISQG 180

Query: 146 VSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           V   RF+ VRG     PI  N T  GR  N+R+EI++ P
Sbjct: 181 VQQERFL-VRGMGPNQPIADNSTAAGRSQNRRVEIKLTP 218


>gi|149909453|ref|ZP_01898108.1| outer membrane protein [Moritella sp. PE36]
 gi|149807563|gb|EDM67512.1| outer membrane protein [Moritella sp. PE36]
          Length = 214

 Score =  132 bits (331), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 49/213 (23%), Positives = 92/213 (43%), Gaps = 31/213 (14%)

Query: 1   MIKELGLSMFIMTTISGC----GLASREKKKVFLHKSNDTDIVNKRFGS----------- 45
           M+K+   ++ I+  ++GC         ++       +    I     G+           
Sbjct: 1   MMKKTLTAIMIIAALTGCARQNATTGEQETNTATKSAIGGAIAGALIGASTGKKNAALFG 60

Query: 46  -------------SLDKAEDEFQMQLQDTGIVVSRIGDM--ITCYIPVHVSFVSEVFLEK 90
                          D+ E+E + +L  +G+ V R+G+               +   L  
Sbjct: 61  ALGGAAIGGGIGHYFDRQEEELRQELIGSGVQVKRVGENELQLIMAKGIGFQTAGYNLSG 120

Query: 91  KFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNR 150
                L  +A ILN++P + + I  HTDS+G+ ++NL +S+ERA+ +    + +    + 
Sbjct: 121 DIYSSLNSVAKILNEYPKSSLRIVGHTDSVGSAQSNLTLSEERAESVSE-YLNKRGIKSG 179

Query: 151 FISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
            +S RG+  + PI +N+TK GR  N+R+EI I 
Sbjct: 180 RLSTRGYGERRPIASNETKSGRAANRRVEISIT 212


>gi|292490116|ref|YP_003533011.1| putative outer membrane lipoprotein yiaD [Erwinia amylovora
           CFBP1430]
 gi|292901121|ref|YP_003540490.1| outer membrane protein [Erwinia amylovora ATCC 49946]
 gi|291200969|emb|CBJ48108.1| putative outer membrane protein [Erwinia amylovora ATCC 49946]
 gi|291555558|emb|CBA24133.1| putative outer membrane lipoprotein yiaD precursor [Erwinia
           amylovora CFBP1430]
          Length = 221

 Score =  131 bits (330), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 48/220 (21%), Positives = 97/220 (44%), Gaps = 37/220 (16%)

Query: 1   MIKELGLSMFIMT----TISGC-------------------------------GLASREK 25
           M K+  +++ ++      ++GC                                 + +++
Sbjct: 1   MKKKSVMTLALLLSGTVALTGCTTNPYTGEREAGKSGIGAGIGAALGAGVGMLSSSKKDR 60

Query: 26  KKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSE 85
            K  L  +     +    G  +D  E + + +++ TG+ V+R GD I   +P +V+F S 
Sbjct: 61  GKGALIGATAGAALGGGAGYYMDVQEAKLRDKMKGTGVSVTRSGDNIVLNMPNNVTFDSS 120

Query: 86  V-FLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQR 144
              L+      L  +A +L ++P T + +  +TDS G+ + N+ +SQ+RAD + S LI +
Sbjct: 121 SSTLKPAGANTLTGVAMVLKEYPKTAVNVVGYTDSSGSRQLNMNLSQQRADGVGSALIAQ 180

Query: 145 GVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
              +   +   G     P+ +N +  G+  N+R+EI + P
Sbjct: 181 -GVAANRVRTNGMGPDNPVASNSSAEGKAQNRRVEITLSP 219


>gi|15804098|ref|NP_290137.1| putative outer membrane lipoprotein [Escherichia coli O157:H7
           EDL933]
 gi|15833691|ref|NP_312464.1| outer membrane lipoprotein [Escherichia coli O157:H7 str. Sakai]
 gi|26250192|ref|NP_756232.1| putative outer membrane lipoprotein [Escherichia coli CFT073]
 gi|49176370|ref|YP_026228.1| outer membrane lipoprotein [Escherichia coli str. K-12 substr.
           MG1655]
 gi|89110462|ref|AP_004242.1| predicted outer membrane lipoprotien [Escherichia coli str. K-12
           substr. W3110]
 gi|110643800|ref|YP_671530.1| putative outer membrane lipoprotein [Escherichia coli 536]
 gi|157158823|ref|YP_001465027.1| putative outer membrane lipoprotein [Escherichia coli E24377A]
 gi|157163027|ref|YP_001460345.1| putative outer membrane lipoprotein [Escherichia coli HS]
 gi|168746904|ref|ZP_02771926.1| OmpA family protein [Escherichia coli O157:H7 str. EC4113]
 gi|168753370|ref|ZP_02778377.1| OmpA family protein [Escherichia coli O157:H7 str. EC4401]
 gi|168759642|ref|ZP_02784649.1| OmpA family protein [Escherichia coli O157:H7 str. EC4501]
 gi|168765965|ref|ZP_02790972.1| OmpA family protein [Escherichia coli O157:H7 str. EC4486]
 gi|168772488|ref|ZP_02797495.1| OmpA family protein [Escherichia coli O157:H7 str. EC4196]
 gi|168779701|ref|ZP_02804708.1| OmpA family protein [Escherichia coli O157:H7 str. EC4076]
 gi|168785422|ref|ZP_02810429.1| OmpA family protein [Escherichia coli O157:H7 str. EC869]
 gi|168797388|ref|ZP_02822395.1| OmpA family protein [Escherichia coli O157:H7 str. EC508]
 gi|170018219|ref|YP_001723173.1| putative outer membrane lipoprotein [Escherichia coli ATCC 8739]
 gi|170083060|ref|YP_001732380.1| outer membrane lipoprotein [Escherichia coli str. K-12 substr.
           DH10B]
 gi|170680831|ref|YP_001745838.1| putative outer membrane lipoprotein [Escherichia coli SMS-3-5]
 gi|170766985|ref|ZP_02901438.1| OmpA family protein [Escherichia albertii TW07627]
 gi|188495948|ref|ZP_03003218.1| OmpA family protein [Escherichia coli 53638]
 gi|191165316|ref|ZP_03027159.1| OmpA family protein [Escherichia coli B7A]
 gi|191170332|ref|ZP_03031885.1| OmpA family protein [Escherichia coli F11]
 gi|193061844|ref|ZP_03042941.1| OmpA family protein [Escherichia coli E22]
 gi|193068535|ref|ZP_03049497.1| OmpA family protein [Escherichia coli E110019]
 gi|194427518|ref|ZP_03060067.1| OmpA family protein [Escherichia coli B171]
 gi|194435666|ref|ZP_03067769.1| OmpA family protein [Escherichia coli 101-1]
 gi|195935083|ref|ZP_03080465.1| putative outer membrane lipoprotein [Escherichia coli O157:H7 str.
           EC4024]
 gi|208808020|ref|ZP_03250357.1| OmpA family protein [Escherichia coli O157:H7 str. EC4206]
 gi|208812888|ref|ZP_03254217.1| OmpA family protein [Escherichia coli O157:H7 str. EC4045]
 gi|208819372|ref|ZP_03259692.1| OmpA family protein [Escherichia coli O157:H7 str. EC4042]
 gi|209400986|ref|YP_002273038.1| OmpA family protein [Escherichia coli O157:H7 str. EC4115]
 gi|209921016|ref|YP_002295100.1| putative outer membrane lipoprotein [Escherichia coli SE11]
 gi|215488837|ref|YP_002331268.1| putative outer membrane lipoprotein [Escherichia coli O127:H6 str.
           E2348/69]
 gi|217326256|ref|ZP_03442340.1| OmpA family protein [Escherichia coli O157:H7 str. TW14588]
 gi|218556112|ref|YP_002389025.1| putative outer membrane lipoprotein [Escherichia coli IAI1]
 gi|218691843|ref|YP_002400055.1| putative outer membrane lipoprotein [Escherichia coli ED1a]
 gi|218697269|ref|YP_002404936.1| putative outer membrane lipoprotein [Escherichia coli 55989]
 gi|218702317|ref|YP_002409946.1| putative outer membrane lipoprotein [Escherichia coli IAI39]
 gi|218707187|ref|YP_002414706.1| putative outer membrane lipoprotein [Escherichia coli UMN026]
 gi|227883718|ref|ZP_04001523.1| outer membrane lipoprotein [Escherichia coli 83972]
 gi|238902640|ref|YP_002928436.1| putative outer membrane lipoprotein [Escherichia coli BW2952]
 gi|254795509|ref|YP_003080346.1| putative outer membrane lipoprotein [Escherichia coli O157:H7 str.
           TW14359]
 gi|256020901|ref|ZP_05434766.1| putative outer membrane lipoprotein [Shigella sp. D9]
 gi|256025721|ref|ZP_05439586.1| putative outer membrane lipoprotein [Escherichia sp. 4_1_40B]
 gi|260846733|ref|YP_003224511.1| putative outer membrane lipoprotein [Escherichia coli O103:H2 str.
           12009]
 gi|260858052|ref|YP_003231943.1| putative outer membrane lipoprotein [Escherichia coli O26:H11 str.
           11368]
 gi|260870283|ref|YP_003236685.1| putative outer membrane lipoprotein [Escherichia coli O111:H- str.
           11128]
 gi|261224871|ref|ZP_05939152.1| outer membrane lipoprotein [Escherichia coli O157:H7 str. FRIK2000]
 gi|261254230|ref|ZP_05946763.1| putative outer membrane lipoprotein [Escherichia coli O157:H7 str.
           FRIK966]
 gi|291284929|ref|YP_003501747.1| Inner membrane lipoprotein yiaD precursor [Escherichia coli O55:H7
           str. CB9615]
 gi|293407175|ref|ZP_06651099.1| outer membrane lipoprotein [Escherichia coli FVEC1412]
 gi|293417001|ref|ZP_06659638.1| outer membrane lipoprotein [Escherichia coli B185]
 gi|293453862|ref|ZP_06664281.1| outer membrane lipoprotein [Escherichia coli B088]
 gi|298382924|ref|ZP_06992519.1| outer membrane lipoprotein [Escherichia coli FVEC1302]
 gi|300815222|ref|ZP_07095447.1| OmpA family protein [Escherichia coli MS 107-1]
 gi|300822046|ref|ZP_07102189.1| OmpA family protein [Escherichia coli MS 119-7]
 gi|300898736|ref|ZP_07117047.1| OmpA family protein [Escherichia coli MS 198-1]
 gi|300920432|ref|ZP_07136866.1| OmpA family protein [Escherichia coli MS 115-1]
 gi|300925626|ref|ZP_07141493.1| OmpA family protein [Escherichia coli MS 182-1]
 gi|300937157|ref|ZP_07152011.1| OmpA family protein [Escherichia coli MS 21-1]
 gi|300971377|ref|ZP_07171446.1| OmpA family protein [Escherichia coli MS 45-1]
 gi|300976951|ref|ZP_07173686.1| OmpA family protein [Escherichia coli MS 200-1]
 gi|301026191|ref|ZP_07189658.1| OmpA family protein [Escherichia coli MS 69-1]
 gi|301028182|ref|ZP_07191452.1| OmpA family protein [Escherichia coli MS 196-1]
 gi|301304604|ref|ZP_07210713.1| OmpA family protein [Escherichia coli MS 124-1]
 gi|301646016|ref|ZP_07245922.1| OmpA family protein [Escherichia coli MS 146-1]
 gi|307140242|ref|ZP_07499598.1| putative outer membrane lipoprotein [Escherichia coli H736]
 gi|307314313|ref|ZP_07593920.1| OmpA/MotB domain protein [Escherichia coli W]
 gi|309796193|ref|ZP_07690604.1| OmpA family protein [Escherichia coli MS 145-7]
 gi|312968105|ref|ZP_07782316.1| inner membrane lipoprotein yiaD [Escherichia coli 2362-75]
 gi|312972173|ref|ZP_07786347.1| inner membrane lipoprotein yiaD [Escherichia coli 1827-70]
 gi|331644263|ref|ZP_08345392.1| inner membrane lipoprotein YiaD [Escherichia coli H736]
 gi|331655189|ref|ZP_08356188.1| inner membrane lipoprotein YiaD [Escherichia coli M718]
 gi|331659868|ref|ZP_08360806.1| inner membrane lipoprotein YiaD [Escherichia coli TA206]
 gi|331665175|ref|ZP_08366076.1| inner membrane lipoprotein YiaD [Escherichia coli TA143]
 gi|331670386|ref|ZP_08371225.1| inner membrane lipoprotein YiaD [Escherichia coli TA271]
 gi|331675043|ref|ZP_08375800.1| inner membrane lipoprotein YiaD [Escherichia coli TA280]
 gi|331679633|ref|ZP_08380303.1| inner membrane lipoprotein YiaD [Escherichia coli H591]
 gi|331685215|ref|ZP_08385801.1| inner membrane lipoprotein YiaD [Escherichia coli H299]
 gi|332282119|ref|ZP_08394532.1| OmpA family protein [Shigella sp. D9]
 gi|54042327|sp|P37665|YIAD_ECOLI RecName: Full=Inner membrane lipoprotein yiaD; Flags: Precursor
 gi|12518287|gb|AAG58701.1|AE005582_4 putative outer membrane protein [Escherichia coli O157:H7 str.
           EDL933]
 gi|26110621|gb|AAN82806.1|AE016768_224 Hypothetical lipoprotein yiaD precursor [Escherichia coli CFT073]
 gi|13363911|dbj|BAB37860.1| putative outer membrane protein [Escherichia coli O157:H7 str.
           Sakai]
 gi|48994946|gb|AAT48190.1| outer membrane lipoprotein [Escherichia coli str. K-12 substr.
           MG1655]
 gi|85676493|dbj|BAE77743.1| predicted outer membrane lipoprotien [Escherichia coli str. K12
           substr. W3110]
 gi|110345392|gb|ABG71629.1| putative outer membrane lipoprotein [Escherichia coli 536]
 gi|157068707|gb|ABV07962.1| OmpA family protein [Escherichia coli HS]
 gi|157080853|gb|ABV20561.1| OmpA family protein [Escherichia coli E24377A]
 gi|169753147|gb|ACA75846.1| OmpA/MotB domain protein [Escherichia coli ATCC 8739]
 gi|169890895|gb|ACB04602.1| predicted outer membrane lipoprotein [Escherichia coli str. K-12
           substr. DH10B]
 gi|170124423|gb|EDS93354.1| OmpA family protein [Escherichia albertii TW07627]
 gi|170518549|gb|ACB16727.1| OmpA family protein [Escherichia coli SMS-3-5]
 gi|187771758|gb|EDU35602.1| OmpA family protein [Escherichia coli O157:H7 str. EC4196]
 gi|188018309|gb|EDU56431.1| OmpA family protein [Escherichia coli O157:H7 str. EC4113]
 gi|188491147|gb|EDU66250.1| OmpA family protein [Escherichia coli 53638]
 gi|189002241|gb|EDU71227.1| OmpA family protein [Escherichia coli O157:H7 str. EC4076]
 gi|189358800|gb|EDU77219.1| OmpA family protein [Escherichia coli O157:H7 str. EC4401]
 gi|189364720|gb|EDU83139.1| OmpA family protein [Escherichia coli O157:H7 str. EC4486]
 gi|189369665|gb|EDU88081.1| OmpA family protein [Escherichia coli O157:H7 str. EC4501]
 gi|189374556|gb|EDU92972.1| OmpA family protein [Escherichia coli O157:H7 str. EC869]
 gi|189380056|gb|EDU98472.1| OmpA family protein [Escherichia coli O157:H7 str. EC508]
 gi|190904718|gb|EDV64424.1| OmpA family protein [Escherichia coli B7A]
 gi|190909140|gb|EDV68726.1| OmpA family protein [Escherichia coli F11]
 gi|192932634|gb|EDV85231.1| OmpA family protein [Escherichia coli E22]
 gi|192958186|gb|EDV88627.1| OmpA family protein [Escherichia coli E110019]
 gi|194414558|gb|EDX30831.1| OmpA family protein [Escherichia coli B171]
 gi|194425209|gb|EDX41193.1| OmpA family protein [Escherichia coli 101-1]
 gi|208727821|gb|EDZ77422.1| OmpA family protein [Escherichia coli O157:H7 str. EC4206]
 gi|208734165|gb|EDZ82852.1| OmpA family protein [Escherichia coli O157:H7 str. EC4045]
 gi|208739495|gb|EDZ87177.1| OmpA family protein [Escherichia coli O157:H7 str. EC4042]
 gi|209162386|gb|ACI39819.1| OmpA family protein [Escherichia coli O157:H7 str. EC4115]
 gi|209755238|gb|ACI75931.1| putative outer membrane protein [Escherichia coli]
 gi|209755240|gb|ACI75932.1| putative outer membrane protein [Escherichia coli]
 gi|209755242|gb|ACI75933.1| putative outer membrane protein [Escherichia coli]
 gi|209755244|gb|ACI75934.1| putative outer membrane protein [Escherichia coli]
 gi|209755246|gb|ACI75935.1| putative outer membrane protein [Escherichia coli]
 gi|209914275|dbj|BAG79349.1| conserved hypothetical protein [Escherichia coli SE11]
 gi|215266909|emb|CAS11352.1| predicted outer membrane lipoprotien [Escherichia coli O127:H6 str.
           E2348/69]
 gi|217322477|gb|EEC30901.1| OmpA family protein [Escherichia coli O157:H7 str. TW14588]
 gi|218354001|emb|CAV00488.1| putative outer membrane lipoprotien [Escherichia coli 55989]
 gi|218362880|emb|CAR00514.1| putative outer membrane lipoprotien [Escherichia coli IAI1]
 gi|218372303|emb|CAR20168.1| putative outer membrane lipoprotien [Escherichia coli IAI39]
 gi|218429407|emb|CAR10226.1| putative outer membrane lipoprotien [Escherichia coli ED1a]
 gi|218434284|emb|CAR15206.1| putative outer membrane lipoprotien [Escherichia coli UMN026]
 gi|227839298|gb|EEJ49764.1| outer membrane lipoprotein [Escherichia coli 83972]
 gi|238862715|gb|ACR64713.1| predicted outer membrane lipoprotein [Escherichia coli BW2952]
 gi|254594909|gb|ACT74270.1| outer membrane lipoprotein [Escherichia coli O157:H7 str. TW14359]
 gi|257756701|dbj|BAI28203.1| predicted outer membrane lipoprotein [Escherichia coli O26:H11 str.
           11368]
 gi|257761880|dbj|BAI33377.1| predicted outer membrane lipoprotein [Escherichia coli O103:H2 str.
           12009]
 gi|257766639|dbj|BAI38134.1| predicted outer membrane lipoprotein [Escherichia coli O111:H- str.
           11128]
 gi|260447432|gb|ACX37854.1| OmpA/MotB domain protein [Escherichia coli DH1]
 gi|284923586|emb|CBG36682.1| putative outer membrane protein [Escherichia coli 042]
 gi|290764802|gb|ADD58763.1| Inner membrane lipoprotein yiaD precursor [Escherichia coli O55:H7
           str. CB9615]
 gi|291321988|gb|EFE61419.1| outer membrane lipoprotein [Escherichia coli B088]
 gi|291425986|gb|EFE99020.1| outer membrane lipoprotein [Escherichia coli FVEC1412]
 gi|291431577|gb|EFF04562.1| outer membrane lipoprotein [Escherichia coli B185]
 gi|298276760|gb|EFI18278.1| outer membrane lipoprotein [Escherichia coli FVEC1302]
 gi|299878738|gb|EFI86949.1| OmpA family protein [Escherichia coli MS 196-1]
 gi|300308421|gb|EFJ62941.1| OmpA family protein [Escherichia coli MS 200-1]
 gi|300357615|gb|EFJ73485.1| OmpA family protein [Escherichia coli MS 198-1]
 gi|300395632|gb|EFJ79170.1| OmpA family protein [Escherichia coli MS 69-1]
 gi|300411301|gb|EFJ94839.1| OmpA family protein [Escherichia coli MS 45-1]
 gi|300412565|gb|EFJ95875.1| OmpA family protein [Escherichia coli MS 115-1]
 gi|300418280|gb|EFK01591.1| OmpA family protein [Escherichia coli MS 182-1]
 gi|300457770|gb|EFK21263.1| OmpA family protein [Escherichia coli MS 21-1]
 gi|300525409|gb|EFK46478.1| OmpA family protein [Escherichia coli MS 119-7]
 gi|300532114|gb|EFK53176.1| OmpA family protein [Escherichia coli MS 107-1]
 gi|300840082|gb|EFK67842.1| OmpA family protein [Escherichia coli MS 124-1]
 gi|301075768|gb|EFK90574.1| OmpA family protein [Escherichia coli MS 146-1]
 gi|306906028|gb|EFN36548.1| OmpA/MotB domain protein [Escherichia coli W]
 gi|307555658|gb|ADN48433.1| putative outer membrane protein [Escherichia coli ABU 83972]
 gi|308120254|gb|EFO57516.1| OmpA family protein [Escherichia coli MS 145-7]
 gi|310334550|gb|EFQ00755.1| inner membrane lipoprotein yiaD [Escherichia coli 1827-70]
 gi|312287364|gb|EFR15273.1| inner membrane lipoprotein yiaD [Escherichia coli 2362-75]
 gi|315062837|gb|ADT77164.1| predicted outer membrane lipoprotein [Escherichia coli W]
 gi|315138128|dbj|BAJ45287.1| inner membrane lipoprotein yiaD precursor [Escherichia coli DH1]
 gi|315254081|gb|EFU34049.1| OmpA family protein [Escherichia coli MS 85-1]
 gi|315294130|gb|EFU53482.1| OmpA family protein [Escherichia coli MS 153-1]
 gi|315300095|gb|EFU59333.1| OmpA family protein [Escherichia coli MS 16-3]
 gi|315618412|gb|EFU98999.1| inner membrane lipoprotein yiaD [Escherichia coli 3431]
 gi|320191391|gb|EFW66041.1| putative outer membrane protein [Escherichia coli O157:H7 str.
           EC1212]
 gi|320201426|gb|EFW76007.1| putative outer membrane protein [Escherichia coli EC4100B]
 gi|320639873|gb|EFX09467.1| putative outer membrane lipoprotein [Escherichia coli O157:H7 str.
           G5101]
 gi|320645036|gb|EFX14060.1| putative outer membrane lipoprotein [Escherichia coli O157:H- str.
           493-89]
 gi|320650303|gb|EFX18786.1| putative outer membrane lipoprotein [Escherichia coli O157:H- str.
           H 2687]
 gi|320655878|gb|EFX23801.1| putative outer membrane lipoprotein [Escherichia coli O55:H7 str.
           3256-97 TW 07815]
 gi|320661658|gb|EFX29073.1| putative outer membrane lipoprotein [Escherichia coli O55:H7 str.
           USDA 5905]
 gi|320666682|gb|EFX33665.1| putative outer membrane lipoprotein [Escherichia coli O157:H7 str.
           LSU-61]
 gi|323153881|gb|EFZ40115.1| inner membrane lipoprotein yiaD [Escherichia coli EPECa14]
 gi|323160679|gb|EFZ46618.1| inner membrane lipoprotein yiaD [Escherichia coli E128010]
 gi|323174210|gb|EFZ59838.1| inner membrane lipoprotein yiaD [Escherichia coli LT-68]
 gi|323179484|gb|EFZ65051.1| inner membrane lipoprotein yiaD [Escherichia coli 1180]
 gi|323182708|gb|EFZ68110.1| inner membrane lipoprotein yiaD [Escherichia coli 1357]
 gi|323376572|gb|ADX48840.1| OmpA/MotB domain protein [Escherichia coli KO11]
 gi|323934746|gb|EGB31133.1| OmpA family protein [Escherichia coli E1520]
 gi|323939549|gb|EGB35757.1| OmpA family protein [Escherichia coli E482]
 gi|323944551|gb|EGB40622.1| OmpA family protein [Escherichia coli H120]
 gi|323959435|gb|EGB55094.1| OmpA family protein [Escherichia coli H489]
 gi|323966022|gb|EGB61463.1| OmpA family protein [Escherichia coli M863]
 gi|323971357|gb|EGB66598.1| OmpA family protein [Escherichia coli TA007]
 gi|323975035|gb|EGB70144.1| OmpA family protein [Escherichia coli TW10509]
 gi|324007339|gb|EGB76558.1| OmpA family protein [Escherichia coli MS 57-2]
 gi|324014213|gb|EGB83432.1| OmpA family protein [Escherichia coli MS 60-1]
 gi|324021134|gb|EGB90353.1| OmpA family protein [Escherichia coli MS 117-3]
 gi|324116568|gb|EGC10485.1| OmpA family protein [Escherichia coli E1167]
 gi|326337443|gb|EGD61278.1| putative outer membrane protein [Escherichia coli O157:H7 str.
           1044]
 gi|326339968|gb|EGD63775.1| putative outer membrane protein [Escherichia coli O157:H7 str.
           1125]
 gi|327251203|gb|EGE62896.1| inner membrane lipoprotein yiaD [Escherichia coli STEC_7v]
 gi|331036557|gb|EGI08783.1| inner membrane lipoprotein YiaD [Escherichia coli H736]
 gi|331047204|gb|EGI19282.1| inner membrane lipoprotein YiaD [Escherichia coli M718]
 gi|331053083|gb|EGI25116.1| inner membrane lipoprotein YiaD [Escherichia coli TA206]
 gi|331057685|gb|EGI29671.1| inner membrane lipoprotein YiaD [Escherichia coli TA143]
 gi|331062448|gb|EGI34368.1| inner membrane lipoprotein YiaD [Escherichia coli TA271]
 gi|331067952|gb|EGI39350.1| inner membrane lipoprotein YiaD [Escherichia coli TA280]
 gi|331072805|gb|EGI44130.1| inner membrane lipoprotein YiaD [Escherichia coli H591]
 gi|331077586|gb|EGI48798.1| inner membrane lipoprotein YiaD [Escherichia coli H299]
 gi|332104471|gb|EGJ07817.1| OmpA family protein [Shigella sp. D9]
 gi|332345519|gb|AEE58853.1| inner membrane lipoprotein YiaD [Escherichia coli UMNK88]
          Length = 219

 Score =  131 bits (330), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 55/219 (25%), Positives = 95/219 (43%), Gaps = 36/219 (16%)

Query: 1   MIKELGLSMFI---MTTISGCGLASREKKKVF---LHKSNDTDIVNKRFGS--------- 45
           M K + L   +      +SGC       ++        +    +V    G+         
Sbjct: 1   MKKRVYLIAAVVSGALAVSGCTTNPYTGEREAGKSAIGAGLGSLVGAGIGALSSSKKDRG 60

Query: 46  -------------------SLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEV 86
                               +D  E + + +++ TG+ V+R GD I   +P +V+F S  
Sbjct: 61  KGALIGAAAGAALGGGVGYYMDVQEAKLRDKMRGTGVSVTRSGDNIILNMPNNVTFDSSS 120

Query: 87  -FLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRG 145
             L+      L  +A +L ++P T + +  +TDS G    N+ +SQ+RAD + S LI +G
Sbjct: 121 ATLKPAGANTLTGVAMVLKEYPKTAVNVIGYTDSTGGHDLNMRLSQQRADSVASALITQG 180

Query: 146 VSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           V ++R I  +G     PI +N T  G+  N+R+EI + P
Sbjct: 181 VDASR-IRTQGLGPANPIASNSTAEGKAQNRRVEITLSP 218


>gi|332996878|gb|EGK16497.1| inner membrane lipoprotein yiaD [Shigella flexneri K-272]
 gi|333013437|gb|EGK32809.1| inner membrane lipoprotein yiaD [Shigella flexneri K-227]
          Length = 219

 Score =  131 bits (330), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 55/219 (25%), Positives = 95/219 (43%), Gaps = 36/219 (16%)

Query: 1   MIKELGLSMFI---MTTISGCGLASREKKKVF---LHKSNDTDIVNKRFGS--------- 45
           M K + L   +      +SGC       ++        +    +V    G+         
Sbjct: 1   MKKRVYLIAAVVSGALAVSGCTTNPYTGEREAGKSAIGAGLGSLVGAGIGALSSSKKDRG 60

Query: 46  -------------------SLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEV 86
                               +D  E + + +++ TG+ V+R GD I   +P +V+F S  
Sbjct: 61  KGALIGAAAGAALGGGVGYYMDVQEAKLRDKMRGTGVSVTRSGDNIILNMPNNVTFDSSS 120

Query: 87  F-LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRG 145
             L+      L  +A +L ++P T + +  +TDS G    N+ +SQ+RAD + S LI +G
Sbjct: 121 APLKPAGANTLTGVAMVLKEYPKTAVNVIGYTDSTGGHDLNMRLSQQRADSVASALITQG 180

Query: 146 VSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           V ++R I  +G     PI +N T  G+  N+R+EI + P
Sbjct: 181 VDASR-IRTQGLGPANPIASNSTAEGKAQNRRVEITLSP 218


>gi|218660571|ref|ZP_03516501.1| outer membrane lipoprotein [Rhizobium etli IE4771]
          Length = 196

 Score =  131 bits (330), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 53/161 (32%), Positives = 86/161 (53%), Gaps = 2/161 (1%)

Query: 25  KKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV- 83
           K+   L  +    +     G+ +D+ E E + QL+ TGI V+R GD I   +P +++F  
Sbjct: 33  KRNAALIGAGIGALAGGAIGNYMDQQEAELRAQLEGTGISVTRNGDNIILNMPSNITFDV 92

Query: 84  SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQ 143
            +  ++  F P L  +A +L KF  T+I +  HTDS G+L++N  +SQ RA  +    + 
Sbjct: 93  DQDAVKPGFYPTLNSVAIVLRKFNRTLIDVNGHTDSTGSLQHNQDLSQRRALSVAD-YLG 151

Query: 144 RGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
                 R +S  GF    P+ +N ++ GR  N+R+EIQI P
Sbjct: 152 GQGIDQRRVSAVGFGPSQPVASNASEAGRAQNRRVEIQIAP 192


>gi|59801892|ref|YP_208604.1| hypothetical protein NGO1559 [Neisseria gonorrhoeae FA 1090]
 gi|260439855|ref|ZP_05793671.1| hypothetical protein NgonDG_01984 [Neisseria gonorrhoeae DGI2]
 gi|291043130|ref|ZP_06568853.1| conserved hypothetical protein [Neisseria gonorrhoeae DGI2]
 gi|59718787|gb|AAW90192.1| conserved hypothetical protein [Neisseria gonorrhoeae FA 1090]
 gi|291012736|gb|EFE04719.1| conserved hypothetical protein [Neisseria gonorrhoeae DGI2]
 gi|307075938|emb|CBE70801.1| outer membrane protein A [Neisseria gonorrhoeae]
          Length = 225

 Score =  131 bits (330), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 50/182 (27%), Positives = 79/182 (43%), Gaps = 2/182 (1%)

Query: 4   ELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGI 63
           +  +       + G   A     K   + +     +    G  +D  E   +  L  T I
Sbjct: 34  KSAMYGLGGAAVCGIVGALTHSGKGARNSALACGAIGAGVGGYMDYQEQRLRQNLAGTQI 93

Query: 64  VVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGT 122
            + R G+ I   +P  V+F      L       L   A  L ++P T + I  HTD+ G+
Sbjct: 94  EIQRQGNQIRLVMPESVTFATGSAALGGSAQYALNTAAQTLVQYPDTTLTINGHTDNTGS 153

Query: 123 LKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
              N  +SQ RA  +  YL  RGV+++R ++V G+    P+ +N T  GR  N+R+EI I
Sbjct: 154 DAVNNPLSQHRAQAVAYYLQTRGVAASR-LTVYGYGSHMPVASNATVEGRAQNRRVEILI 212

Query: 183 FP 184
            P
Sbjct: 213 NP 214


>gi|194430954|ref|ZP_03063247.1| OmpA family protein [Shigella dysenteriae 1012]
 gi|194420409|gb|EDX36485.1| OmpA family protein [Shigella dysenteriae 1012]
 gi|332085980|gb|EGI91144.1| inner membrane lipoprotein yiaD [Shigella dysenteriae 155-74]
          Length = 219

 Score =  131 bits (330), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 54/180 (30%), Positives = 93/180 (51%), Gaps = 2/180 (1%)

Query: 6   GLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVV 65
           GLS  +   I     + +++ K  L  +     +    G  +D  E + + +++ TG+ V
Sbjct: 40  GLSSLVGAGIGALSSSKKDRGKGALIGAAAGAALGGGVGYYMDVQEAKLRDKMRGTGVSV 99

Query: 66  SRIGDMITCYIPVHVSFVSEV-FLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLK 124
           +R GD I   +P +V+F S    L+      L  +A +L ++P T + +  +TDS G   
Sbjct: 100 TRSGDNIILNMPNNVTFDSSSATLKPAGANTLTGVAMVLKEYPKTAVNVIGYTDSTGGHD 159

Query: 125 NNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
            N+ +SQ+RAD + S LI +GV ++R I  +G     PI +N T  G+  N+R+EI + P
Sbjct: 160 LNMRLSQQRADSVASALITQGVDASR-IRTQGLGPANPIASNSTAEGKAQNRRVEITLSP 218


>gi|15964027|ref|NP_384380.1| hypothetical protein SMc00354 [Sinorhizobium meliloti 1021]
 gi|15073203|emb|CAC41711.1| Probable porin [Sinorhizobium meliloti 1021]
          Length = 221

 Score =  131 bits (330), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 58/218 (26%), Positives = 95/218 (43%), Gaps = 35/218 (16%)

Query: 1   MIKELGLSMFIMTTISGCGLASREKKKVFLHKSN-----------------DTDIVNKRF 43
           MIK+  +   +   +SGC        +  +  +                        +R 
Sbjct: 1   MIKKCAILAVVAVYLSGCTTTDPYTGEQKMSNTAGGALIGAGLGAATGLLVGGSAAGRRD 60

Query: 44  G----------------SSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSE-V 86
                            + +D+ E E + QLQ TG+ V+R GD I   +P +++F ++  
Sbjct: 61  AALVGAGIGALGGGLVGNYMDQQESELRAQLQGTGVSVTRAGDRIILNMPSNITFATDRD 120

Query: 87  FLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGV 146
            +   F   L  +A +L KF  T+I +  HTDS G+   N  +S+ RA  + +YL  R  
Sbjct: 121 QVIPAFYSTLDSVAIVLRKFNKTLIDVDGHTDSTGSASYNQGLSERRAASVANYLASR-G 179

Query: 147 SSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
              R +S  G+  + PI +N T+VGR  N+R+EI I P
Sbjct: 180 VDQRRMSAVGYGLERPIASNATEVGRAQNRRVEISIAP 217


>gi|260778449|ref|ZP_05887341.1| outer membrane protein [Vibrio coralliilyticus ATCC BAA-450]
 gi|260604613|gb|EEX30908.1| outer membrane protein [Vibrio coralliilyticus ATCC BAA-450]
          Length = 222

 Score =  131 bits (330), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 57/221 (25%), Positives = 101/221 (45%), Gaps = 39/221 (17%)

Query: 2   IKELGLSMFIMTTISGCGLASREKKKVFLHKSND-------------------TDIVNKR 42
           +K++ L++ +   +SGC    R+       ++N                     D   +R
Sbjct: 1   MKKMTLALAVAIALSGCQATQRQNATTGESETNSVTKGALLGALAGAAVGLATGDDATER 60

Query: 43  FG-----------------SSLDKAEDEFQMQLQDTGIVVSRIG-DMITCYIPVHV-SFV 83
                                 D+ E   + +L D+G+ V R+G + +   +   +    
Sbjct: 61  RQHALIGAAGGAAVGGGVGYYFDQQEAALRKELLDSGVQVERVGENQLMLRMENGIGFQT 120

Query: 84  SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQ 143
               L+      L+ +A IL ++P T + I+ HTDS G+   N ++S+ RA+ ++SYLI 
Sbjct: 121 GSYNLDPSIHNTLRGVAKILVEYPDTSLVIEGHTDSTGSDTTNQVLSERRAESVRSYLIS 180

Query: 144 RGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           +GV+S R I  RG   ++P+ TN+T  GR  N+R+EI+I P
Sbjct: 181 QGVASGRAI-ARGNGERFPLCTNNTSEGRACNRRVEIKILP 220


>gi|91213065|ref|YP_543051.1| putative outer membrane lipoprotein [Escherichia coli UTI89]
 gi|117625836|ref|YP_859159.1| putative outer membrane lipoprotein [Escherichia coli APEC O1]
 gi|218560629|ref|YP_002393542.1| outer membrane lipoprotein [Escherichia coli S88]
 gi|306816094|ref|ZP_07450232.1| putative outer membrane lipoprotein [Escherichia coli NC101]
 gi|331649382|ref|ZP_08350468.1| inner membrane lipoprotein YiaD [Escherichia coli M605]
 gi|91074639|gb|ABE09520.1| putative outer membrane protein [Escherichia coli UTI89]
 gi|115514960|gb|ABJ03035.1| conserved hypothetical protein [Escherichia coli APEC O1]
 gi|218367398|emb|CAR05180.1| putative outer membrane lipoprotien [Escherichia coli S88]
 gi|281180597|dbj|BAI56927.1| conserved hypothetical protein [Escherichia coli SE15]
 gi|294489870|gb|ADE88626.1| OmpA family protein [Escherichia coli IHE3034]
 gi|305850490|gb|EFM50947.1| putative outer membrane lipoprotein [Escherichia coli NC101]
 gi|307628634|gb|ADN72938.1| putative outer membrane lipoprotein [Escherichia coli UM146]
 gi|323949796|gb|EGB45680.1| OmpA family protein [Escherichia coli H252]
 gi|330909615|gb|EGH38129.1| outer membrane protein A precursor [Escherichia coli AA86]
 gi|331041880|gb|EGI14024.1| inner membrane lipoprotein YiaD [Escherichia coli M605]
          Length = 219

 Score =  131 bits (330), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 55/219 (25%), Positives = 96/219 (43%), Gaps = 36/219 (16%)

Query: 1   MIKELGLSMFI---MTTISGCGLASREKKKVF---LHKSNDTDIVNKRFGS--------- 45
           M K + L   +      +SGC       ++        +    +V    G+         
Sbjct: 1   MKKRVYLIAAVVSGALAVSGCTTNPYTGEREAGKSAIGAGLGSLVGAGIGALSSSKKDRG 60

Query: 46  -------------------SLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEV 86
                               +D  E + + +++ TG+ V+R GD I   +P +V+F S  
Sbjct: 61  KGALIGAAAGAALGGGVGYYMDVQEAKLRDKMRGTGVSVTRSGDNIILNMPNNVTFDSSS 120

Query: 87  -FLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRG 145
             L+      L  +A +L ++P T + +  +TDS G+   N+ +SQ+RAD + S LI +G
Sbjct: 121 ATLKPAGANTLTGVAMVLKEYPKTAVNVIGYTDSTGSHDLNMRLSQQRADSVASALITQG 180

Query: 146 VSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           V ++R I  +G     PI +N T  G+  N+R+EI + P
Sbjct: 181 VDASR-IRTQGLGPANPIASNSTAEGKAQNRRVEITLSP 218


>gi|332995852|gb|AEF05907.1| outer membrane protein and related peptidoglycan-associated
           (lipo)protein [Alteromonas sp. SN2]
          Length = 202

 Score =  131 bits (330), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 48/199 (24%), Positives = 87/199 (43%), Gaps = 24/199 (12%)

Query: 9   MFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGS----------------------S 46
           M     ++GC       +K     +    ++ K  G                        
Sbjct: 1   MAASLAVAGCANDPSNSQKGAAIGAVMGALIGKATGDNDKSRYAWGAAVGAIAGGAIGGY 60

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
           +DK E+  + +L DTG+ V R GD +   +P  ++F      +   F P+LQ +A ++N 
Sbjct: 61  MDKQEEALRSELSDTGVQVVREGDNLRLIMPGDITFATDSSSISPNFNPVLQDVAKVVNN 120

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +  TV+ I+ HTD  G+ + N  +S+ RA  +++ ++     ++  I+  G     P   
Sbjct: 121 YEKTVLMIKGHTDDTGSEQYNQGLSERRAGAVRN-VLLNYSVNSTRITTVGMGEYQPKVP 179

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           NDT   R  N+R+E++I P
Sbjct: 180 NDTAANRSMNRRVELEIQP 198


>gi|59713511|ref|YP_206286.1| outer membrane lipoprotein [Vibrio fischeri ES114]
 gi|197337177|ref|YP_002157921.1| inner membrane lipoprotein YiaD [Vibrio fischeri MJ11]
 gi|59481759|gb|AAW87398.1| predicted outer membrane lipoprotein [Vibrio fischeri ES114]
 gi|197314429|gb|ACH63878.1| inner membrane lipoprotein YiaD [Vibrio fischeri MJ11]
          Length = 222

 Score =  131 bits (330), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 51/221 (23%), Positives = 98/221 (44%), Gaps = 39/221 (17%)

Query: 2   IKELGLSMFIMTTISGC-------GLASREKKKVFLHKSNDTDIVNKRFG---------- 44
           +K++ +++ ++ +++GC             +            +     G          
Sbjct: 1   MKKITIALALLISLTGCQATQRQNATTGESETNSATKGVLAGALAGVAIGLATGDNAKER 60

Query: 45  -------------------SSLDKAEDEFQMQLQDTGIVVSRIG-DMITCYIPVHVSFVS 84
                                 D+ E   + +L+ +G+ V R+G + +   +   + F S
Sbjct: 61  RKNALIGAAAGGAVGGGVGYYFDQQEKALRNELKSSGVQVERVGKNELKLVMDNGIGFQS 120

Query: 85  EVF-LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQ 143
             + L+      L  +A IL ++P T + I  HTDS G    N  +S++RAD +++YLI+
Sbjct: 121 SSYQLDASIYNTLNGVARILVEYPDTALQIDGHTDSSGNATKNQTLSEQRADSVRTYLIK 180

Query: 144 RGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           + V++ R ++ RG+  +YP+  N TK GR  N+R+EI I P
Sbjct: 181 QDVAAGR-VNARGYGARYPVCDNSTKQGRACNRRVEITILP 220


>gi|291615624|ref|YP_003518366.1| YiaD [Pantoea ananatis LMG 20103]
 gi|291150654|gb|ADD75238.1| YiaD [Pantoea ananatis LMG 20103]
          Length = 237

 Score =  131 bits (330), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 48/180 (26%), Positives = 90/180 (50%), Gaps = 2/180 (1%)

Query: 6   GLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVV 65
           GL   +   +     + +++ K  L  +     +    G  +D  E + + +++ TG+ V
Sbjct: 57  GLGALVGAGVGVLSSSKKDRGKGALIGAASGAALGGGVGYYMDVQEAKLRDKMKGTGVSV 116

Query: 66  SRIGDMITCYIPVHVSFVSEVF-LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLK 124
           +R GD I   +P +V+F S    L+      L  +A +L ++P T + +  HTDS G+  
Sbjct: 117 TRQGDNIVLNMPNNVTFDSSSSSLKPAGANTLTGVAMVLKEYPKTAVNVVGHTDSTGSRA 176

Query: 125 NNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
            N+ +SQ+RA+ + S LI +   +   +  +G     P+ TN T+ G+  N+R+EI + P
Sbjct: 177 LNMRLSQQRAESVASALIVQ-GVAGNRLHTQGAGPDSPVATNSTEAGKAQNRRVEITLSP 235


>gi|154250728|ref|YP_001411552.1| OmpA/MotB domain-containing protein [Parvibaculum lavamentivorans
           DS-1]
 gi|154154678|gb|ABS61895.1| OmpA/MotB domain protein [Parvibaculum lavamentivorans DS-1]
          Length = 224

 Score =  131 bits (330), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 53/164 (32%), Positives = 93/164 (56%), Gaps = 2/164 (1%)

Query: 22  SREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVS 81
           S ++++  +  +    +     G  +DK E E   +L+ +G+ V+R+G+ I   +P +V+
Sbjct: 58  STDRRQRAMIGAGIGALAGGGVGYYMDKQEAELTQRLRASGVSVTRVGNDIILNMPGNVT 117

Query: 82  F-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSY 140
           F  +   +  KF  +L  +A +L ++  T+I +  HTDS G+ + NL +SQ+RA  + SY
Sbjct: 118 FATNSSDINAKFYDVLNSVAIVLKEYDKTLIDVTGHTDSTGSDQYNLELSQKRAQSVASY 177

Query: 141 LIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           LI + V  +R   + G     PI TNDT  GR+ N+R+EI++ P
Sbjct: 178 LIGQSVD-SRRFYIVGAGESQPIATNDTPQGREQNRRVEIRLSP 220


>gi|332996326|gb|EGK15953.1| inner membrane lipoprotein yiaD [Shigella flexneri VA-6]
          Length = 219

 Score =  131 bits (329), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 55/219 (25%), Positives = 94/219 (42%), Gaps = 36/219 (16%)

Query: 1   MIKELGLSMFI---MTTISGCGLASREKKKVF---LHKSNDTDIVNKRFG---------- 44
           M K + L   +      +SGC       ++        +    +V    G          
Sbjct: 1   MKKRVYLIAAVVSGALAVSGCTTNPYTGEREAGKSAIGAGLGSLVGAGIGVLSSSKKDRG 60

Query: 45  ------------------SSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEV 86
                               +D  E + + +++ TG+ V+R GD I   +P +V+F S  
Sbjct: 61  KGALIGAAAGAALGGGVGYYMDVQEAKLRDKMRGTGVSVTRSGDNIILNMPNNVTFDSSS 120

Query: 87  F-LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRG 145
             L+      L  +A +L ++P T + +  +TDS G    N+ +SQ+RAD + S LI +G
Sbjct: 121 APLKPAGANTLTGVAMVLKEYPKTAVNVIGYTDSTGGHDLNMRLSQQRADSVASALITQG 180

Query: 146 VSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           V ++R I  +G     PI +N T  G+  N+R+EI + P
Sbjct: 181 VDASR-IRTQGLGPANPIASNSTAEGKAQNRRVEITLSP 218


>gi|94496613|ref|ZP_01303189.1| OmpA/MotB [Sphingomonas sp. SKA58]
 gi|94423973|gb|EAT08998.1| OmpA/MotB [Sphingomonas sp. SKA58]
          Length = 226

 Score =  131 bits (329), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 45/140 (32%), Positives = 76/140 (54%), Gaps = 2/140 (1%)

Query: 46  SLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILN 104
            +D  E + + +   TG+ V R GD +   +P  ++F      ++ +F P L  +A++L 
Sbjct: 80  YMDAQERKLREETAGTGVDVIRDGDNLLLRMPSGITFGYDRADVQPQFQPTLNDVASVLA 139

Query: 105 KFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPID 164
           ++P T I +  HTDS G+   N  +S+ RA  + +YL+ R    +  I  RGF    PI 
Sbjct: 140 QYPKTYIDVYGHTDSDGSDAYNQTLSERRAQAVANYLVGR-GVQSARIGTRGFGETQPIA 198

Query: 165 TNDTKVGRQNNQRIEIQIFP 184
           +N T+ G+  N+R+EI+I P
Sbjct: 199 SNATEEGKAANRRVEIKIAP 218


>gi|307301173|ref|ZP_07580935.1| OmpA/MotB domain protein [Sinorhizobium meliloti BL225C]
 gi|307321074|ref|ZP_07600479.1| OmpA/MotB domain protein [Sinorhizobium meliloti AK83]
 gi|306893246|gb|EFN24027.1| OmpA/MotB domain protein [Sinorhizobium meliloti AK83]
 gi|306903629|gb|EFN34216.1| OmpA/MotB domain protein [Sinorhizobium meliloti BL225C]
          Length = 227

 Score =  131 bits (329), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 58/218 (26%), Positives = 95/218 (43%), Gaps = 35/218 (16%)

Query: 1   MIKELGLSMFIMTTISGCGLASREKKKVFLHKSN-----------------DTDIVNKRF 43
           MIK+  +   +   +SGC        +  +  +                        +R 
Sbjct: 7   MIKKCAILAVVAVYLSGCTTTDPYTGEQKMSNTAGGALIGAGLGAATGLLVGGSAAGRRD 66

Query: 44  G----------------SSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSE-V 86
                            + +D+ E E + QLQ TG+ V+R GD I   +P +++F ++  
Sbjct: 67  AALVGAGIGALGGGLVGNYMDQQESELRAQLQGTGVSVTRAGDRIILNMPSNITFATDRD 126

Query: 87  FLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGV 146
            +   F   L  +A +L KF  T+I +  HTDS G+   N  +S+ RA  + +YL  R  
Sbjct: 127 QVIPAFYSTLDSVAIVLRKFNKTLIDVDGHTDSTGSASYNQGLSERRAASVANYLASR-G 185

Query: 147 SSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
              R +S  G+  + PI +N T+VGR  N+R+EI I P
Sbjct: 186 VDQRRMSAVGYGLERPIASNATEVGRAQNRRVEISIAP 223


>gi|304391383|ref|ZP_07373325.1| inner membrane lipoprotein YiaD [Ahrensia sp. R2A130]
 gi|303295612|gb|EFL89970.1| inner membrane lipoprotein YiaD [Ahrensia sp. R2A130]
          Length = 219

 Score =  131 bits (329), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 50/218 (22%), Positives = 97/218 (44%), Gaps = 36/218 (16%)

Query: 2   IKELGL-SMFIMTTISGCGL---------------------------------ASREKKK 27
           +K + L  +     +S C                                      + +K
Sbjct: 1   MKNMILPVLLAAGLVSACTTDPYTGQQKVSNTAIGVGGGAALGALGGLIVGKTTGADTRK 60

Query: 28  VFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV-SEV 86
             L  +    I     G   D  E + + +LQ+TG+ VSR+G+ I   +P +++F     
Sbjct: 61  AVLIGAGIGAIGGGGVGLYQDNQEAKLRAELQNTGVSVSRVGNDIVLNMPSNITFNSGSA 120

Query: 87  FLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGV 146
            L+ +F  +L  +A +L ++  T++ +  HTDS G+ + N  +S+ R   +  YL+Q+  
Sbjct: 121 DLKAQFFRVLNSVALVLKEYNKTLVNVSGHTDSDGSDQFNQQLSERRGVNVAQYLVQQ-G 179

Query: 147 SSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           + +R   V G+  + PI +N +  G++ N+R+EI++ P
Sbjct: 180 TDSRRYYVVGYGEERPIASNASAAGKEQNRRVEIRLSP 217


>gi|293412987|ref|ZP_06655655.1| conserved hypothetical protein [Escherichia coli B354]
 gi|291468634|gb|EFF11127.1| conserved hypothetical protein [Escherichia coli B354]
          Length = 219

 Score =  131 bits (329), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 55/219 (25%), Positives = 94/219 (42%), Gaps = 36/219 (16%)

Query: 1   MIKELGLSMFI---MTTISGCGLASREKKKVF---LHKSNDTDIVNKRFGS--------- 45
           M K + L   +      +SGC       ++        +    +V    G+         
Sbjct: 1   MKKRVYLIAAVVSGALAVSGCTTNPYTGEREAGKSAIGAGLGSLVGAGIGALSSSKKDRG 60

Query: 46  -------------------SLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEV 86
                               +D  E + + +++ TG+ V+R GD I   +P +V+F S  
Sbjct: 61  KGALIGAAAGAALGGGVGYYMDVQEAKLRDKMRGTGVSVTRSGDNIILNMPNNVTFDSSS 120

Query: 87  -FLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRG 145
             L+      L  +A +L ++P T + +  +TDS G    N+ +SQ+RAD + S LI +G
Sbjct: 121 ATLKPAGANTLTGVAMVLKEYPKTAVNVIGYTDSTGGHDLNMRLSQQRADSVASALITQG 180

Query: 146 VSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           V + R I  +G     PI +N T  G+  N+R+EI + P
Sbjct: 181 VDAGR-IRTQGLGPANPIASNSTAEGKAQNRRVEITLSP 218


>gi|283787805|ref|YP_003367670.1| outer membrane protein [Citrobacter rodentium ICC168]
 gi|282951259|emb|CBG90953.1| putative outer membrane protein [Citrobacter rodentium ICC168]
          Length = 220

 Score =  131 bits (329), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 53/180 (29%), Positives = 90/180 (50%), Gaps = 2/180 (1%)

Query: 6   GLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVV 65
           G+   +   I     + +++ K  L  +     +    G  +D  E + + ++Q TG+ V
Sbjct: 40  GIGSLVGAGIGALSSSKKDRGKGALIGAAAGAALGGGAGYYMDVQEAKLRDKMQGTGVSV 99

Query: 66  SRIGDMITCYIPVHVSFVSEV-FLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLK 124
           +R GD I   +P +V+F S    L+      L  +A +L ++P T + +  +TDS G   
Sbjct: 100 TRSGDNIILNMPNNVTFDSSSATLKPAGANTLTGVAMVLKEYPKTAVNVIGYTDSTGGQD 159

Query: 125 NNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
            N+ +SQ+RAD + S LI +GV + R I   G     PI +N T  G+  N+R+EI + P
Sbjct: 160 LNMRLSQQRADSVASALITQGVEAGR-IRTSGMGPANPIASNSTAEGKAQNRRVEITLSP 218


>gi|295691294|ref|YP_003594987.1| OmpA/MotB domain-containing protein [Caulobacter segnis ATCC 21756]
 gi|295433197|gb|ADG12369.1| OmpA/MotB domain protein [Caulobacter segnis ATCC 21756]
          Length = 224

 Score =  131 bits (329), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 49/221 (22%), Positives = 90/221 (40%), Gaps = 37/221 (16%)

Query: 1   MIKELGLSMFI--MTTISGCGLAS----------------------------------RE 24
           M ++  L+  +     +  C                                       +
Sbjct: 1   MTRKFALAAVLVGAGALVACTTTDPYTGMPVRNNTGTGVLAGAGAGALLGYLTNTNKGEQ 60

Query: 25  KKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV- 83
            +K  L  +    +     G+ +D+ + +F+  L+ +G+++ R GD I   +P  V+F  
Sbjct: 61  GRKNALIGAGIGALAGGAVGNYMDRQQADFRRSLEGSGVMIRRNGDQIVLVMPSDVTFDV 120

Query: 84  SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQ 143
               ++ +F+ +L  +A  LN +P T I +  H DS G  + N ++S+ RA  +  YL  
Sbjct: 121 DRSDIQPRFVRVLDDVARTLNAYPQTTIDVVGHADSSGADEYNQVLSERRASAVAGYLTS 180

Query: 144 RGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           +G      + V G   + PI  N T  GR  N+R+EI + P
Sbjct: 181 QGRVLPDRVFVAGMGERQPIADNSTAAGRAENRRVEIVLRP 221


>gi|110807356|ref|YP_690876.1| putative outer membrane lipoprotein [Shigella flexneri 5 str. 8401]
 gi|229088112|ref|NP_709330.3| putative outer membrane lipoprotein [Shigella flexneri 2a str. 301]
 gi|229089132|ref|NP_839340.2| putative outer membrane lipoprotein [Shigella flexneri 2a str.
           2457T]
 gi|110616904|gb|ABF05571.1| putative outer membrane protein [Shigella flexneri 5 str. 8401]
 gi|281602912|gb|ADA75896.1| putative outer membrane protein [Shigella flexneri 2002017]
 gi|313647591|gb|EFS12041.1| inner membrane lipoprotein yiaD [Shigella flexneri 2a str. 2457T]
 gi|332750012|gb|EGJ80424.1| inner membrane lipoprotein yiaD [Shigella flexneri K-671]
 gi|332750169|gb|EGJ80580.1| inner membrane lipoprotein yiaD [Shigella flexneri 4343-70]
 gi|332751243|gb|EGJ81646.1| inner membrane lipoprotein yiaD [Shigella flexneri 2747-71]
 gi|332997456|gb|EGK17072.1| inner membrane lipoprotein yiaD [Shigella flexneri K-218]
 gi|333012432|gb|EGK31813.1| inner membrane lipoprotein yiaD [Shigella flexneri K-304]
          Length = 216

 Score =  131 bits (329), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 53/180 (29%), Positives = 92/180 (51%), Gaps = 2/180 (1%)

Query: 6   GLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVV 65
           GL   +   I     + +++ K  L  +     +    G  +D  E + + +++ TG+ V
Sbjct: 37  GLGSLVGAGIGALSSSKKDRGKGALIGAAAGAALGGGVGYYMDVQEAKLRDKMRGTGVSV 96

Query: 66  SRIGDMITCYIPVHVSFVSEVF-LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLK 124
           +R GD I   +P +V+F S    L+      L  +A +L ++P T + +  +TDS G   
Sbjct: 97  TRSGDNIILNMPNNVTFDSSSAPLKPAGANTLTGVAMVLKEYPKTAVNVIGYTDSTGGHD 156

Query: 125 NNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
            N+ +SQ+RAD + S LI +GV ++R I  +G     PI +N T  G+  N+R+EI + P
Sbjct: 157 LNMRLSQQRADSVASALITQGVDASR-IRTQGLGPANPIASNSTAEGKAQNRRVEITLSP 215


>gi|30043431|gb|AAP19151.1| putative outer membrane protein [Shigella flexneri 2a str. 2457T]
 gi|56383924|gb|AAN45037.2| putative outer membrane protein [Shigella flexneri 2a str. 301]
 gi|332763439|gb|EGJ93678.1| ompA family protein [Shigella flexneri 2930-71]
          Length = 208

 Score =  130 bits (328), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 53/180 (29%), Positives = 92/180 (51%), Gaps = 2/180 (1%)

Query: 6   GLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVV 65
           GL   +   I     + +++ K  L  +     +    G  +D  E + + +++ TG+ V
Sbjct: 29  GLGSLVGAGIGALSSSKKDRGKGALIGAAAGAALGGGVGYYMDVQEAKLRDKMRGTGVSV 88

Query: 66  SRIGDMITCYIPVHVSFVSEVF-LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLK 124
           +R GD I   +P +V+F S    L+      L  +A +L ++P T + +  +TDS G   
Sbjct: 89  TRSGDNIILNMPNNVTFDSSSAPLKPAGANTLTGVAMVLKEYPKTAVNVIGYTDSTGGHD 148

Query: 125 NNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
            N+ +SQ+RAD + S LI +GV ++R I  +G     PI +N T  G+  N+R+EI + P
Sbjct: 149 LNMRLSQQRADSVASALITQGVDASR-IRTQGLGPANPIASNSTAEGKAQNRRVEITLSP 207


>gi|315180390|gb|ADT87304.1| lipoprotein, hypothetical [Vibrio furnissii NCTC 11218]
          Length = 222

 Score =  130 bits (328), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 56/221 (25%), Positives = 102/221 (46%), Gaps = 39/221 (17%)

Query: 2   IKELGLSMFIMTTISGCGLASREKKKVFLHKSNDTD------------------------ 37
           +K++ L++ ++  +SGC    R+       ++N                           
Sbjct: 1   MKKITLALAVLIALSGCAATQRQNATTGETETNSATKGALLGALAGAAVGLASGDDAKER 60

Query: 38  ------------IVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIG-DMITCYIPVHVSFVS 84
                        V    G   D+ E   + +L ++G+ V R+G + +   +   + F +
Sbjct: 61  RQRALIGAAGGAAVGGGVGYYFDQQEAALRQELLNSGVQVERVGENQLVLRMQNGIGFQT 120

Query: 85  EVF-LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQ 143
             + L+      L+ +A IL ++P T + I  HTDS G+   N ++S+ RA+ ++S+L+ 
Sbjct: 121 NSYQLDSSIHNTLRGVAKILVEYPDTSLVIDGHTDSTGSDTTNQILSERRAESVRSFLLS 180

Query: 144 RGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           +GV++ R I  RG   +YP+ TN T  GR  N+R+EIQI P
Sbjct: 181 QGVAAGRAI-ARGNGERYPLCTNSTADGRSCNRRVEIQILP 220


>gi|120555732|ref|YP_960083.1| OmpA/MotB domain-containing protein [Marinobacter aquaeolei VT8]
 gi|120325581|gb|ABM19896.1| OmpA/MotB domain protein [Marinobacter aquaeolei VT8]
          Length = 236

 Score =  130 bits (328), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 56/216 (25%), Positives = 99/216 (45%), Gaps = 35/216 (16%)

Query: 3   KELGLSMFIMTT-ISGC--------------------------------GLASREKKKVF 29
           K+  L+  + T  +SGC                                  +S ++ K  
Sbjct: 20  KKTILAFAVATVGLSGCMTYDPYTGEEKTSNATKGSIIGAIGGAAIGAATSSSSDRGKGA 79

Query: 30  LHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV-SEVFL 88
           L  +     V    G  +D+ E + + +L+ TG+ V R GD I   +P +++F   +  +
Sbjct: 80  LIGAAGGAAVGGGIGYYMDRQEAQLRQKLEGTGVRVVRNGDQIDLIMPGNITFDTDQSTI 139

Query: 89  EKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSS 148
              F   L+ +A +L +F  T+I I+ HTDS G+   N L+S+ RA  ++ +L+ +    
Sbjct: 140 RSGFTGTLESVALVLKEFDKTIIQIEGHTDSTGSDSYNQLLSERRASSVRDFLLNQ-GIE 198

Query: 149 NRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
            R     G+  +YPI +NDT  GR+ N+R+E+ + P
Sbjct: 199 PRRTRATGYGERYPIASNDTAAGREQNRRVELTLVP 234


>gi|323497435|ref|ZP_08102453.1| putative outer membrane protein [Vibrio sinaloensis DSM 21326]
 gi|323317518|gb|EGA70511.1| putative outer membrane protein [Vibrio sinaloensis DSM 21326]
          Length = 222

 Score =  130 bits (328), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 56/221 (25%), Positives = 98/221 (44%), Gaps = 39/221 (17%)

Query: 2   IKELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFG----------------- 44
           +K++ L++ +   +SGC    R+       ++N T                         
Sbjct: 1   MKKITLALAVAIALSGCQATQRQNATTGESETNSTTTGAIIGALAGAAVGVATGDDAKDR 60

Query: 45  -------------------SSLDKAEDEFQMQLQDTGIVVSRIG-DMITCYIPVHVSFVS 84
                                 DK E+  + +L ++G+ V R+G + +   +   + F +
Sbjct: 61  RKRALIGATGGAVVGGGVGYYFDKQEEALRQELLNSGVQVERVGENQLLLRLENGIGFAT 120

Query: 85  EV-FLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQ 143
               L+      L  +A IL ++P T + I   TDS G+   N L+S+ RA+ ++SYL+ 
Sbjct: 121 ASHTLDSGIRNTLNGVARILVEYPDTSLVIDGFTDSTGSDTTNQLLSERRAESVRSYLVS 180

Query: 144 RGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           +GV++ R I  RG   ++P+ TN T  GR  N+R+EIQI P
Sbjct: 181 QGVAAGRAI-ARGNGERHPLCTNSTAEGRACNRRVEIQILP 220


>gi|92115424|ref|YP_575352.1| OmpA/MotB [Chromohalobacter salexigens DSM 3043]
 gi|91798514|gb|ABE60653.1| OmpA/MotB [Chromohalobacter salexigens DSM 3043]
          Length = 226

 Score =  130 bits (328), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 45/167 (26%), Positives = 79/167 (47%), Gaps = 2/167 (1%)

Query: 19  GLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPV 78
           G  S  ++   L  +     +    G+ +D  E++ +  L  TGI V R GD I   +P 
Sbjct: 56  GDGSTSRRDRALIGAAAGAAIGGGVGAYMDAQEEKLRRDLDGTGIGVDRQGDNIVLNMPS 115

Query: 79  HVSFV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVI 137
            V+F      L+      L     ++ ++P T I +  +TDS G+   N  +S+ RA  +
Sbjct: 116 SVTFDVDSSALKTPARQALNDATAVMREYPKTRINVAGYTDSTGSADYNQRLSERRAQAV 175

Query: 138 KSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
               + +G  +   I+  G+  + P+ +NDT+ GR  N+R+EI + P
Sbjct: 176 AD-YLGQGGIAANRINTVGYGERQPVASNDTESGRAQNRRVEITLTP 221


>gi|254038735|ref|ZP_04872791.1| conserved hypothetical protein [Escherichia sp. 1_1_43]
 gi|226839241|gb|EEH71264.1| conserved hypothetical protein [Escherichia sp. 1_1_43]
 gi|309703955|emb|CBJ03298.1| putative outer membrane protein [Escherichia coli ETEC H10407]
          Length = 219

 Score =  130 bits (328), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 55/219 (25%), Positives = 96/219 (43%), Gaps = 36/219 (16%)

Query: 1   MIKELGLSMFI---MTTISGCGLASREKKKVF---LHKSNDTDIVNKRFGS--------- 45
           M K + L   +      +SGC       ++        ++   +V    G+         
Sbjct: 1   MKKRVYLIAAVVSGALAVSGCTTNPYTGEREAGKSAIGASLGSLVGAGIGALSSSKKDRG 60

Query: 46  -------------------SLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEV 86
                               +D  E + + +++ TG+ V+R GD I   +P +V+F S  
Sbjct: 61  KGALIGAAAGAALGGGVGYYMDVQEAKLRDKMRGTGVSVTRSGDNIILNMPNNVTFDSSS 120

Query: 87  -FLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRG 145
             L+      L  +A +L ++P T + +  +TDS G    N+ +SQ+RAD + S LI +G
Sbjct: 121 ATLKPAGANTLTGVAMVLKEYPKTAVNVIGYTDSTGGHDLNMRLSQQRADSVASALITQG 180

Query: 146 VSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           V ++R I  +G     PI +N T  G+  N+R+EI + P
Sbjct: 181 VDASR-IRTQGLGPANPIASNSTAEGKAQNRRVEITLSP 218


>gi|16124456|ref|NP_419020.1| OmpA family protein [Caulobacter crescentus CB15]
 gi|221233140|ref|YP_002515576.1| outer membrane protein [Caulobacter crescentus NA1000]
 gi|13421324|gb|AAK22188.1| OmpA family protein [Caulobacter crescentus CB15]
 gi|220962312|gb|ACL93668.1| outer membrane protein [Caulobacter crescentus NA1000]
          Length = 226

 Score =  130 bits (328), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 46/215 (21%), Positives = 80/215 (37%), Gaps = 35/215 (16%)

Query: 5   LGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFG-------------------- 44
           L + +     ++ C            + +    +     G                    
Sbjct: 10  LAVVLMSAGALAACTTTDPYTGMPVRNNTGTGALTGAGVGAVLGYLTNTNKGEQGRKNAL 69

Query: 45  --------------SSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV-SEVFLE 89
                         + +D+ + +F+  L+ +G+++ R GD I   +P  V+F      ++
Sbjct: 70  IGAGIGALAGGAIGNYMDRQQADFRRSLEGSGVMIRRNGDQIVLVMPSDVTFAVDRSDVQ 129

Query: 90  KKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSN 149
             F  +L  +A  LN +P T I +  H DS G    N  +S+ RA  +  YL   G    
Sbjct: 130 PPFTRVLDDVARTLNAYPQTTIDVVGHADSSGPDDYNQTLSERRASAVAGYLTGPGGVLV 189

Query: 150 RFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
             + V G   + PI  N T  GR  N+R+EI + P
Sbjct: 190 DRVFVAGMGERAPIADNATADGRAQNRRVEIILRP 224


>gi|268595437|ref|ZP_06129604.1| ompA family protein [Neisseria gonorrhoeae 35/02]
 gi|268597225|ref|ZP_06131392.1| conserved hypothetical protein [Neisseria gonorrhoeae FA19]
 gi|268599401|ref|ZP_06133568.1| OmpA/MotB domain-containing protein [Neisseria gonorrhoeae MS11]
 gi|268601994|ref|ZP_06136161.1| OmpA/MotB domain-containing protein [Neisseria gonorrhoeae PID18]
 gi|268604326|ref|ZP_06138493.1| OmpA/MotB domain-containing protein [Neisseria gonorrhoeae PID1]
 gi|268682782|ref|ZP_06149644.1| OmpA/MotB domain-containing protein [Neisseria gonorrhoeae PID332]
 gi|268684809|ref|ZP_06151671.1| OmpA/MotB domain-containing protein [Neisseria gonorrhoeae
           SK-92-679]
 gi|268687209|ref|ZP_06154071.1| OmpA/MotB domain-containing protein [Neisseria gonorrhoeae
           SK-93-1035]
 gi|268548826|gb|EEZ44244.1| ompA family protein [Neisseria gonorrhoeae 35/02]
 gi|268551013|gb|EEZ46032.1| conserved hypothetical protein [Neisseria gonorrhoeae FA19]
 gi|268583532|gb|EEZ48208.1| OmpA/MotB domain-containing protein [Neisseria gonorrhoeae MS11]
 gi|268586125|gb|EEZ50801.1| OmpA/MotB domain-containing protein [Neisseria gonorrhoeae PID18]
 gi|268588457|gb|EEZ53133.1| OmpA/MotB domain-containing protein [Neisseria gonorrhoeae PID1]
 gi|268623066|gb|EEZ55466.1| OmpA/MotB domain-containing protein [Neisseria gonorrhoeae PID332]
 gi|268625093|gb|EEZ57493.1| OmpA/MotB domain-containing protein [Neisseria gonorrhoeae
           SK-92-679]
 gi|268627493|gb|EEZ59893.1| OmpA/MotB domain-containing protein [Neisseria gonorrhoeae
           SK-93-1035]
          Length = 216

 Score =  130 bits (328), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 50/182 (27%), Positives = 79/182 (43%), Gaps = 2/182 (1%)

Query: 4   ELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGI 63
           +  +       + G   A     K   + +     +    G  +D  E   +  L  T I
Sbjct: 25  KSAMYGLGGAAVCGIVGALTHSGKGARNSALACGAIGAGVGGYMDYQEQRLRQNLAGTQI 84

Query: 64  VVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGT 122
            + R G+ I   +P  V+F      L       L   A  L ++P T + I  HTD+ G+
Sbjct: 85  EIQRQGNQIRLVMPESVTFATGSAALGGSAQYALNTAAQTLVQYPDTTLTINGHTDNTGS 144

Query: 123 LKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
              N  +SQ RA  +  YL  RGV+++R ++V G+    P+ +N T  GR  N+R+EI I
Sbjct: 145 DAVNNPLSQHRAQAVAYYLQTRGVAASR-LTVYGYGSHMPVASNATVEGRAQNRRVEILI 203

Query: 183 FP 184
            P
Sbjct: 204 NP 205


>gi|294782159|ref|ZP_06747485.1| OmpA family protein [Fusobacterium sp. 1_1_41FAA]
 gi|294480800|gb|EFG28575.1| OmpA family protein [Fusobacterium sp. 1_1_41FAA]
          Length = 212

 Score =  130 bits (328), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 47/163 (28%), Positives = 76/163 (46%), Gaps = 2/163 (1%)

Query: 23  REKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF 82
            +  K  L  +    ++   +G+  D    E +  L+ T   V   G+ +   +P  V+F
Sbjct: 49  GKDTKGTLIGAAVGSLLGMGWGAYKDNQARELKAALKGTQAEVRNDGNALVVNLPGGVTF 108

Query: 83  -VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYL 141
                 +   F   L  +A  L ++P T I +  +TDS G   +N  +SQ RA+ +  YL
Sbjct: 109 ASDSANISSGFYSALNGVAQTLVRYPETRIQVNGYTDSTGGDAHNQELSQRRANSVAQYL 168

Query: 142 IQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           I +   S+  I   GF    PI +N T  GRQ N+R+E++I P
Sbjct: 169 ISQ-GVSSNRIVANGFGSLNPIASNATPEGRQANRRVEVRILP 210


>gi|222035267|emb|CAP78012.1| Inner membrane lipoprotein yiad [Escherichia coli LF82]
 gi|312948118|gb|ADR28945.1| putative outer membrane lipoprotein [Escherichia coli O83:H1 str.
           NRG 857C]
 gi|320193935|gb|EFW68568.1| Outer membrane protein A precursor [Escherichia coli WV_060327]
          Length = 219

 Score =  130 bits (327), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 55/219 (25%), Positives = 96/219 (43%), Gaps = 36/219 (16%)

Query: 1   MIKELGLSMFI---MTTISGCGLASREKKKVF---LHKSNDTDIVNKRFGS--------- 45
           M K + L   +      +SGC       ++        +    +V    G+         
Sbjct: 1   MKKRVYLIAAVVSGALAVSGCTTNPYTGEREAGKSAIGAGLGSLVGAGIGALSSSKKDRG 60

Query: 46  -------------------SLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEV 86
                               +D  E + + +++ TG+ V+R GD I   +P +V+F S  
Sbjct: 61  KGALIGAAAGAALGGGVGYYMDVQEAKLRDKMRGTGVSVTRSGDNIILNMPNNVTFDSSS 120

Query: 87  -FLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRG 145
             L+      L  +A +L ++P T + +  +TDS G+   N+ +SQ+RAD + S LI +G
Sbjct: 121 ATLKPAGANTLTGVAMVLKEYPKTAVNVIGYTDSTGSHDLNMRLSQQRADSVASALITQG 180

Query: 146 VSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           V ++R I  +G     PI +N T  G+  N+R+EI + P
Sbjct: 181 VDASR-IRTQGLGPANPIASNSTSEGKAQNRRVEITLSP 218


>gi|114562313|ref|YP_749826.1| OmpA/MotB domain-containing protein [Shewanella frigidimarina NCIMB
           400]
 gi|114333606|gb|ABI70988.1| OmpA/MotB domain protein [Shewanella frigidimarina NCIMB 400]
          Length = 225

 Score =  130 bits (327), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 52/183 (28%), Positives = 87/183 (47%), Gaps = 5/183 (2%)

Query: 6   GLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVV 65
           GLS   +  +     +  ++ K  L  +     +    G  +D  E E + QL+ TG+ V
Sbjct: 47  GLSGAAIGVL---SSSKSDRGKGALIGAASGAALGGGIGYYMDVQEAELRKQLKSTGVSV 103

Query: 66  SRIGDMITCYIPVHVSFV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLK 124
           +R GD I   +P  V+F   +  L  +   +L  +  +  ++  T + +  +TDS G+  
Sbjct: 104 TRNGDNIVLNMPNEVTFAVDQTVLSSRAKSVLNSVVLVAKEYDDTRLNVIGYTDSSGSDS 163

Query: 125 NNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
            NL +SQ RA  +  Y+  + VS +R  S  G     PI +N T+ GR  N+R+EI + P
Sbjct: 164 YNLRLSQVRASEVAQYMTSQKVSGSRVSST-GMGESSPIASNSTEQGRSQNRRVEIVLTP 222

Query: 185 RGN 187
            G 
Sbjct: 223 MGK 225


>gi|268316295|ref|YP_003290014.1| OmpA/MotB domain-containing protein [Rhodothermus marinus DSM 4252]
 gi|262333829|gb|ACY47626.1| OmpA/MotB domain protein [Rhodothermus marinus DSM 4252]
          Length = 209

 Score =  130 bits (327), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 46/206 (22%), Positives = 77/206 (37%), Gaps = 28/206 (13%)

Query: 10  FIMTTISGCG------------------------LASREKKKVFLHKSNDTDIVNKRFGS 45
            +   ++GC                          A+    +  +  +          G 
Sbjct: 1   MLALLLAGCARLSNTEKGAAVGAGAGAVVGGAIGKATGNTARGAILGAIVGGTAGAIIGQ 60

Query: 46  SLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILN 104
            +D+   E Q +L D    + R+G+ I       + F      L  +    L+ +A  L 
Sbjct: 61  RMDRQAAEMQQELPD--ARIERVGEGILVTFDSGILFDFDSATLRPEAREKLRRLAESLK 118

Query: 105 KFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPID 164
           K+P T + I  HTDS G  + N  +S+ RA+   +  + +       I   G     PI 
Sbjct: 119 KYPETEVLIVGHTDSTGPEEYNQRLSERRAEA-AAAFLMQQGIRPSRIRTMGKGETEPIA 177

Query: 165 TNDTKVGRQNNQRIEIQIFPRGNIKK 190
           +N T+ GRQ N+R+EI IF     +K
Sbjct: 178 SNATEEGRQLNRRVEIAIFASEAYRK 203


>gi|238798361|ref|ZP_04641844.1| Inner membrane lipoprotein yiaD [Yersinia mollaretii ATCC 43969]
 gi|238717819|gb|EEQ09652.1| Inner membrane lipoprotein yiaD [Yersinia mollaretii ATCC 43969]
          Length = 219

 Score =  130 bits (327), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 47/219 (21%), Positives = 86/219 (39%), Gaps = 36/219 (16%)

Query: 1   MIKELGL---SMFIMTTISGCGLASREKKKVFLH---KSNDTDIVNKRFG---------- 44
           M K +     ++ +  T+S C       +         +    ++    G          
Sbjct: 1   MKKRILATVTALTLALTLSACTTNPYTGESQAGKSGYGAGIGAVLGAGIGMLSSSKHDRG 60

Query: 45  ------------------SSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV-SE 85
                               +D  E + + ++  TG+ V+R GD I   +P +V+F    
Sbjct: 61  KGALIGAAAGAALGGGAGYYMDVQEAKLREKMSGTGVSVTRQGDNIVLNMPNNVTFDTDS 120

Query: 86  VFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRG 145
             L+      L  +A +L ++  T + +   TDS G   +N+ +SQ+RAD + S LI + 
Sbjct: 121 SNLKPAGANTLTGVAMVLKEYDKTAVNVTGFTDSSGARAHNMTLSQQRADSVGSALIVQ- 179

Query: 146 VSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
             +   I   G     P+ +N T  G+  N+R+EI + P
Sbjct: 180 GVAANRIRTSGAGPDNPVASNSTAAGKAQNRRVEITLSP 218


>gi|319783265|ref|YP_004142741.1| OmpA/MotB domain protein [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
 gi|317169153|gb|ADV12691.1| OmpA/MotB domain protein [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
          Length = 216

 Score =  130 bits (327), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 46/139 (33%), Positives = 75/139 (53%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV-SEVFLEKKFLPMLQLIATILNK 105
           +D+ E E + QL+ TG+ V+R GD I   +P  ++F   +  ++  F  +L  +A +L K
Sbjct: 77  MDQNEAELRRQLEGTGVSVTRSGDQIILNMPSDITFNSDQDAVKPGFYQVLNSVALVLKK 136

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           F  T + +  HTDS G  ++N  +SQ RA  + +  +       R  +V GF    P+ +
Sbjct: 137 FKQTTVDVFGHTDSTGGDQHNFDLSQRRALAVAN-YLSGQGVDQRRFAVTGFGKTRPVAS 195

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T  GR  N+R+EIQ+ P
Sbjct: 196 NATAEGRAQNRRVEIQLSP 214


>gi|218673547|ref|ZP_03523216.1| outer membrane lipoprotein [Rhizobium etli GR56]
          Length = 180

 Score =  130 bits (327), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 50/141 (35%), Positives = 80/141 (56%), Gaps = 2/141 (1%)

Query: 45  SSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV-SEVFLEKKFLPMLQLIATIL 103
           + +D+ E E + QL+ TGI V+R GD I   +P +++F   +  ++  F P L  +A +L
Sbjct: 37  NYMDQQEAELRAQLEGTGISVTRNGDNIILNMPSNITFDVDQDAVKPGFYPTLNSVAIVL 96

Query: 104 NKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPI 163
            KF  T+I +  HTDS G+L++N  +SQ RA  +    +       R +S  GF    P+
Sbjct: 97  RKFNRTLIDVNGHTDSTGSLQHNQDLSQRRALSVAD-YLGGQGIDQRRVSAVGFGPSQPV 155

Query: 164 DTNDTKVGRQNNQRIEIQIFP 184
            +N ++ GR  N+R+EIQI P
Sbjct: 156 ASNASEAGRAQNRRVEIQIAP 176


>gi|301047095|ref|ZP_07194195.1| OmpA family protein [Escherichia coli MS 185-1]
 gi|300300982|gb|EFJ57367.1| OmpA family protein [Escherichia coli MS 185-1]
          Length = 219

 Score =  130 bits (327), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 55/219 (25%), Positives = 95/219 (43%), Gaps = 36/219 (16%)

Query: 1   MIKELGLSMFI---MTTISGCGLASREKKKVF---LHKSNDTDIVNKRFGS--------- 45
           M K + L   +      +SGC       ++        +    +V    G+         
Sbjct: 1   MKKRVYLIAAVVSGALAVSGCTTNPYTGEREAGKSAIGAGLGSLVGAGIGALSSSKKDRG 60

Query: 46  -------------------SLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEV 86
                               +D  E + + +++ TG+ V+R GD I   +P +V+F S  
Sbjct: 61  KGALIGAAAGAALGGGVGYYMDVQEAKLRDKMRGTGVSVTRSGDNIILNMPNNVTFDSSS 120

Query: 87  -FLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRG 145
             L+      L  +A +L ++P T + +  +TDS G    N+ +SQ+RAD + S LI +G
Sbjct: 121 ATLKPAGANPLTGVAMVLKEYPKTAVNVIGYTDSTGGHDLNMRLSQQRADSVASALIPQG 180

Query: 146 VSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           V ++R I  +G     PI +N T  G+  N+R+EI + P
Sbjct: 181 VDASR-IRTQGLGPANPIASNSTAEGKAQNRRVEITLSP 218


>gi|260768688|ref|ZP_05877622.1| outer membrane protein [Vibrio furnissii CIP 102972]
 gi|260616718|gb|EEX41903.1| outer membrane protein [Vibrio furnissii CIP 102972]
          Length = 229

 Score =  130 bits (327), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 56/222 (25%), Positives = 103/222 (46%), Gaps = 39/222 (17%)

Query: 1   MIKELGLSMFIMTTISGCGLASREKKKVFLHKSNDTD----------------------- 37
           ++K++ L++ ++  +SGC    R+       ++N                          
Sbjct: 7   VLKKITLALAVLIALSGCAATQRQNATTGETETNSATKGALLGALAGAAVGLASGDDAKE 66

Query: 38  -------------IVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIG-DMITCYIPVHVSFV 83
                         V    G   D+ E   + +L ++G+ V R+G + +   +   + F 
Sbjct: 67  RRQRALIGAAGGAAVGGGVGYYFDQQEAALRQELLNSGVQVERVGENQLVLRMQNGIGFQ 126

Query: 84  SEVF-LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLI 142
           +  + L+      L+ +A IL ++P T + I  HTDS G+   N ++S+ RA+ ++S+L+
Sbjct: 127 TNSYQLDSSIHNTLRGVAKILVEYPDTSLVIDGHTDSTGSDTTNQILSERRAESVRSFLL 186

Query: 143 QRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
            +GV++ R I  RG   +YP+ TN T  GR  N+R+EIQI P
Sbjct: 187 SQGVAAGRAI-ARGNGERYPLCTNSTADGRSCNRRVEIQILP 227


>gi|218550833|ref|YP_002384624.1| outer membrane lipoprotein [Escherichia fergusonii ATCC 35469]
 gi|218358374|emb|CAQ91021.1| putative outer membrane lipoprotien [Escherichia fergusonii ATCC
           35469]
 gi|324111886|gb|EGC05866.1| OmpA family protein [Escherichia fergusonii B253]
 gi|325499107|gb|EGC96966.1| outer membrane lipoprotein [Escherichia fergusonii ECD227]
          Length = 219

 Score =  130 bits (327), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 54/219 (24%), Positives = 91/219 (41%), Gaps = 36/219 (16%)

Query: 1   MIKELGLSMFI---MTTISGCGL---ASREKKKVFLHKSNDTDIVNKRFGS--------- 45
           M K + L   I      +SGC         +       +    +V    G+         
Sbjct: 1   MKKRVYLIAAIVSGALAVSGCTTNPYTGEREAGNSAIGAGLGSLVGAGIGALSSSKKDRG 60

Query: 46  -------------------SLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVS-E 85
                               +D  E + + +++ TG+ V+R GD I   +P +V+F S  
Sbjct: 61  KGALIGAAAGAALGGGVGYYMDVQEAKLRDKMRGTGVSVTRSGDNIILNMPNNVTFDSNS 120

Query: 86  VFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRG 145
             L+      L  +A +L ++P T + +  +TDS G    N+ +SQ+RAD + S LI + 
Sbjct: 121 ATLKPAGANTLTGVAMVLKEYPKTAVNVLGYTDSTGGYDLNMRLSQQRADSVASALITQ- 179

Query: 146 VSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
             +   I+ RG     PI +N T  G+  N+R+EI + P
Sbjct: 180 GVAANRINTRGMGPANPIASNSTAEGKAQNRRVEITLSP 218


>gi|254494341|ref|ZP_05107512.1| conserved hypothetical protein [Neisseria gonorrhoeae 1291]
 gi|226513381|gb|EEH62726.1| conserved hypothetical protein [Neisseria gonorrhoeae 1291]
          Length = 216

 Score =  130 bits (327), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 51/182 (28%), Positives = 80/182 (43%), Gaps = 2/182 (1%)

Query: 4   ELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGI 63
           +  +       + G   A     K   + +     +    G  +D  E   +  L DT I
Sbjct: 25  KSAMYGLGGAAVCGIVGALTHSGKGARNSALACGAIGAGVGGYMDYQEQRLRQNLADTQI 84

Query: 64  VVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGT 122
            + R G+ I   +P  V+F      L       L   A  L ++P T + I  HTD+ G+
Sbjct: 85  EIQRQGNQIRLVMPESVTFATGSAALGGSAQYALNTAAQTLVQYPDTTLTINGHTDNTGS 144

Query: 123 LKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
              N  +SQ RA  +  YL  RGV+++R ++V G+    P+ +N T  GR  N+R+EI I
Sbjct: 145 DAVNNPLSQHRAQAVAYYLQTRGVAASR-LTVYGYGSHMPVASNATVEGRAQNRRVEILI 203

Query: 183 FP 184
            P
Sbjct: 204 NP 205


>gi|82545917|ref|YP_409864.1| outer membrane lipoprotein [Shigella boydii Sb227]
 gi|187734257|ref|YP_001882255.1| putative outer membrane lipoprotein [Shigella boydii CDC 3083-94]
 gi|81247328|gb|ABB68036.1| putative outer membrane protein [Shigella boydii Sb227]
 gi|187431249|gb|ACD10523.1| OmpA family protein [Shigella boydii CDC 3083-94]
 gi|320187083|gb|EFW61791.1| Outer membrane protein A precursor [Shigella flexneri CDC 796-83]
 gi|332089323|gb|EGI94427.1| inner membrane lipoprotein yiaD [Shigella boydii 3594-74]
          Length = 219

 Score =  130 bits (327), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 55/219 (25%), Positives = 95/219 (43%), Gaps = 36/219 (16%)

Query: 1   MIKELGLSMFI---MTTISGCGLASREKKKVF---LHKSNDTDIVNKRFGS--------- 45
           M K + L   +      +SGC       ++        +    +V    G+         
Sbjct: 1   MKKRVYLIAAVVSGALAVSGCTTNPYTGEREAGKSAIGAGLDSLVGAGIGALSSSKKDRG 60

Query: 46  -------------------SLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEV 86
                               +D  E + + +++ TG+ V+R GD I   +P +V+F S  
Sbjct: 61  KGALIGAAAGAALGGGVGYYMDVQEAKLRDKMRGTGVSVTRSGDNIILNMPNNVTFDSSS 120

Query: 87  -FLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRG 145
             L+      L  +A +L ++P T + +  +TDS G    N+ +SQ+RAD + S LI +G
Sbjct: 121 ATLKPAGANTLTGVAMVLKEYPKTAVNVIGYTDSTGGHDLNMRLSQQRADSVASALITQG 180

Query: 146 VSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           V ++R I  +G     PI +N T  G+  N+R+EI + P
Sbjct: 181 VDASR-IRTQGLGPANPIASNSTAEGKAQNRRVEITLSP 218


>gi|119776228|ref|YP_928968.1| OmpA family protein [Shewanella amazonensis SB2B]
 gi|119768728|gb|ABM01299.1| OmpA family protein [Shewanella amazonensis SB2B]
          Length = 222

 Score =  130 bits (327), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 56/223 (25%), Positives = 97/223 (43%), Gaps = 38/223 (17%)

Query: 1   MIKELGLSMFIMTTIS----GCGLA--------------------------------SRE 24
           M K+  L++  +  ++    GC                                     +
Sbjct: 1   MNKKAILTLTGVFALAAMGTGCSTVNPYTNEQQTANATTGAIIGAVAGAAVGVASSSKSD 60

Query: 25  KKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV- 83
           + K  L  +     V    G  +D  E + + QLQ +G+ V+R GD I   +P  V+F  
Sbjct: 61  RGKGALIGAASGAAVGGGIGYYMDVQETKLRQQLQASGVSVTRNGDNIILNMPNDVTFAV 120

Query: 84  SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQ 143
            +  L  + + +L  +A +  ++  T + +  +TDS G    NL +SQ RA  + +YL+ 
Sbjct: 121 DKTDLSPRAMQVLDSVALVAKEYSKTRLNVLGYTDSSGADSYNLRLSQVRASEVGNYLLS 180

Query: 144 RGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRG 186
           +GV++ R +S +G     PI +N T  GR  N+R+EI + P G
Sbjct: 181 KGVAAAR-VSTQGMGEASPIASNATAEGRAQNRRVEIILTPIG 222


>gi|114778645|ref|ZP_01453461.1| OmpA/MotB [Mariprofundus ferrooxydans PV-1]
 gi|114551110|gb|EAU53671.1| OmpA/MotB [Mariprofundus ferrooxydans PV-1]
          Length = 226

 Score =  130 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 50/227 (22%), Positives = 86/227 (37%), Gaps = 39/227 (17%)

Query: 1   MIKELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGS--------------- 45
           M + + L +    T++ C     +  K    K+     +    G+               
Sbjct: 1   MNRIIILGVAAGLTLTACVSDPNDPNKNTKEKAAVGATIGALAGAVIGYQGDHSGGALRG 60

Query: 46  -----------------SLDKAEDEFQMQLQDTG----IVVSR-IGDMITCYIPVHV-SF 82
                             +DK + EF  QL        I V R   + +   +   +   
Sbjct: 61  ALIGGAAGGALGAGVGIYMDKQQAEFNRQLAAEQQAHQIEVERLQNENLKITMNSEISFD 120

Query: 83  VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLI 142
            +   L+  F   L  +A IL ++P + I I  HTD+ G+ + N  +S++RA  +  + +
Sbjct: 121 YNSAQLKPAFTDTLNKVADILKRYPRSTIRITGHTDNRGSTQYNQQLSEQRAQAV-KWYL 179

Query: 143 QRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGNIK 189
                  R I   G     P  TNDT+ GRQ N+R+E+ I P  +I+
Sbjct: 180 SDRGVDPRRIIAEGRGELQPRATNDTEAGRQLNRRVEMLIVPDQDIQ 226


>gi|254447788|ref|ZP_05061253.1| OmpA family protein [gamma proteobacterium HTCC5015]
 gi|198262568|gb|EDY86848.1| OmpA family protein [gamma proteobacterium HTCC5015]
          Length = 225

 Score =  130 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 51/164 (31%), Positives = 91/164 (55%), Gaps = 2/164 (1%)

Query: 22  SREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVS 81
           S ++++  L  +    ++    G  +D+ E + + +L+D+G+ V R GD I   +P +++
Sbjct: 58  SDKRQERILEAAGGGALIGGGVGYYMDRQEAKLREKLRDSGVSVERDGDNINLIMPGNIT 117

Query: 82  FV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSY 140
           F      +   F  +L  +A +L +F  T++A+  HTDS G+   N ++S++RA  + SY
Sbjct: 118 FQTDSSDVSSSFYNVLDSVAIVLEEFDKTIVAVSGHTDSTGSDSYNQVLSEKRASSVASY 177

Query: 141 LIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           L  +GV + R   V GF    PI  N T+ GR+ N+R+EI + P
Sbjct: 178 LKSKGVLNER-FEVIGFGEARPIADNSTESGREQNRRVEITLLP 220


>gi|254465245|ref|ZP_05078656.1| OmpA/MotB [Rhodobacterales bacterium Y4I]
 gi|206686153|gb|EDZ46635.1| OmpA/MotB [Rhodobacterales bacterium Y4I]
          Length = 219

 Score =  130 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 38/166 (22%), Positives = 72/166 (43%), Gaps = 2/166 (1%)

Query: 22  SREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVS 81
             ++       +          G+ LD  E E +  L +  I +   GD +    P  ++
Sbjct: 54  DSDRGLGAATGALVGAAAGSVIGNQLDAQERELRQTLANDSITIVNTGDRLILSFPNDLT 113

Query: 82  F-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSY 140
           F      +       L+ +A  L ++P++ I +  HTDS G    N  +S+ RA+ + S+
Sbjct: 114 FATDSAAVAPAVQADLRRVADSLVRYPNSAIQVIGHTDSDGDAGYNQGLSERRANAVASH 173

Query: 141 LIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRG 186
           +   GV  +R   + G     P+ +N T  G+  N+R+E+ + P+ 
Sbjct: 174 IQAGGVPYHRM-RIIGRGESQPVASNLTPEGKARNRRVEVVVIPQA 218


>gi|74314194|ref|YP_312613.1| putative outer membrane lipoprotein [Shigella sonnei Ss046]
 gi|73857671|gb|AAZ90378.1| putative outer membrane protein [Shigella sonnei Ss046]
 gi|323166955|gb|EFZ52694.1| inner membrane lipoprotein yiaD [Shigella sonnei 53G]
          Length = 219

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 55/219 (25%), Positives = 95/219 (43%), Gaps = 36/219 (16%)

Query: 1   MIKELGLSMFI---MTTISGCGLASREKKKVF---LHKSNDTDIVNKRFGS--------- 45
           M K + L   +      +SGC       ++        +    +V    G+         
Sbjct: 1   MKKRVYLIAAVVSGALAVSGCTTNPYTGEREAGKSAIGAGLGSLVGAGIGALSSSKKDRG 60

Query: 46  -------------------SLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEV 86
                               +D  E + + +++ TG+ V+R GD I   +P +V+F S  
Sbjct: 61  KGALIGAAAGAALGGGVGYYMDVQEAKLRDKMRGTGVSVTRSGDNIILNMPNNVTFDSSS 120

Query: 87  -FLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRG 145
             L+      L  +A +L ++P T + +  +TDS G    N+ +SQ+RAD + S LI +G
Sbjct: 121 ATLKPAGANTLTGVAMVLTEYPKTAVNVIGYTDSTGGHDLNMRLSQQRADSVASALITQG 180

Query: 146 VSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           V ++R I  +G     PI +N T  G+  N+R+EI + P
Sbjct: 181 VDASR-IRTQGLGPANPIASNSTAEGKAQNRRVEITLSP 218


>gi|86147507|ref|ZP_01065818.1| outer membrane protein [Vibrio sp. MED222]
 gi|218709202|ref|YP_002416823.1| putative outer membrane protein [Vibrio splendidus LGP32]
 gi|85834675|gb|EAQ52822.1| outer membrane protein [Vibrio sp. MED222]
 gi|218322221|emb|CAV18335.1| putative outer membrane protein [Vibrio splendidus LGP32]
          Length = 222

 Score =  129 bits (325), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 52/221 (23%), Positives = 98/221 (44%), Gaps = 39/221 (17%)

Query: 2   IKELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVN--------------------- 40
           +K++ L++ +   ++GC    R+       ++N                           
Sbjct: 1   MKKITLALALTVALTGCQATQRQNATTGESETNSATQGALIGAIAGAVAGAATGDDSKDR 60

Query: 41  ---------------KRFGSSLDKAEDEFQMQLQDTGIVVSRIG-DMITCYIPVHV-SFV 83
                             G   D+ E   + +L ++G+ V R+G + +   +   +    
Sbjct: 61  RKRALIGAAGGAAVGGGIGYYFDQQEAALREELMNSGVQVERVGENQLLLRLENGIGFDS 120

Query: 84  SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQ 143
               LE      L+ +A IL ++P T + I+ HTDS G+  +N ++S+ RA+ ++++LI 
Sbjct: 121 GSYALESSIHKTLRGVARILVEYPDTSLVIEGHTDSTGSESSNQVLSERRAESVRAFLIS 180

Query: 144 RGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           + V++ R I  RG   +YP+  N+T  GR  N+R+EIQI P
Sbjct: 181 QDVAAGRAI-ARGNGERYPLCDNNTSQGRACNRRVEIQILP 220


>gi|317494692|ref|ZP_07953104.1| OmpA family protein [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316917294|gb|EFV38641.1| OmpA family protein [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 219

 Score =  129 bits (325), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 51/209 (24%), Positives = 91/209 (43%), Gaps = 33/209 (15%)

Query: 8   SMFIMTTISGCGL---ASREKKKVFLHKSNDTDIVNKRFG-------------------- 44
           ++     +SGC         +       +    +V    G                    
Sbjct: 11  AVCAALLLSGCTTNPYTGESEAGKAGVGAGLGALVGAGVGVLSSSKHDRGKGALIGAAAG 70

Query: 45  --------SSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEV-FLEKKFLPM 95
                     +D  E + + +++ TG+ V+R GD I   +P +V+F S    L+      
Sbjct: 71  AALGGGAGYYMDVQESKLRDKMRGTGVSVTRQGDNIILNMPNNVTFDSSSSTLKPAGANT 130

Query: 96  LQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVR 155
           L  +A +L ++P T + +  +TDS G+   N+ +SQ+RAD + S LI +GV ++R +  +
Sbjct: 131 LTGVAMVLKEYPKTAVNVVGYTDSTGSQDLNMRLSQQRADSVASALIVQGVEASR-VRTQ 189

Query: 156 GFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           G     PI +N T  G+  N+R+EI + P
Sbjct: 190 GMGPANPIASNSTAEGKAQNRRVEITLSP 218


>gi|15641208|ref|NP_230840.1| putative lipoprotein [Vibrio cholerae O1 biovar El Tor str. N16961]
 gi|121587785|ref|ZP_01677544.1| lipoprotein, putative [Vibrio cholerae 2740-80]
 gi|121728252|ref|ZP_01681285.1| lipoprotein, putative [Vibrio cholerae V52]
 gi|147673077|ref|YP_001216765.1| putative lipoprotein [Vibrio cholerae O395]
 gi|153819084|ref|ZP_01971751.1| lipoprotein, putative [Vibrio cholerae NCTC 8457]
 gi|153823238|ref|ZP_01975905.1| lipoprotein, putative [Vibrio cholerae B33]
 gi|227081367|ref|YP_002809918.1| putative lipoprotein [Vibrio cholerae M66-2]
 gi|229505212|ref|ZP_04394722.1| outer membrane protein [Vibrio cholerae BX 330286]
 gi|229511118|ref|ZP_04400597.1| outer membrane protein [Vibrio cholerae B33]
 gi|229518237|ref|ZP_04407681.1| outer membrane protein [Vibrio cholerae RC9]
 gi|229608231|ref|YP_002878879.1| outer membrane protein [Vibrio cholerae MJ-1236]
 gi|255745601|ref|ZP_05419549.1| outer membrane protein [Vibrio cholera CIRS 101]
 gi|262158324|ref|ZP_06029440.1| outer membrane protein [Vibrio cholerae INDRE 91/1]
 gi|262169483|ref|ZP_06037175.1| outer membrane protein [Vibrio cholerae RC27]
 gi|298498705|ref|ZP_07008512.1| conserved hypothetical protein [Vibrio cholerae MAK 757]
 gi|9655673|gb|AAF94354.1| lipoprotein, putative [Vibrio cholerae O1 biovar El Tor str.
           N16961]
 gi|121547949|gb|EAX58030.1| lipoprotein, putative [Vibrio cholerae 2740-80]
 gi|121629503|gb|EAX61929.1| lipoprotein, putative [Vibrio cholerae V52]
 gi|126510367|gb|EAZ72961.1| lipoprotein, putative [Vibrio cholerae NCTC 8457]
 gi|126519252|gb|EAZ76475.1| lipoprotein, putative [Vibrio cholerae B33]
 gi|146314960|gb|ABQ19499.1| putative lipoprotein [Vibrio cholerae O395]
 gi|227009255|gb|ACP05467.1| putative lipoprotein [Vibrio cholerae M66-2]
 gi|227013112|gb|ACP09322.1| putative lipoprotein [Vibrio cholerae O395]
 gi|229344952|gb|EEO09926.1| outer membrane protein [Vibrio cholerae RC9]
 gi|229351083|gb|EEO16024.1| outer membrane protein [Vibrio cholerae B33]
 gi|229357435|gb|EEO22352.1| outer membrane protein [Vibrio cholerae BX 330286]
 gi|229370886|gb|ACQ61309.1| outer membrane protein [Vibrio cholerae MJ-1236]
 gi|255736676|gb|EET92073.1| outer membrane protein [Vibrio cholera CIRS 101]
 gi|262022296|gb|EEY41005.1| outer membrane protein [Vibrio cholerae RC27]
 gi|262029765|gb|EEY48413.1| outer membrane protein [Vibrio cholerae INDRE 91/1]
 gi|297543038|gb|EFH79088.1| conserved hypothetical protein [Vibrio cholerae MAK 757]
          Length = 223

 Score =  129 bits (325), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 54/222 (24%), Positives = 99/222 (44%), Gaps = 39/222 (17%)

Query: 1   MIKELGLSMFIMTTISGC-------GLASREKKKVFLHKSNDTDIVNKRFG--------- 44
           M+ +  L +  +  +SGC             +       +    +     G         
Sbjct: 1   MLNKTTLLLAAVVALSGCQATQRQNATTGETETNATTKGALLGVLAGAAVGLATGDDAKE 60

Query: 45  --------------------SSLDKAEDEFQMQLQDTGIVVSRIG-DMITCYIPVHVSFV 83
                                  D+ E E +  L D+G+ V R+G + +   +   + F 
Sbjct: 61  RRKHALIGAAGGAAVGGGIGYYFDQQEAELRKALLDSGVQVVRVGENQLMLRMENGIGFT 120

Query: 84  SEVF-LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLI 142
           S  + L+      L+ +A IL ++P T + I+ HTDS G+   N ++S++RA+ ++S+L+
Sbjct: 121 SNSYQLDSYIHKTLRGVARILVEYPDTSLVIEGHTDSTGSDTTNQVLSEKRAESVRSFLL 180

Query: 143 QRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
            +GV++ R I  RG   ++P+ +N+T  GR  N+R+EIQI P
Sbjct: 181 SQGVAAGRAI-ARGNGERFPLCSNNTAEGRACNRRVEIQILP 221


>gi|237736307|ref|ZP_04566788.1| outer membrane protein [Fusobacterium mortiferum ATCC 9817]
 gi|229421655|gb|EEO36702.1| outer membrane protein [Fusobacterium mortiferum ATCC 9817]
          Length = 203

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 50/163 (30%), Positives = 82/163 (50%), Gaps = 2/163 (1%)

Query: 23  REKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF 82
            +  K  L  +    +    +G+  D  E E + +L++T + VSR GD +  Y+P  V+F
Sbjct: 40  GKDTKGTLIGAGIGALAGLGWGAYRDNQEKELRERLKNTEVEVSREGDNLNLYLPGGVTF 99

Query: 83  -VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYL 141
             +   +   F   L  IA++L ++P T I +  +TD+ G    NL +SQ RA+ ++ Y 
Sbjct: 100 ATNSANIASNFYGPLNSIASVLVQYPETRIVVNGYTDNTGAASYNLDLSQRRANSVRDYF 159

Query: 142 IQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           I +    +  ++  G     P  TN T  GR  N+R+EIQI P
Sbjct: 160 ISQ-GVESYRVTSVGHGINNPRATNSTAAGRAENRRVEIQILP 201


>gi|149913202|ref|ZP_01901736.1| OmpA family domain protein [Roseobacter sp. AzwK-3b]
 gi|149813608|gb|EDM73434.1| OmpA family domain protein [Roseobacter sp. AzwK-3b]
          Length = 222

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 44/181 (24%), Positives = 79/181 (43%), Gaps = 3/181 (1%)

Query: 8   SMFIMTTISG-CGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVS 66
           ++      +G   + S ++ K  L            +G+ LD+ E + + QL D  + ++
Sbjct: 42  ALLGGLIGAGVGAVVSDDRAKGALIGGAIGAAGGATYGNMLDRQEAQLRQQLDDDRVQIT 101

Query: 67  RIGDMITCYIPVHVSFV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKN 125
             GD +   +P  + F      +       L  +A+ L  +P + + +  HTD+ G    
Sbjct: 102 NTGDRLIVTLPQDILFDVDSASVRSGLRDDLMTVASSLRDYPDSTVQVVGHTDNTGDAGY 161

Query: 126 NLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPR 185
           N  +S+ RA+ +   L+  GV+ +R I   G     P+  N T  GR  N+R+EI I P 
Sbjct: 162 NQQLSERRANAVADVLMDGGVAFSR-IQTFGRGENQPVADNLTDAGRAQNRRVEIVILPN 220

Query: 186 G 186
            
Sbjct: 221 A 221


>gi|296100590|ref|YP_003610736.1| putative outer membrane lipoprotein [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
 gi|295055049|gb|ADF59787.1| putative outer membrane lipoprotein [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
          Length = 220

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 50/219 (22%), Positives = 90/219 (41%), Gaps = 36/219 (16%)

Query: 1   MIKELGLSMFI---MTTISGCGLASREKKKVFL---HKSNDTDIVNKRFGS--------- 45
           M K + +   +      +SGC       ++        +    +V    G+         
Sbjct: 1   MKKRVLVIAALVSGALAVSGCTTNPYTGEREAGKSGIGAGIGSLVGAGVGALSSSKKDRG 60

Query: 46  -------------------SLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEV 86
                               +D  E + + +++ TG+ V+R GD I   +P +V+F S  
Sbjct: 61  KGALIGAAAGAALGGGVGYYMDVQEAKLRDKMKGTGVSVTRSGDNIILNMPNNVTFDSSS 120

Query: 87  -FLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRG 145
             L+      L  +A +L ++  T + +  +TDS G+ + N+ +SQ+RAD + S LI + 
Sbjct: 121 ATLKPAGANTLTGVAMVLKEYNKTAVNVIGYTDSTGSQELNMRLSQQRADSVASSLITQ- 179

Query: 146 VSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
                 I   G     PI +N T  G+  N+R+EI + P
Sbjct: 180 GVEANRIRTSGMGPANPIASNSTAEGKAQNRRVEITLSP 218


>gi|146309839|ref|YP_001174913.1| putative outer membrane lipoprotein [Enterobacter sp. 638]
 gi|145316715|gb|ABP58862.1| OmpA/MotB domain protein [Enterobacter sp. 638]
          Length = 220

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 48/180 (26%), Positives = 88/180 (48%), Gaps = 2/180 (1%)

Query: 6   GLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVV 65
           G+   +   +     + +++ K  L  +     +    G  +D  E + + ++Q TG+ V
Sbjct: 40  GIGSLVGAGVGALSSSKKDRGKGALIGAAAGAALGGGAGYYMDVQEAKLRDKMQGTGVSV 99

Query: 66  SRIGDMITCYIPVHVSFVSEV-FLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLK 124
           +R GD I   +P +V+F S    L+      L  +A +L ++  T + +  +TDS G+  
Sbjct: 100 TRNGDNIILNMPSNVTFDSSSATLKPAGANTLTGVAMVLKEYSKTAVNVIGYTDSTGSQD 159

Query: 125 NNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
            N+ +SQ+RAD + S LI +   +   I   G     PI +N+T  G+  N+R+EI + P
Sbjct: 160 LNMRLSQQRADSVASSLITQ-GVAANRIRTSGMGPANPIASNNTAEGKAQNRRVEITLSP 218


>gi|157149164|ref|YP_001456483.1| putative outer membrane lipoprotein [Citrobacter koseri ATCC
           BAA-895]
 gi|157086369|gb|ABV16047.1| hypothetical protein CKO_05004 [Citrobacter koseri ATCC BAA-895]
          Length = 220

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 48/180 (26%), Positives = 86/180 (47%), Gaps = 2/180 (1%)

Query: 6   GLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVV 65
           G+   +   +     + +++ K  L  +     +    G  +D  E + + ++Q TG+ V
Sbjct: 40  GIGSLVGAGVGALSSSKKDRGKGALIGAAAGAALGGGAGYYMDVQEAKLRDKMQGTGVSV 99

Query: 66  SRIGDMITCYIPVHVSFVSEV-FLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLK 124
           +R GD I   +P +V+F S    L+      L  +A +L ++  T + +  +TDS G   
Sbjct: 100 TRSGDNIILNMPNNVTFDSSSATLKPAGANTLTGVAMVLKEYNKTAVNVVGYTDSTGGQD 159

Query: 125 NNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
            N+ +SQ+RAD + S LI +   +   I   G     PI +N T  G+  N+R+EI + P
Sbjct: 160 LNMRLSQQRADSVASALITQ-GVAANRIRTSGMGPANPIASNSTAEGKAQNRRVEITLSP 218


>gi|152972417|ref|YP_001337563.1| putative outer membrane lipoprotein [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|206578997|ref|YP_002236080.1| OmpA family protein [Klebsiella pneumoniae 342]
 gi|238897010|ref|YP_002921755.1| putative outer membrane lipoprotein [Klebsiella pneumoniae
           NTUH-K2044]
 gi|262040618|ref|ZP_06013856.1| OmpA family protein [Klebsiella pneumoniae subsp. rhinoscleromatis
           ATCC 13884]
 gi|288933077|ref|YP_003437136.1| OmpA/MotB domain protein [Klebsiella variicola At-22]
 gi|290511871|ref|ZP_06551239.1| outer membrane lipoprotein [Klebsiella sp. 1_1_55]
 gi|329999890|ref|ZP_08303557.1| OmpA family protein [Klebsiella sp. MS 92-3]
 gi|150957266|gb|ABR79296.1| putative outer membrane protein [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|206568055|gb|ACI09831.1| OmpA family protein [Klebsiella pneumoniae 342]
 gi|238549337|dbj|BAH65688.1| putative outer membrane protein [Klebsiella pneumoniae subsp.
           pneumoniae NTUH-K2044]
 gi|259041982|gb|EEW43015.1| OmpA family protein [Klebsiella pneumoniae subsp. rhinoscleromatis
           ATCC 13884]
 gi|288887806|gb|ADC56124.1| OmpA/MotB domain protein [Klebsiella variicola At-22]
 gi|289775661|gb|EFD83661.1| outer membrane lipoprotein [Klebsiella sp. 1_1_55]
 gi|328538172|gb|EGF64327.1| OmpA family protein [Klebsiella sp. MS 92-3]
          Length = 220

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 52/219 (23%), Positives = 91/219 (41%), Gaps = 36/219 (16%)

Query: 1   MIKELGLSMFIM---TTISGCGLASREKKKVFL---HKSNDTDIVNKRFGS--------- 45
           M K + +   ++     ISGC       ++        +    +V    G+         
Sbjct: 1   MKKRVLMIAALVSGTLAISGCTTNPYTGEREAGKSGIGAGIGSLVGAGVGALSSSKHDRG 60

Query: 46  -------------------SLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVS-E 85
                               +D  E + + ++Q TG+ V+R GD I   +P +V+F S  
Sbjct: 61  KGALIGAAAGAALGGGIGYYMDVQEAKLRDKMQGTGVSVTRNGDNIVLNMPNNVTFDSNS 120

Query: 86  VFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRG 145
             L+      L  +A +L ++  T + +  +TDS G+   N+ +SQ+RAD + S LI + 
Sbjct: 121 ANLKPAGANTLTGVAMVLKEYEKTAVNVVGYTDSTGSKDLNMRLSQQRADSVASALITQ- 179

Query: 146 VSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
             +   I   G     PI +N T  G+  N+R+EI + P
Sbjct: 180 GVAANRIRTTGMGPANPIASNSTAEGKAQNRRVEITLSP 218


>gi|300950898|ref|ZP_07164778.1| OmpA family protein [Escherichia coli MS 116-1]
 gi|300449827|gb|EFK13447.1| OmpA family protein [Escherichia coli MS 116-1]
          Length = 217

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 54/217 (24%), Positives = 94/217 (43%), Gaps = 36/217 (16%)

Query: 1   MIKELGLSMFI---MTTISGCGLASREKKKVF---LHKSNDTDIVNKRFGS--------- 45
           M K + L   +      +SGC       ++        +    +V    G+         
Sbjct: 1   MKKRVYLIAAVVSGALAVSGCTTNPYTGEREAGKSAIGAGLGSLVGAGIGALSSSKKDRG 60

Query: 46  -------------------SLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEV 86
                               +D  E + + +++ TG+ V+R GD I   +P +V+F S  
Sbjct: 61  KGALIGAAAGAALGGGVGYYMDVQEAKLRDKMRGTGVSVTRSGDNIILNMPNNVTFDSSS 120

Query: 87  -FLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRG 145
             L+      L  +A +L ++P T + +  +TDS G    N+ +SQ+RAD + S LI +G
Sbjct: 121 ATLKPAGANTLTGVAMVLKEYPKTAVNVIGYTDSTGGHDLNMRLSQQRADSVASALITQG 180

Query: 146 VSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           V ++R I  +G     PI +N T  G+  N+R+EI +
Sbjct: 181 VDASR-IRTQGLGPANPIASNSTAEGKAQNRRVEITL 216


>gi|56698398|ref|YP_168771.1| OmpA domain-containing protein [Ruegeria pomeroyi DSS-3]
 gi|56680135|gb|AAV96801.1| OmpA domain protein [Ruegeria pomeroyi DSS-3]
          Length = 221

 Score =  128 bits (323), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 47/211 (22%), Positives = 82/211 (38%), Gaps = 34/211 (16%)

Query: 9   MFIMTTISGCG-----LASREKKKVFLHKSNDTDIVNKRFG------------------- 44
           +  +  +  C        + +  +     +    I+    G                   
Sbjct: 12  LTAILALGACTDPASLSTNTDPNQKAKQGALIGGILGAGVGAIANDSNPGLGALAGAAIG 71

Query: 45  --------SSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV-SEVFLEKKFLPM 95
                   +SLDK   E + +L + GI ++  GD +   +P  ++F      +       
Sbjct: 72  AAGGGLIGNSLDKQAAELRQELANDGITITNTGDRLIVSVPNDITFDTDSSTVRPGLRSD 131

Query: 96  LQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVR 155
           LQ +A  L ++P + + +  HTDS G    N  +S+ RA  +   L   GV+ +R IS  
Sbjct: 132 LQKVAAHLVRYPQSSVQVIGHTDSDGEAAYNQGLSERRAGAVADILQAGGVTYDR-ISTL 190

Query: 156 GFAYKYPIDTNDTKVGRQNNQRIEIQIFPRG 186
           G     PI +N T  G+  N+R+EI + PR 
Sbjct: 191 GMGENSPIASNLTPEGKARNRRVEIVVIPRN 221


>gi|300719120|ref|YP_003743923.1| outer membrane protein [Erwinia billingiae Eb661]
 gi|299064956|emb|CAX62076.1| Putative outer membrane protein [Erwinia billingiae Eb661]
          Length = 220

 Score =  128 bits (323), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 45/167 (26%), Positives = 85/167 (50%), Gaps = 2/167 (1%)

Query: 19  GLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPV 78
             + +++ K  L  +     +    G  +D  E + + +++ TG+ V+R GD I   +P 
Sbjct: 53  SSSKKDRGKGALIGAAAGAALGGGAGYYMDVQEAKLRDKMKGTGVSVTRQGDNIVLNMPN 112

Query: 79  HVSFVSEV-FLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVI 137
           +V+F S    L+      L  +A +L ++P T + +  +TDS G+ + N+ +SQ+RAD +
Sbjct: 113 NVTFDSSSSTLKPAGANTLTGVAMVLKEYPKTAVNVAGYTDSTGSRQLNMTLSQQRADSV 172

Query: 138 KSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
            S LI +   +   +   G     P+ +N T  G+  N+R+EI + P
Sbjct: 173 GSALITQ-GVAANRVRTSGMGPDNPVASNSTAEGKAQNRRVEITLSP 218


>gi|241759693|ref|ZP_04757793.1| inner membrane lipoprotein YiaD [Neisseria flavescens SK114]
 gi|241319701|gb|EER56097.1| inner membrane lipoprotein YiaD [Neisseria flavescens SK114]
          Length = 226

 Score =  128 bits (323), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 48/182 (26%), Positives = 80/182 (43%), Gaps = 2/182 (1%)

Query: 4   ELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGI 63
           +  +       + G   A     K   + +     V    G  +D  E + +  L +T I
Sbjct: 34  KTAMYGLGGAAVCGIVGALTHGGKGARNSALACGAVGAGIGGYMDYQEKKLRQSLANTNI 93

Query: 64  VVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGT 122
            V R G+ I   +P +V+F      L  +    L + A  L ++P T + I  HTD+ G 
Sbjct: 94  EVERQGNQIKLVMPENVTFATGSAALSGQAQSALSVAAQTLVQYPDTTLTINGHTDNTGN 153

Query: 123 LKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
              N  +S+ RA+ + +  +Q    S+  +S  G+  + PI +N T  GR  N+R+EI I
Sbjct: 154 DAINEPLSRNRAESV-AIFLQSRGVSSTRLSTFGYGSRQPIASNATVEGRAQNRRVEILI 212

Query: 183 FP 184
            P
Sbjct: 213 NP 214


>gi|466690|gb|AAB18529.1| unnamed protein product [Escherichia coli str. K-12 substr. MG1655]
          Length = 219

 Score =  128 bits (323), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 55/219 (25%), Positives = 94/219 (42%), Gaps = 36/219 (16%)

Query: 1   MIKELGLSMFI---MTTISGCGLASREKKKVF---LHKSNDTDIVNKRFGS--------- 45
           M K + L   +      +SGC       ++        +    +V    G+         
Sbjct: 1   MKKRVYLIAAVVSGALAVSGCTTNPYTGEREAGKSAIGAGLGSLVGAGIGALSSSKKDRG 60

Query: 46  -------------------SLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEV 86
                               +D  E   + +++ TG+ V+R GD I   +P +V+F S  
Sbjct: 61  KGALIGAAAGAALGGGVGYYMDVQEANVRDKMRGTGVSVTRSGDNIILNMPNNVTFDSSS 120

Query: 87  -FLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRG 145
             L+      L  +A +L ++P T + +  +TDS G    N+ +SQ+RAD + S LI +G
Sbjct: 121 ATLKPAGANTLTGVAMVLKEYPKTAVNVIGYTDSTGGHDLNMRLSQQRADSVASALITQG 180

Query: 146 VSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           V ++R I  +G     PI +N T  G+  N+R+EI + P
Sbjct: 181 VDASR-IRTQGLGPANPIASNSTAEGKAQNRRVEITLSP 218


>gi|295095145|emb|CBK84235.1| Outer membrane protein and related peptidoglycan-associated
           (lipo)proteins [Enterobacter cloacae subsp. cloacae NCTC
           9394]
          Length = 220

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 50/219 (22%), Positives = 89/219 (40%), Gaps = 36/219 (16%)

Query: 1   MIKELGLSMFI---MTTISGCGLASREKKKVFL---HKSNDTDIVNKRFGS--------- 45
           M K + +   +      +SGC       ++        +    +V    G+         
Sbjct: 1   MKKRVLVIAALVSGALAVSGCTTNPYTGEREAGKSGIGAGIGSLVGAGVGALSSSKKDRG 60

Query: 46  -------------------SLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEV 86
                               +D  E + + +++ TG+ V+R GD I   +P +V+F S  
Sbjct: 61  KGALIGAAAGAALGGGVGYYMDVQEAKLRDKMKGTGVSVTRSGDNIILNMPNNVTFDSSS 120

Query: 87  -FLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRG 145
             L+      L  +A +L ++  T + +  +TDS G+   N+ +SQ+RAD + S LI + 
Sbjct: 121 ATLKPAGANTLTGVAAVLKEYNKTAVNVIGYTDSTGSQDLNMRLSQQRADSVASSLIAQ- 179

Query: 146 VSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
                 I   G     PI +N T  G+  N+R+EI + P
Sbjct: 180 GVEANRIRTSGMGPANPIASNSTAEGKAQNRRVEITLSP 218


>gi|167644153|ref|YP_001681816.1| OmpA/MotB domain-containing protein [Caulobacter sp. K31]
 gi|167346583|gb|ABZ69318.1| OmpA/MotB domain protein [Caulobacter sp. K31]
          Length = 224

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 53/221 (23%), Positives = 91/221 (41%), Gaps = 37/221 (16%)

Query: 1   MIKELGLSMFIMTTISG--CGLAS--------REKKKVFLHKSNDTDIVN---------- 40
           MIK+  + + +M  ++   C                   L  +    ++           
Sbjct: 1   MIKKTAIGVAMMGALALAACTTTDPYTGMPVRNNTGTGALSGAGVGAVLGYLTNTNKGEQ 60

Query: 41  ----------------KRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV- 83
                              G+ +D+ + +F+  L+ +G+++ R GD I   +P  V+F  
Sbjct: 61  GRKNALIGAGIGALAGGAVGNYMDRQQADFRRGLEGSGVMIRRNGDQIVLVMPSDVTFAV 120

Query: 84  SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQ 143
            +  ++ +F  +L  +A  LN +P T I I  H DS G    N  +S+ RA  + SYL  
Sbjct: 121 DKSEVQPQFTRVLDDVARTLNAYPQTTIDIVGHADSSGPDDYNQTLSERRASSVASYLTN 180

Query: 144 RGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
            G      + V G   + PI +NDT  GR  N+R+EI + P
Sbjct: 181 VGRVVPDRVFVAGQGERQPIASNDTPEGRAQNRRVEIILRP 221


>gi|83952523|ref|ZP_00961254.1| OmpA domain protein [Roseovarius nubinhibens ISM]
 gi|83836196|gb|EAP75494.1| OmpA domain protein [Roseovarius nubinhibens ISM]
          Length = 203

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 47/185 (25%), Positives = 84/185 (45%), Gaps = 3/185 (1%)

Query: 3   KELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTG 62
           K+  L   ++  I+G   + + K K  +       +     G++LDK   E +  L +  
Sbjct: 21  KQGALIGGVVGAITGAAASDK-KGKGAVIGGAIGALGGAAIGNALDKQAAELERDLNNDS 79

Query: 63  IVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIG 121
           + V+  GD +   +P  + F +    +       L  +A  L  +P T + +  HTD+ G
Sbjct: 80  VTVNNTGDRLIVTMPQDILFAIDSSTVNSGLRGDLLTVARSLQSYPDTTVQVVGHTDNTG 139

Query: 122 TLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQ 181
           +  +N  +S+ RA+ +   L+  GV+ +R I   G     P+ +N T  GR  N+R+EI 
Sbjct: 140 SAAHNQALSERRANAVADVLMNGGVAFSR-IQTYGRGEDQPLASNLTAEGRAQNRRVEIV 198

Query: 182 IFPRG 186
           I P  
Sbjct: 199 ILPNA 203


>gi|148979919|ref|ZP_01815777.1| outer membrane protein [Vibrionales bacterium SWAT-3]
 gi|145961523|gb|EDK26825.1| outer membrane protein [Vibrionales bacterium SWAT-3]
          Length = 221

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 52/220 (23%), Positives = 97/220 (44%), Gaps = 38/220 (17%)

Query: 2   IKELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVN--------------------- 40
           +K++ L++ +   ++GC    R+       ++N                           
Sbjct: 1   MKKITLALALTVALTGCQATQRQNATTGESETNSATQGALIGAIAGAVAGAATGDSKDRG 60

Query: 41  --------------KRFGSSLDKAEDEFQMQLQDTGIVVSRIG-DMITCYIPVHV-SFVS 84
                            G   D+ E   + +L ++G+ V R+G + +   +   +     
Sbjct: 61  KRALIGAAGGAAVGGGIGYYFDRQEAALREELMNSGVQVERVGENQLLLRLENGIGFDSG 120

Query: 85  EVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQR 144
              LE      L+ +A IL ++P T + I+ HTDS G+   N ++S+ RA+ ++++LI +
Sbjct: 121 SYALESSIHNTLRGVARILVEYPDTSLVIEGHTDSTGSESTNQILSERRAESVRAFLISQ 180

Query: 145 GVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
            V++ R I  RG   +YP+  N+T  GR  N+R+EIQI P
Sbjct: 181 DVAAGRAI-ARGNGERYPLCDNNTSRGRACNRRVEIQILP 219


>gi|54307294|ref|YP_128314.1| putative OmpA family protein [Photobacterium profundum SS9]
 gi|46911714|emb|CAG18512.1| Putative OmpA family protein [Photobacterium profundum SS9]
          Length = 241

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 51/180 (28%), Positives = 89/180 (49%), Gaps = 2/180 (1%)

Query: 6   GLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVV 65
            +       I     +  ++ K  L  +     +    G  +D  E + + QL+ TGI V
Sbjct: 61  LIGAISGAVIGVASSSKSDRGKGALIGAASGAALGGGIGYYMDVQETKLRQQLESTGISV 120

Query: 66  SRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLK 124
           +R GD I   +P  ++F   +  L  + +  L+ +A +  ++  T+I +   TDS G+  
Sbjct: 121 TRDGDNIVLNMPNEITFGFDQSDLSSRAVAALKNVALVAKEYDKTLINVYGFTDSTGSAS 180

Query: 125 NNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
            N  +SQ RA  + S L++ GV++NR I+ +G     PI +N T+ GR  N+R+EI + P
Sbjct: 181 YNQRLSQVRASEVSSNLMRGGVAANRVIT-KGMGEANPIASNKTEQGRAENRRVEIVLSP 239


>gi|332185595|ref|ZP_08387343.1| rickettsia 17 kDa surface antigen family protein [Sphingomonas sp.
           S17]
 gi|332014573|gb|EGI56630.1| rickettsia 17 kDa surface antigen family protein [Sphingomonas sp.
           S17]
          Length = 225

 Score =  128 bits (322), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 50/147 (34%), Positives = 78/147 (53%), Gaps = 4/147 (2%)

Query: 46  SLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILN 104
            +DK E + + +   T + V R GD +   +P  ++F      ++ +F   L  +A IL+
Sbjct: 80  YMDKQERDLRARTAGTDVQVVRQGDDLLLNLPSGITFAYDSSTVQPQFRQTLDQVADILS 139

Query: 105 KFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPID 164
           ++  T I +  HTDS G+   N  +S+ RA  +  YL  RGV   R I  RGF    PI 
Sbjct: 140 QYKQTYIDVYGHTDSTGSDSYNQALSERRAVAVADYLASRGVQPAR-IGTRGFGKSQPIA 198

Query: 165 TNDTKVGRQNNQRIEIQIFP--RGNIK 189
           +NDT  GR  N+R+EI+I P   G+++
Sbjct: 199 SNDTDAGRAANRRVEIKIVPIREGDLR 225


>gi|293393749|ref|ZP_06638056.1| OmpA family protein [Serratia odorifera DSM 4582]
 gi|291423576|gb|EFE96798.1| OmpA family protein [Serratia odorifera DSM 4582]
          Length = 220

 Score =  128 bits (322), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 50/219 (22%), Positives = 94/219 (42%), Gaps = 36/219 (16%)

Query: 1   MIKELGL---SMFIMTTISGC-------------------------------GLASREKK 26
           M K + +   ++ +   +S C                                 + +++ 
Sbjct: 1   MKKRIAIIAGAVAMTMALSACTTNPYTGESEAGKSGIGAGLGAALGAGIGVLSSSKKDRG 60

Query: 27  KVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV-SE 85
           K  L  +     +    G  +D  E + + +++ TG+ V+R GD I   +P +V+F    
Sbjct: 61  KGALIGAAAGAALGGGAGYYMDVQEAKLRDKMRGTGVSVTRQGDNIVLNMPNNVTFDTDS 120

Query: 86  VFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRG 145
             L+      L  +A +L ++P T + +  +TDS G   +N+ +SQ+RAD + S LI + 
Sbjct: 121 STLKPAGANTLTGVAMVLKEYPKTAVNVVGYTDSTGARAHNMTLSQQRADGVASALITQ- 179

Query: 146 VSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
             +   I  +G     PI +N T  G+  N+R+EI + P
Sbjct: 180 GVAANRIRTQGAGPDNPIASNSTTEGKAQNRRVEITLSP 218


>gi|86139806|ref|ZP_01058372.1| OmpA domain protein [Roseobacter sp. MED193]
 gi|85823435|gb|EAQ43644.1| OmpA domain protein [Roseobacter sp. MED193]
          Length = 218

 Score =  128 bits (322), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 45/181 (24%), Positives = 82/181 (45%), Gaps = 3/181 (1%)

Query: 5   LGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIV 64
           L     +   ++G   +S  K    +  +    ++    GS LDK E E +  L + GI 
Sbjct: 38  LIAGAIVGAGLAGLSNSSN-KGAAVVAGAAAGALLGGVIGSQLDKQEAELRESLSNNGIT 96

Query: 65  VSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTL 123
           +   GD +   +P  ++F      +       L+ +A  + ++P++ + +  HTDS G  
Sbjct: 97  IVNTGDRLIVSLPNDLTFASDSAAISPAVESDLRQVAQSIVRYPNSSVQVIGHTDSDGDA 156

Query: 124 KNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
             N  +S++RA+ +   +   GV  NR +   G     P+ +N T  G+  N+R+EI I 
Sbjct: 157 SYNQTLSEQRANTVADQVQAGGVPYNR-LQTFGRGESQPVASNLTAEGKAQNRRVEIVIV 215

Query: 184 P 184
           P
Sbjct: 216 P 216


>gi|238757311|ref|ZP_04618497.1| Inner membrane lipoprotein yiaD [Yersinia aldovae ATCC 35236]
 gi|238704350|gb|EEP96881.1| Inner membrane lipoprotein yiaD [Yersinia aldovae ATCC 35236]
          Length = 226

 Score =  128 bits (321), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 50/219 (22%), Positives = 91/219 (41%), Gaps = 36/219 (16%)

Query: 1   MIKELGL---SMFIMTTISGC-------------------------------GLASREKK 26
           M K + +   ++ +  T+S C                                 +  ++ 
Sbjct: 8   MKKRILVTVTAISVALTLSACTTNPYTGESQAGKSGYGAGIGAALGAGIGMLSSSKHDRG 67

Query: 27  KVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV-SE 85
           K  L  +     +    G  +D  E + + ++  TG+ V+R GD I   +P +V+F    
Sbjct: 68  KGALIGAAAGAALGGGAGYYMDVQEAKLREKMSGTGVSVTRQGDNIVLNMPNNVTFDTDS 127

Query: 86  VFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRG 145
             L+      L  +A +L ++  T + +  +TDS G   +N+ +SQ+RAD + S LI + 
Sbjct: 128 SNLKPAGANTLTGVAMVLKEYDKTAVNVTGYTDSTGARAHNMTLSQQRADSVGSTLIVQ- 186

Query: 146 VSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
             +   I   G     P+ TN T  G+  N+R+EI + P
Sbjct: 187 GVAANRIRTSGAGPDNPVATNSTAAGKAQNRRVEITLSP 225


>gi|148555237|ref|YP_001262819.1| OmpA/MotB domain-containing protein [Sphingomonas wittichii RW1]
 gi|148500427|gb|ABQ68681.1| OmpA/MotB domain protein [Sphingomonas wittichii RW1]
          Length = 222

 Score =  128 bits (321), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 46/213 (21%), Positives = 87/213 (40%), Gaps = 32/213 (15%)

Query: 3   KELGLSMFIMTTISGCGLASRE------------------------------KKKVFLHK 32
           K L       T ++GC                                     +   +  
Sbjct: 5   KMLVAMFAASTLLAGCVTDPDTGQRRLSKAGIGAIAGTALGAGAGALVGGRHNRTEAIVG 64

Query: 33  SNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKK 91
           +    +     G  +D+ E + + Q   TG+ V R GD +   +P  ++F  +   ++ +
Sbjct: 65  AGIGALAGGAIGVYMDRQEAKLREQTAGTGVEVERQGDELLLNMPAGITFATNSYEVQPQ 124

Query: 92  FLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRF 151
           F   L  +A+ L+++  T + +  HTDS G+   N  +S+ RA+ + +  +     +   
Sbjct: 125 FRTTLDKVASTLSEYGKTYVDVYGHTDSTGSDAINEPLSRNRAEAVAN-YLSGHGVAAAR 183

Query: 152 ISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           I  +GF  + P+ +N T  GRQ N+R+EI+I P
Sbjct: 184 IGTQGFGSRQPVASNATPDGRQANRRVEIKIVP 216


>gi|149377133|ref|ZP_01894882.1| Outer membrane protein and related peptidoglycan-associated
           (lipo)protein [Marinobacter algicola DG893]
 gi|149358551|gb|EDM47024.1| Outer membrane protein and related peptidoglycan-associated
           (lipo)protein [Marinobacter algicola DG893]
          Length = 222

 Score =  128 bits (321), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 48/166 (28%), Positives = 92/166 (55%), Gaps = 2/166 (1%)

Query: 20  LASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVH 79
            +S ++ K  L  +     +    G  +DK E + + +L+ +G+ V R GD I   +P +
Sbjct: 56  SSSSDRGKGALIGAASGAAIGGGIGYYMDKQEAQLRRKLEGSGVRVVRNGDEIELVMPGN 115

Query: 80  VSFV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIK 138
           ++F  ++  ++  F   L+ +A +L +F  T+I I+ HTDS G+   N L+S+ RA  ++
Sbjct: 116 ITFDVNQSSIKPSFSNTLESVALVLKEFDKTIIQIEGHTDSTGSRDYNQLLSERRAGSVR 175

Query: 139 SYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
            +L+ +     +     G+  +YPI +NDT+ GR+ N+R+E+ + P
Sbjct: 176 DFLLNQ-GIEPKRTRATGYGPRYPIASNDTESGREQNRRVELTLVP 220


>gi|84391232|ref|ZP_00991563.1| outer membrane protein [Vibrio splendidus 12B01]
 gi|84376521|gb|EAP93399.1| outer membrane protein [Vibrio splendidus 12B01]
          Length = 222

 Score =  128 bits (321), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 52/221 (23%), Positives = 97/221 (43%), Gaps = 39/221 (17%)

Query: 2   IKELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVN--------------------- 40
           +K++ L++ +   ++GC    R+       ++N                           
Sbjct: 1   MKKITLALALTVALTGCQATQRQNATTGESETNSATQGALIGAIAGAVAGAATGDDSKDR 60

Query: 41  ---------------KRFGSSLDKAEDEFQMQLQDTGIVVSRIG-DMITCYIPVHV-SFV 83
                             G   D+ E   + +L ++G+ V R+G + +   +   +    
Sbjct: 61  RKRALIGAAGGAAVGGGIGYYFDQQEAALREELMNSGVQVERVGENQLLLRLENGIGFGS 120

Query: 84  SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQ 143
               LE      L+ +A IL ++P T + I  HTDS G+  +N ++S+ RA+ ++++LI 
Sbjct: 121 GSYALESSIHNTLRGVARILVEYPDTSLVIDGHTDSTGSESSNQILSERRAESVRAFLIS 180

Query: 144 RGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           + V++ R I  RG   +YP+  N+T  GR  N+R+EIQI P
Sbjct: 181 QDVAAGRAI-ARGNGERYPLCDNNTSQGRACNRRVEIQILP 220


>gi|71281842|ref|YP_271675.1| ompA family protein [Colwellia psychrerythraea 34H]
 gi|71147582|gb|AAZ28055.1| ompA family protein [Colwellia psychrerythraea 34H]
          Length = 222

 Score =  128 bits (321), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 47/219 (21%), Positives = 91/219 (41%), Gaps = 37/219 (16%)

Query: 2   IKELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGS---------------- 45
           +K++  +   +  +  C        +    K+           +                
Sbjct: 1   MKKIITTASAILLLQACTTFDPYTGESKTSKTAIGATTGAGLAAVVAYISNKDEDSNTRN 60

Query: 46  -------------------SLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSE 85
                               +D  E + + QL+D+G+ + R GD I   +P +++F  S 
Sbjct: 61  KRILAAAAGGAAIGGGIGFYMDSQEAKLRKQLRDSGVSIQREGDKINLIMPGNITFATSS 120

Query: 86  VFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRG 145
             +   F  +L  +A +L ++  T++ +  HTDS G+ + N  +S+ERA  + +YL  + 
Sbjct: 121 SNINTNFTGVLNSVALVLEEYNKTLVVVSGHTDSSGSAQYNQKLSEERAGSVANYLRGQK 180

Query: 146 VSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           + S R + V GF    P+  N +  GR+ N+R+EI + P
Sbjct: 181 ILSER-LEVVGFGEAQPVADNQSAGGRELNRRVEITLLP 218


>gi|146281506|ref|YP_001171659.1| OmpA family protein [Pseudomonas stutzeri A1501]
 gi|145569711|gb|ABP78817.1| OmpA family protein [Pseudomonas stutzeri A1501]
 gi|327479683|gb|AEA82993.1| OmpA family protein [Pseudomonas stutzeri DSM 4166]
          Length = 217

 Score =  128 bits (321), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 55/180 (30%), Positives = 86/180 (47%), Gaps = 2/180 (1%)

Query: 6   GLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVV 65
           G+       I     + +++ K  L  +         +G  +D  E + +  LQ TG+ V
Sbjct: 38  GIGAVSGAVIGAATSSKKDRTKGALIGAAVGGAAGGGYGYYVDTQEAKLRQTLQGTGVQV 97

Query: 66  SRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLK 124
            R GD +T  +P +++F  +   +   F P L  +  +  +F    + I  HTDS G+L+
Sbjct: 98  QRNGDNLTLIMPGNITFASNSADISSSFYPTLNSLVQVFKEFNKNGVDIVGHTDSTGSLQ 157

Query: 125 NNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
            N  +S  RA  + SYLI  GV+  R IS  G     PI +NDT  GR  N+R+EI + P
Sbjct: 158 LNQDLSNRRAQSVASYLIANGVAPAR-ISSYGAGPSQPIASNDTAAGRAQNRRVEINLRP 216


>gi|294782096|ref|ZP_06747422.1| outer membrane porin F [Fusobacterium sp. 1_1_41FAA]
 gi|294480737|gb|EFG28512.1| outer membrane porin F [Fusobacterium sp. 1_1_41FAA]
          Length = 183

 Score =  128 bits (321), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 48/187 (25%), Positives = 83/187 (44%), Gaps = 5/187 (2%)

Query: 1   MIKELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQD 60
           M K++   + +   ++ C  + +  K   +   +      +   ++    ED        
Sbjct: 1   MKKKIFAVLMLALLVTACSSSKKVIKNTGVGVDSANKYAIEDTEANKKPLEDII--VFDQ 58

Query: 61  TGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDS 119
            G+ + R G+ +   +P  + F   +  ++    P L  +A  L +     I I  +TD 
Sbjct: 59  EGVTIRREGNNLILSMPELILFDFDKYVVKDGIKPSLATLAKALGENKDIHIKIDGYTDF 118

Query: 120 IGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIE 179
           IGT   NL +S +RA  IK +LI +G   +  IS+ G+  + P DTN T  GR  N+R+E
Sbjct: 119 IGTEAYNLDLSVKRARAIKEFLISKGAIGSN-ISIEGYGEQNPADTNQTAAGRSRNRRVE 177

Query: 180 IQIFPRG 186
             I  RG
Sbjct: 178 F-IISRG 183


>gi|269121368|ref|YP_003309545.1| OmpA/MotB domain protein [Sebaldella termitidis ATCC 33386]
 gi|268615246|gb|ACZ09614.1| OmpA/MotB domain protein [Sebaldella termitidis ATCC 33386]
          Length = 215

 Score =  128 bits (321), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 47/216 (21%), Positives = 91/216 (42%), Gaps = 32/216 (14%)

Query: 1   MIKELGLSMFIMTTISGCGLASRE-----------------------------KKKVFLH 31
           M  +  +++ +   +  C   + E                               K  + 
Sbjct: 1   MKNKFIMTLALSLIVVSCTTTNPETGKTQASKTTIGAGAGAAAGAVLGQIIGKDTKGTVI 60

Query: 32  KSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDM-ITCYIPVHVSF-VSEVFLE 89
            +     V    G+  DK E + +  L+ TG+ V+R  +  I    P +V+F  +   + 
Sbjct: 61  GTAAGAAVGAVIGNVFDKQEAKLREDLKGTGVEVTRTAEGEIKLVAPENVTFATNSSTIS 120

Query: 90  KKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSN 149
            +F   L  IA++L ++P + I +  HTDS G    N  +S  RA+ + +  +++   ++
Sbjct: 121 SRFTNTLDSIASVLKEYPDSNITVSGHTDSTGNDAINNPLSVNRANSVAN-YLKQEGIAS 179

Query: 150 RFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPR 185
             I+  G+  K P+ +N T  GR  N+R+EI+I  +
Sbjct: 180 SRITAVGYGSKQPVASNSTSDGRAQNRRVEIKITAK 215


>gi|270264140|ref|ZP_06192407.1| hypothetical protein SOD_g00710 [Serratia odorifera 4Rx13]
 gi|270041789|gb|EFA14886.1| hypothetical protein SOD_g00710 [Serratia odorifera 4Rx13]
          Length = 219

 Score =  127 bits (320), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 51/218 (23%), Positives = 95/218 (43%), Gaps = 36/218 (16%)

Query: 2   IKELGL---SMFIMTTISGC-------------------------------GLASREKKK 27
           +K + +   ++ +  T+S C                                 + +++ K
Sbjct: 1   MKRIAIIAGAVSVALTLSACTTNPYTGESEAGKSGIGAGIGAALGAGVGMISSSKKDRGK 60

Query: 28  VFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEV- 86
             L  +     +    G  +D  E + + +++ TG+ V+R GD I   +P +V+F S   
Sbjct: 61  GALIGAAAGAALGGGAGYYMDVQEAKLRDKMKGTGVSVTRQGDNIVLNMPNNVTFDSSSA 120

Query: 87  FLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGV 146
            L+      L  +A +L ++P T + +  +TDS G+   N+ +SQ+RAD + S LI +  
Sbjct: 121 TLKPAGANTLTGVAMVLKEYPKTAVNVIGYTDSSGSRALNMTLSQQRADGVGSALITQ-G 179

Query: 147 SSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
            +   I   G     PI +N T  G+  N+R+EI + P
Sbjct: 180 VAANRIRTSGAGPDNPIASNSTAEGKAQNRRVEITLSP 217


>gi|315122505|ref|YP_004062994.1| OmpA/MotB [Candidatus Liberibacter solanacearum CLso-ZC1]
 gi|313495907|gb|ADR52506.1| OmpA/MotB [Candidatus Liberibacter solanacearum CLso-ZC1]
          Length = 190

 Score =  127 bits (320), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 103/185 (55%), Positives = 128/185 (69%), Gaps = 1/185 (0%)

Query: 1   MIKELGLSMFIMTTISGCGLASREKK-KVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQ 59
           MIK  G  M +MT +SGC      K     L+  N+  ++   FGS LDKAEDE +MQLQ
Sbjct: 1   MIKRTGALMVVMTALSGCSNKGNHKLFSKKLNNENNIILIKPNFGSHLDKAEDELRMQLQ 60

Query: 60  DTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDS 119
           D  + + R  D ITC+IPVH++F S   L K  +P+L  IAT LNKFPST IAI  HTDS
Sbjct: 61  DVDVSIIRKYDQITCHIPVHIAFSSGSILHKDIVPVLNSIATTLNKFPSTKIAITGHTDS 120

Query: 120 IGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIE 179
           IGTL+ NLLISQ+R+ +I  YLI++GVS +RF   +GFAYK PIDTNDT+ GR+NNQR+E
Sbjct: 121 IGTLEYNLLISQQRSQIITDYLIEKGVSPDRFAPPQGFAYKRPIDTNDTQEGRKNNQRVE 180

Query: 180 IQIFP 184
           I IFP
Sbjct: 181 INIFP 185


>gi|83945760|ref|ZP_00958104.1| OmpA family protein [Oceanicaulis alexandrii HTCC2633]
 gi|83850850|gb|EAP88711.1| OmpA family protein [Oceanicaulis alexandrii HTCC2633]
          Length = 217

 Score =  127 bits (320), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 52/214 (24%), Positives = 100/214 (46%), Gaps = 31/214 (14%)

Query: 1   MIKELGLSMFIMTTISGCGLASR-----------------------------EKKKVFLH 31
           M + L  ++  +   + C    +                             + ++  L 
Sbjct: 2   MFRSLIAAVMALGLAAACTTTDQYGNVTRNNTGTGILAGAAAGALLGTLAGGDDRRNALI 61

Query: 32  KSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEK 90
            +    +     G+ +D+ E+ F+ +L+ +G+ V R+G+ +   +P  V+F  +   +++
Sbjct: 62  GAGVGALAGGGVGNYMDRQENAFRERLRGSGVTVRRVGNDLYLVMPGDVTFATNSAQIDQ 121

Query: 91  KFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNR 150
           +F P+L  +A +L  +P+T + +  H DS+G    N  +S+ RA  + + LI RGV  +R
Sbjct: 122 RFGPVLNDVADVLMTYPATYVDVIGHADSVGDASYNQTLSERRASSVAAELIARGVMRDR 181

Query: 151 FISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
            + V G     PI +NDT  GR  N+R+EI+I P
Sbjct: 182 -LYVAGMGESQPIASNDTDSGRAANRRVEIKIAP 214


>gi|298369467|ref|ZP_06980784.1| OmpA family protein [Neisseria sp. oral taxon 014 str. F0314]
 gi|298282024|gb|EFI23512.1| OmpA family protein [Neisseria sp. oral taxon 014 str. F0314]
          Length = 224

 Score =  127 bits (320), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 46/188 (24%), Positives = 83/188 (44%), Gaps = 2/188 (1%)

Query: 4   ELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGI 63
           +  +       + G   A     K   + +     +    G  +D    + +  L +T +
Sbjct: 34  KTAVYGLGGAAVCGIVGALTHGGKGARNSALACGAIGAGVGGYMDYQAKKLRESLANTDV 93

Query: 64  VVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGT 122
            V + G+ I   +P +V+F  +   L       L   +  L ++P T + I  HTD+ G+
Sbjct: 94  KVEQQGNQIKLVMPENVTFATNSATLSANARDALTAASKTLVQYPDTTLTINGHTDNTGS 153

Query: 123 LKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
              N  +S+ RA  + S+L  +GV+ +R ++  G   + P+ +N T  GR  N+R+EI I
Sbjct: 154 DAINDPLSRNRAQSVASFLQSQGVAGSR-LTTAGHGSRQPVASNATPEGRAQNRRVEILI 212

Query: 183 FPRGNIKK 190
            P  N  K
Sbjct: 213 NPDQNAIK 220


>gi|260890151|ref|ZP_05901414.1| OmpA family protein [Leptotrichia hofstadii F0254]
 gi|260860174|gb|EEX74674.1| OmpA family protein [Leptotrichia hofstadii F0254]
          Length = 215

 Score =  127 bits (320), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 54/212 (25%), Positives = 91/212 (42%), Gaps = 30/212 (14%)

Query: 1   MIKELGLSMFIMTTISGCGLAS---------------------------REKKKVFLHKS 33
           M K L + +  + T+  C  A+                            +  K  L  +
Sbjct: 1   MKKVLAIILLSLLTVVSCTTATDGTRKVSKTGVGAGIGAAAGAVIGQAIGKDTKGTLIGT 60

Query: 34  NDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDM-ITCYIPVHVSFV-SEVFLEKK 91
                V    G+  D+ E E + +L+ TG+ V R G+  I    P +++F  +   ++ +
Sbjct: 61  AGGAAVGAAIGNIFDRQEKELRNKLKGTGVDVKRTGEGEIKLTAPENITFDINSYVIKPQ 120

Query: 92  FLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRF 151
           F   L  +AT+L  +P + I +  HTD+ G    N  +S  RA  +    ++    S+  
Sbjct: 121 FRNTLDSVATVLKTYPDSTIVVSGHTDTTGNDAINNPLSINRASSV-ESYLESQGISSSR 179

Query: 152 ISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
           I+ RGF  K PI +N T+ GR  N+R+EI I 
Sbjct: 180 ITSRGFGSKQPIASNSTEAGRAQNRRVEIAII 211


>gi|237728863|ref|ZP_04559344.1| OmpA/MotB domain-containing protein [Citrobacter sp. 30_2]
 gi|226909485|gb|EEH95403.1| OmpA/MotB domain-containing protein [Citrobacter sp. 30_2]
          Length = 220

 Score =  127 bits (320), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 52/219 (23%), Positives = 90/219 (41%), Gaps = 36/219 (16%)

Query: 1   MIKELGLSMFI---MTTISGCGLASREKKKVFL---HKSNDTDIVNKRFGS--------- 45
           M K + +   I      +SGC       ++        +    +V    G+         
Sbjct: 1   MKKRVFVIAAIVSGALAVSGCTTNPYTGEREAGKSGIGAGIGSLVGAGIGALSSSKKDRG 60

Query: 46  -------------------SLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEV 86
                               +D  E + + ++Q TG+ V+R GD I   +P +V+F S  
Sbjct: 61  KGALIGAAAGAAVGGGIGYYMDVQEAKLREKMQGTGVSVTRSGDNIILNMPNNVTFDSSS 120

Query: 87  -FLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRG 145
             L+      L  +A +L ++  T + +   TDS G+   N+ +SQ+RAD + S LI + 
Sbjct: 121 ANLKPAGANTLTGVAMVLKEYNKTAVNVLGFTDSTGSQDLNMRLSQQRADSVASALITQ- 179

Query: 146 VSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
             +   I  +G     PI +N T  G+  N+R+EI + P
Sbjct: 180 GVAANRIRTQGMGPANPIASNSTAEGKAQNRRVEITLSP 218


>gi|261341826|ref|ZP_05969684.1| hypothetical protein ENTCAN_08313 [Enterobacter cancerogenus ATCC
           35316]
 gi|288316202|gb|EFC55140.1| OmpA family protein [Enterobacter cancerogenus ATCC 35316]
          Length = 220

 Score =  127 bits (320), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 51/219 (23%), Positives = 90/219 (41%), Gaps = 36/219 (16%)

Query: 1   MIKELGLSMFI---MTTISGCGLASREKKKVFL---HKSNDTDIVNKRFGS--------- 45
           M K + +   +      +SGC       ++        +    +V    G+         
Sbjct: 1   MKKRVLVIAALVSGALAVSGCTTNPYSGEREAGKSGIGAGIGSLVGAGVGALSSSKKDRG 60

Query: 46  -------------------SLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEV 86
                               +D  E + + ++Q TG+ V+R GD I   +P +V+F S  
Sbjct: 61  KGALIGAAAGAALGGGVGYYMDVQEAKLRDKMQGTGVSVTRSGDNIILNMPNNVTFDSSS 120

Query: 87  -FLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRG 145
             L+      L  +A +L ++  T + +  +TDS G+   N+ +SQ+RAD + S LI + 
Sbjct: 121 ATLKPAGANTLTGVAMVLKEYSKTAVNVIGYTDSTGSQDLNMRLSQQRADSVASALITQ- 179

Query: 146 VSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
             +   I   G     PI +N T  G+  N+R+EI + P
Sbjct: 180 GVAANRIRTSGMGPANPIASNSTAEGKAQNRRVEITLSP 218


>gi|269963902|ref|ZP_06178214.1| putative lipoprotein [Vibrio harveyi 1DA3]
 gi|269831389|gb|EEZ85536.1| putative lipoprotein [Vibrio harveyi 1DA3]
          Length = 219

 Score =  127 bits (320), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 51/216 (23%), Positives = 94/216 (43%), Gaps = 39/216 (18%)

Query: 7   LSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFG---------------------- 44
           +++ ++  ++GC    R+      +++N T                              
Sbjct: 3   IALALVLALTGCQATQRQNATTGEYETNSTTQGALIGAIAGAAIGLATGDDAKERRKHAL 62

Query: 45  --------------SSLDKAEDEFQMQLQDTGIVVSRIG-DMITCYIPVHVSFVSEVF-L 88
                            D+ E E +  L ++G+ V R+G + +   +   + F S  + L
Sbjct: 63  IGAAAGGATGAGVGYYFDQQEAELRRALLNSGVQVERVGENQLLLRMENGIGFSSSSYQL 122

Query: 89  EKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSS 148
           +      L+ +A IL ++P T + I  +TDS G+   N  +S+ RA+ ++ YL+ + V+ 
Sbjct: 123 DASIHNTLRGVARILVEYPDTSLVIDGYTDSTGSDSYNQTLSERRAESVRQYLVSQNVAP 182

Query: 149 NRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
            R I  RG+  + PI +N T  GR  N+R+EIQI P
Sbjct: 183 GRAI-ARGYGERNPICSNQTSEGRACNRRVEIQILP 217


>gi|300955043|ref|ZP_07167452.1| OmpA family protein [Escherichia coli MS 175-1]
 gi|300318040|gb|EFJ67824.1| OmpA family protein [Escherichia coli MS 175-1]
          Length = 215

 Score =  127 bits (319), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 54/216 (25%), Positives = 93/216 (43%), Gaps = 36/216 (16%)

Query: 1   MIKELGLSMFI---MTTISGCGLASREKKKVF---LHKSNDTDIVNKRFGS--------- 45
           M K + L   +      +SGC       ++        +    +V    G+         
Sbjct: 1   MKKRVYLIAAVVSGALAVSGCTTNPYTGEREAGKSAIGAGLGSLVGAGIGALSSSKKDRG 60

Query: 46  -------------------SLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEV 86
                               +D  E + + +++ TG+ V+R GD I   +P +V+F S  
Sbjct: 61  KGALIGAAAGAALGGGVGYYMDVQEAKLRDKMRGTGVSVTRSGDNIILNMPNNVTFDSSS 120

Query: 87  -FLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRG 145
             L+      L  +A +L ++P T + +  +TDS G    N+ +SQ+RAD + S LI +G
Sbjct: 121 ATLKPAGANTLTGVAMVLKEYPKTAVNVIGYTDSTGGHDLNMRLSQQRADSVASALITQG 180

Query: 146 VSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQ 181
           V ++R I  +G     PI +N T  G+  N+R+EI 
Sbjct: 181 VDASR-IRTQGLGPANPIASNSTAEGKAQNRRVEIT 215


>gi|283835926|ref|ZP_06355667.1| OmpA family protein [Citrobacter youngae ATCC 29220]
 gi|291068103|gb|EFE06212.1| OmpA family protein [Citrobacter youngae ATCC 29220]
          Length = 220

 Score =  127 bits (319), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 52/219 (23%), Positives = 90/219 (41%), Gaps = 36/219 (16%)

Query: 1   MIKELGLSMFI---MTTISGCGLASREKKKVFL---HKSNDTDIVNKRFGS--------- 45
           M K + +   I      +SGC       ++        +    +V    G+         
Sbjct: 1   MKKRVFVIAAIVSGALAVSGCTTNPYTGEREAGKSGIGAGIGSLVGAGIGALSSSKKDRG 60

Query: 46  -------------------SLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVS-E 85
                               +D  E + + ++Q TG+ V+R GD I   +P +V+F S  
Sbjct: 61  KGALIGAAAGAAVGGGIGYYMDVQEAKLREKMQGTGVSVTRSGDNIILNMPNNVTFDSNS 120

Query: 86  VFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRG 145
             L+      L  +A +L ++  T + +   TDS G+   N+ +SQ+RAD + S LI + 
Sbjct: 121 SNLKPAGANTLTGVAMVLKEYDKTAVNVLGFTDSTGSQDLNMRLSQQRADSVASALITQ- 179

Query: 146 VSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
             +   I  +G     PI +N T  G+  N+R+EI + P
Sbjct: 180 GVAANRIRTQGMGPANPIASNSTAEGKAQNRRVEITLSP 218


>gi|296313347|ref|ZP_06863288.1| OmpA family protein [Neisseria polysaccharea ATCC 43768]
 gi|296840164|gb|EFH24102.1| OmpA family protein [Neisseria polysaccharea ATCC 43768]
          Length = 225

 Score =  127 bits (319), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 50/182 (27%), Positives = 80/182 (43%), Gaps = 2/182 (1%)

Query: 4   ELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGI 63
           +  +       + G   A     K   + +     +    G  +D  E   +  L  T +
Sbjct: 34  KSAMYGLGGAAVCGIVGALTHSGKGARNSALACGAIGAGIGGYMDYQEQRLRQSLTGTQV 93

Query: 64  VVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGT 122
            V R G+ I   +P +V+F      L       L   A  L ++P T + I  HTD+ G+
Sbjct: 94  QVQRQGNQIKLVMPENVTFATGSAVLSNNAQFALNTAAQTLVQYPDTTLTINGHTDNTGS 153

Query: 123 LKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
              N  +SQ RA  +  YL  RGV+++R ++V G+    P+ +N T  GR  N+R+EI I
Sbjct: 154 DAVNNPLSQHRAQAVAYYLQSRGVAASR-LAVYGYGSHMPVASNATAEGRAQNRRVEILI 212

Query: 183 FP 184
            P
Sbjct: 213 NP 214


>gi|254848320|ref|ZP_05237670.1| lipoprotein [Vibrio cholerae MO10]
 gi|254844025|gb|EET22439.1| lipoprotein [Vibrio cholerae MO10]
          Length = 222

 Score =  127 bits (319), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 53/221 (23%), Positives = 98/221 (44%), Gaps = 39/221 (17%)

Query: 2   IKELGLSMFIMTTISGC-------GLASREKKKVFLHKSNDTDIVNKRFG---------- 44
           + +  L +  +  +SGC             +       +    +     G          
Sbjct: 1   MNKTTLLLAAVVALSGCQATQRQNATTGETETNATTKGALLGVLAGAAVGLATGDDAKER 60

Query: 45  -------------------SSLDKAEDEFQMQLQDTGIVVSRIG-DMITCYIPVHVSFVS 84
                                 D+ E E +  L D+G+ V R+G + +   +   + F S
Sbjct: 61  RKHALIGAAGGAAVGGGIGYYFDQQEAELRKALLDSGVQVVRVGENQLMLRMENGIGFTS 120

Query: 85  EVF-LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQ 143
             + L+      L+ +A IL ++P T + I+ HTDS G+   N ++S++RA+ ++S+L+ 
Sbjct: 121 NSYQLDSYIHKTLRGVARILVEYPDTSLVIEGHTDSTGSDTTNQVLSEKRAESVRSFLLS 180

Query: 144 RGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           +GV++ R I  RG   ++P+ +N+T  GR  N+R+EIQI P
Sbjct: 181 QGVAAGRAI-ARGNGERFPLCSNNTAEGRACNRRVEIQILP 220


>gi|326386301|ref|ZP_08207925.1| OmpA/MotB [Novosphingobium nitrogenifigens DSM 19370]
 gi|326209526|gb|EGD60319.1| OmpA/MotB [Novosphingobium nitrogenifigens DSM 19370]
          Length = 229

 Score =  127 bits (319), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 50/145 (34%), Positives = 80/145 (55%), Gaps = 4/145 (2%)

Query: 43  FGSSLDKAEDEFQMQLQDTGIVVSRIGDM--ITCYIPVHVSFVSEVF-LEKKFLPMLQLI 99
            G ++DK   E + +   +G+ V  + D   I   +P  V+F ++   ++  F   L  +
Sbjct: 74  VGYTMDKQIKELKEKTAGSGVDVKSVDDGQAILVNLPSGVTFDTDSTVIKPGFRDTLDKV 133

Query: 100 ATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAY 159
           A  LN++P+++I +  HTDS G+   N  +S+ RA V+  YL  +GVSS R  S  GF  
Sbjct: 134 ADSLNRYPNSLIDVYGHTDSTGSDAYNQTLSENRARVVADYLSSKGVSSARIRST-GFGK 192

Query: 160 KYPIDTNDTKVGRQNNQRIEIQIFP 184
             P+ +NDT  GR  N+R+EI+I P
Sbjct: 193 TQPVASNDTPEGRAANRRVEIKIVP 217


>gi|260773001|ref|ZP_05881917.1| outer membrane protein [Vibrio metschnikovii CIP 69.14]
 gi|260612140|gb|EEX37343.1| outer membrane protein [Vibrio metschnikovii CIP 69.14]
          Length = 222

 Score =  127 bits (319), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 58/221 (26%), Positives = 100/221 (45%), Gaps = 39/221 (17%)

Query: 2   IKELGLSMFIMTTISGCGLASREKKKVFLHKSNDTD------------------------ 37
           +K++ L+M ++ T+SGC    R+       ++N                           
Sbjct: 1   MKKITLAMALVITLSGCAATQRQNATTGESETNAATRGALIGAVAGAAAGLATGDNAKQR 60

Query: 38  ------------IVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDM-ITCYIPVHVSFVS 84
                        V    G   D+ E   + +L  +G+ V R+GD  +   +   + F +
Sbjct: 61  RQRALIGATGGAAVGGGVGYYFDQQEAALREELLHSGVQVQRVGDNQLLLRMENGIGFQT 120

Query: 85  EVF-LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQ 143
             + L+      L+ +A IL ++P T + I  HTDS G    N ++S+ RA+ ++S+L+ 
Sbjct: 121 NSYQLDSSIHRTLRGVAKILVQYPDTSLVIDGHTDSTGGDTTNQVLSERRAESVRSFLLS 180

Query: 144 RGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           +GV+  R I  RG   ++PI TN T  GR  N+R++IQI P
Sbjct: 181 QGVAPGRAI-ARGNGSRFPICTNSTVEGRACNRRVDIQILP 220


>gi|257451630|ref|ZP_05616929.1| Outer membrane porin F [Fusobacterium sp. 3_1_5R]
 gi|257466946|ref|ZP_05631257.1| Outer membrane porin F [Fusobacterium gonidiaformans ATCC 25563]
          Length = 183

 Score =  127 bits (319), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 50/186 (26%), Positives = 86/186 (46%), Gaps = 10/186 (5%)

Query: 1   MIKELGLSMFIM-TTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQL- 58
           M K LG+++ +       CG  S    +    + N    +       +D A+   +  + 
Sbjct: 1   MKKYLGITLLLASFVFVACGKTSNTSIRDLSTEGNQNFAI-----EDIDAAKKPLEDIIV 55

Query: 59  -QDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSH 116
               G+ + R G+ +   +P  + F  ++  ++    P L+ +A  L       I I  +
Sbjct: 56  FNQDGVTIRREGNNLILSMPELILFDFNKYEVKNGIKPSLRTLANALGANADIKIKIDGY 115

Query: 117 TDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQ 176
           TD IG+   NL +S  RA  IKSYL+ +G   N  IS+ G+  + P+ +NDT+ GR  N+
Sbjct: 116 TDFIGSEGYNLELSVNRAKAIKSYLVAQGAIENN-ISIEGYGKQNPVASNDTESGRARNR 174

Query: 177 RIEIQI 182
           R+E  I
Sbjct: 175 RVEFII 180


>gi|218514237|ref|ZP_03511077.1| outer membrane lipoprotein [Rhizobium etli 8C-3]
          Length = 141

 Score =  127 bits (319), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 50/138 (36%), Positives = 78/138 (56%), Gaps = 2/138 (1%)

Query: 48  DKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV-SEVFLEKKFLPMLQLIATILNKF 106
           D+ E E + QL+ TGI V+R GD I   +P +++F   +  ++  F P L  +A +L KF
Sbjct: 1   DQQEAELRAQLEGTGISVTRNGDNIILNMPSNITFDVDQDAVKPGFYPTLNSVAIVLRKF 60

Query: 107 PSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTN 166
             T+I +  HTDS G+L++N  +SQ RA  +    +       R +S  GF    P+ +N
Sbjct: 61  NRTLIDVNGHTDSTGSLQHNQDLSQRRALSVAD-YLGGQGIDQRRVSAVGFGPSQPVASN 119

Query: 167 DTKVGRQNNQRIEIQIFP 184
            ++ GR  N+R+EIQI P
Sbjct: 120 ASEAGRAQNRRVEIQIAP 137


>gi|260432355|ref|ZP_05786326.1| inner membrane lipoprotein YiaD [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260416183|gb|EEX09442.1| inner membrane lipoprotein YiaD [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 223

 Score =  127 bits (319), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 48/216 (22%), Positives = 77/216 (35%), Gaps = 34/216 (15%)

Query: 5   LGLSMFIMTTISGCGL-----ASREKKKVFLHKSNDTDIVNKRFG--------------- 44
           L L +     +  C          +  +     +    ++    G               
Sbjct: 8   LPLGLSAALVLGACTDPGTLRVQDDPNQNAKQGAILGGLIGAGVGAIANDSDPGLGALAG 67

Query: 45  ------------SSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV-SEVFLEKK 91
                       + LD+   E + QL + GI +   GD +   +P  ++F      +   
Sbjct: 68  AAIGAAGGGLIGNQLDRQAAELRQQLANDGITIVNAGDRLIVTVPNDITFDTDSATVRPA 127

Query: 92  FLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRF 151
               L  +   L  +P + + I  HTDS G    N  +S+ RA  +   L   GVS  R 
Sbjct: 128 LRADLVRVGQNLVNYPKSNVQIIGHTDSDGDAGYNQALSERRASAVADILHANGVSYAR- 186

Query: 152 ISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGN 187
           I+  G     PI +N T  G+  N+R+EI I P GN
Sbjct: 187 ITTIGRGENQPIASNLTPEGKAQNRRVEIVIVPSGN 222


>gi|315918088|ref|ZP_07914328.1| outer membrane porin F [Fusobacterium gonidiaformans ATCC 25563]
 gi|317058194|ref|ZP_07922679.1| outer membrane porin F [Fusobacterium sp. 3_1_5R]
 gi|313683870|gb|EFS20705.1| outer membrane porin F [Fusobacterium sp. 3_1_5R]
 gi|313691963|gb|EFS28798.1| outer membrane porin F [Fusobacterium gonidiaformans ATCC 25563]
          Length = 189

 Score =  127 bits (318), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 50/186 (26%), Positives = 86/186 (46%), Gaps = 10/186 (5%)

Query: 1   MIKELGLSMFIM-TTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQL- 58
           M K LG+++ +       CG  S    +    + N    +       +D A+   +  + 
Sbjct: 7   MKKYLGITLLLASFVFVACGKTSNTSIRDLSTEGNQNFAI-----EDIDAAKKPLEDIIV 61

Query: 59  -QDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSH 116
               G+ + R G+ +   +P  + F  ++  ++    P L+ +A  L       I I  +
Sbjct: 62  FNQDGVTIRREGNNLILSMPELILFDFNKYEVKNGIKPSLRTLANALGANADIKIKIDGY 121

Query: 117 TDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQ 176
           TD IG+   NL +S  RA  IKSYL+ +G   N  IS+ G+  + P+ +NDT+ GR  N+
Sbjct: 122 TDFIGSEGYNLELSVNRAKAIKSYLVAQGAIENN-ISIEGYGKQNPVASNDTESGRARNR 180

Query: 177 RIEIQI 182
           R+E  I
Sbjct: 181 RVEFII 186


>gi|88798562|ref|ZP_01114146.1| Outer membrane protein and related peptidoglycan-associated
           (lipo)protein [Reinekea sp. MED297]
 gi|88778662|gb|EAR09853.1| Outer membrane protein and related peptidoglycan-associated
           (lipo)protein [Reinekea sp. MED297]
          Length = 224

 Score =  127 bits (318), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 48/180 (26%), Positives = 95/180 (52%), Gaps = 4/180 (2%)

Query: 6   GLSMFIMTTISGCGLASREK-KKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIV 64
            ++  ++  + G   A +E+  K  +  +    +     G  +D+ E E + +L  TG+ 
Sbjct: 40  AIAGGLIGAVIGAATAPKEERAKRAIIGAGIGGVAGGGVGYYMDQQEKELRDELVGTGVQ 99

Query: 65  VSRIGD-MITCYIPVHVSFV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGT 122
           V R  +  I   +P +++F  +   +   F+P L+ +A +L ++ +T++ I  HTDS G+
Sbjct: 100 VKRTEEGQIDLIMPGNITFDVNSSTVADGFIPTLRSVAKVLKEYENTLVTISGHTDSSGS 159

Query: 123 LKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
              N L+S++RA  + + ++Q G+   R ++  G+    PI +NDT  GR  N+R+EI +
Sbjct: 160 EDYNQLLSEQRATSVANIILQEGIVVER-VAAAGYGELQPIASNDTPEGRAENRRVEITL 218


>gi|90413724|ref|ZP_01221712.1| Putative OmpA family protein [Photobacterium profundum 3TCK]
 gi|90325193|gb|EAS41690.1| Putative OmpA family protein [Photobacterium profundum 3TCK]
          Length = 241

 Score =  127 bits (318), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 51/180 (28%), Positives = 90/180 (50%), Gaps = 2/180 (1%)

Query: 6   GLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVV 65
            +       I     +  ++ K  L  +     +    G  +D  E + + QL+ TGI V
Sbjct: 61  LIGAISGAAIGVASSSKSDRGKGALIGAASGAALGGGIGYYMDVQETKLRQQLESTGISV 120

Query: 66  SRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLK 124
           +R GD I   +P  ++F + +  L  + +  L+ +A +  ++  T+I +   TDS G+  
Sbjct: 121 TRDGDNIVLNMPNEITFGIDQSDLSSRAVAALKNVALVAKEYDKTLINVYGFTDSTGSAS 180

Query: 125 NNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
            N  +SQ RA  + S L++ GV++NR I+ +G     PI +N T+ GR  N+R+EI + P
Sbjct: 181 YNQRLSQVRASEVSSNLMRGGVAANRVIT-KGMGEAKPIASNKTEQGRAENRRVEIVLSP 239


>gi|330447262|ref|ZP_08310912.1| ompA family protein [Photobacterium leiognathi subsp. mandapamensis
           svers.1.1.]
 gi|328491453|dbj|GAA05409.1| ompA family protein [Photobacterium leiognathi subsp. mandapamensis
           svers.1.1.]
          Length = 223

 Score =  127 bits (318), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 53/180 (29%), Positives = 90/180 (50%), Gaps = 2/180 (1%)

Query: 6   GLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVV 65
            +       I     +  ++ K  L  +     +    G  +D  E + + QL  +GI V
Sbjct: 43  IIGALAGAAIGVASSSKHDRGKGALIGAAAGAALGGGIGYYMDVQEAKLRQQLASSGISV 102

Query: 66  SRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLK 124
           +R G+ I   +P  ++F   +  L  + +  L  +A +  ++P T + +   TDS G   
Sbjct: 103 TRDGNNIILNMPNEITFGFDQANLNDRAMNALHNVALVAKEYPKTQLNVLGFTDSKGAAS 162

Query: 125 NNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
            NL +SQ RAD + +YLI++GV++NR IS +G     PI +N T+ GR  N+R+EI + P
Sbjct: 163 YNLRLSQVRADAVGNYLIRQGVNANRVIS-QGRGEANPIASNSTENGRAQNRRVEIILSP 221


>gi|157373855|ref|YP_001472455.1| OmpA/MotB domain-containing protein [Shewanella sediminis HAW-EB3]
 gi|157316229|gb|ABV35327.1| OmpA/MotB domain protein [Shewanella sediminis HAW-EB3]
          Length = 226

 Score =  127 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 50/167 (29%), Positives = 80/167 (47%), Gaps = 2/167 (1%)

Query: 19  GLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPV 78
             +  ++ K  L  +     +    G  +D  E E + QLQ TG+ V+R GD I   +P 
Sbjct: 57  SSSRSDRGKGALIGAASGAALGGGIGYYMDTQEAELRKQLQSTGVSVTRSGDNIVLNMPN 116

Query: 79  HVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVI 137
            V+F V +  L      +L  +A +  ++  T + +  +TDS G    NL +S+ RA  +
Sbjct: 117 EVTFGVDQTDLSSGAKRVLNSVALVAKEYDQTQLNVLGYTDSSGAESYNLRLSKIRAIEV 176

Query: 138 KSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
            +YL+ + +   R  S  G     PI TN T  GR  N+R+EI + P
Sbjct: 177 GNYLVAQKIEYGRVKS-EGLGESRPIATNATAEGRAQNRRVEIVLSP 222


>gi|289209442|ref|YP_003461508.1| OmpA/MotB domain protein [Thioalkalivibrio sp. K90mix]
 gi|288945073|gb|ADC72772.1| OmpA/MotB domain protein [Thioalkalivibrio sp. K90mix]
          Length = 221

 Score =  127 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 53/166 (31%), Positives = 91/166 (54%), Gaps = 2/166 (1%)

Query: 20  LASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVH 79
            + R + +  +  +    +     G+ +D+ E E + QL+ TG+ V+R GD I   +P H
Sbjct: 53  TSRRNRTQRAMIGAGIGALAGGAIGNYMDRQEAELREQLRGTGVSVTRDGDNIILNMPGH 112

Query: 80  VSFV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIK 138
           ++F      ++ +F  +L  +A +L ++  T I +  HTD  G ++ N+ +S+ RA  + 
Sbjct: 113 ITFDIDRTDIKPEFEEVLNSVALVLAEYDQTGIEVAGHTDITGRVEYNMDLSERRAQSVG 172

Query: 139 SYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
             LI+RGV S R  +V GF    PI TN+T  GR  N+R+E+ +FP
Sbjct: 173 RALIRRGVQSVRVDTV-GFGPHQPIATNETAEGRALNRRVELTLFP 217


>gi|127511841|ref|YP_001093038.1| OmpA/MotB domain-containing protein [Shewanella loihica PV-4]
 gi|126637136|gb|ABO22779.1| OmpA/MotB domain protein [Shewanella loihica PV-4]
          Length = 224

 Score =  127 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 52/167 (31%), Positives = 83/167 (49%), Gaps = 2/167 (1%)

Query: 19  GLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPV 78
             +  ++ K  L  +     V    G  +D  E E + QLQ TG+ V+R GD I   +P 
Sbjct: 55  SSSKSDRGKGALIGAASGAAVGGGIGYYMDVQEAELRKQLQSTGVSVTRNGDNIILNMPN 114

Query: 79  HVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVI 137
            V+F V +  L  +   +L  +A +  ++  T++ +   TDS G+   NL +SQ RA  +
Sbjct: 115 EVTFGVDQSVLSSRAKNVLDSVALVAKEYDETMLNVMGFTDSSGSESYNLRLSQVRAAEV 174

Query: 138 KSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
            +YL+ R    ++ IS  G     PI  N T+ GR  N+R+EI + P
Sbjct: 175 ANYLMSRE-IKSQRISSVGMGESRPIADNSTQQGRAQNRRVEIVLSP 220


>gi|91226490|ref|ZP_01261239.1| putative lipoprotein [Vibrio alginolyticus 12G01]
 gi|91189122|gb|EAS75403.1| putative lipoprotein [Vibrio alginolyticus 12G01]
          Length = 219

 Score =  127 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 50/216 (23%), Positives = 94/216 (43%), Gaps = 39/216 (18%)

Query: 7   LSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFG---------------------- 44
           +++ ++  ++GC    R+      +++N T                              
Sbjct: 3   IALALVLALTGCQATQRQNATTGEYETNSTTQGALIGAIAGAAIGLATGDDAKERRQHAL 62

Query: 45  --------------SSLDKAEDEFQMQLQDTGIVVSRIG-DMITCYIPVHVSFVSEVF-L 88
                            D+ E E +  L ++G+ V R+G + +   +   + F S  + L
Sbjct: 63  IGAAAGGATGAGVGYYFDQQEAELRRALLNSGVQVQRVGENQLLLRMENGIGFSSSSYQL 122

Query: 89  EKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSS 148
           +      L+ +A IL ++P T + I  +TDS G+   N  +S+ RA+ ++ +L+ + V+ 
Sbjct: 123 DASIHNTLRGVARILVEYPDTSLVIDGYTDSTGSESYNQTLSERRAESVRQFLVSQNVAP 182

Query: 149 NRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
            R I  RG+  + PI +N T  GR  N+R+EIQI P
Sbjct: 183 GRAI-ARGYGERNPICSNQTSEGRACNRRVEIQILP 217


>gi|254473994|ref|ZP_05087387.1| OmpA family protein [Pseudovibrio sp. JE062]
 gi|211956883|gb|EEA92090.1| OmpA family protein [Pseudovibrio sp. JE062]
          Length = 220

 Score =  127 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 49/219 (22%), Positives = 97/219 (44%), Gaps = 37/219 (16%)

Query: 2   IKELG---LSMFIMTTISGCGLA--------------------------------SREKK 26
           +K+L    +++ +  +++ C                                      + 
Sbjct: 1   MKKLMHAAIAIVLGLSVAACTTTNPYTGESRISKTAGGAGLGAATGAIIGAIAGGKSARV 60

Query: 27  KVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV-SE 85
           +  L  +    ++    G+ +D+ E + + QLQ +G+ V+R G+ I   +P  V+F   +
Sbjct: 61  EGALVGAAAGGLIGGGIGNYMDRQEAQLRQQLQSSGVSVTRNGNQIVLNMPNDVTFAVGQ 120

Query: 86  VFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRG 145
             L  + + +L  +A +  +FP T + +  HTD+ G+ + NL +SQ RAD + +  +   
Sbjct: 121 ATLSSRAMQVLNSVALVAKEFPQTRLNVYGHTDNTGSAQFNLQLSQRRADSVSN-YLFNQ 179

Query: 146 VSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
             +   IS  G+    PI +N T+ GR  N+R+EI + P
Sbjct: 180 GVNGARISAAGYGLTSPIASNATEAGRAQNRRVEIILSP 218


>gi|261210647|ref|ZP_05924939.1| outer membrane protein [Vibrio sp. RC341]
 gi|260840132|gb|EEX66712.1| outer membrane protein [Vibrio sp. RC341]
          Length = 223

 Score =  127 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 56/222 (25%), Positives = 101/222 (45%), Gaps = 39/222 (17%)

Query: 1   MIKELGLSMFIMTTISGCGLASREKKKVFLHKSNDTD----------------------- 37
           M+ +  L +  +  +SGC    R+       ++N                          
Sbjct: 1   MLNKTTLLLAAVMALSGCQATQRQNATTGETETNSATKGALLGALAGAAVGLATGDDAKE 60

Query: 38  -------------IVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIG-DMITCYIPVHVSFV 83
                         V    G   D+ E E +  L D+G+ V R+G + +   +   + F 
Sbjct: 61  RRKHALIGAAGGAAVGGGIGYYFDQQEAELRKALLDSGVQVVRVGENQLLLRMENGIGFT 120

Query: 84  SEVF-LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLI 142
           S  + L+      L+ +A IL ++P T + I+ HTDS G+   N ++S++RA+ ++++L+
Sbjct: 121 SSSYQLDSYIHKTLRGVARILVEYPDTSLVIEGHTDSTGSDTTNQVLSEKRAESVRAFLL 180

Query: 143 QRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
            +GV++ R I  RG   ++P+ +N T  GR  N+R+EIQI P
Sbjct: 181 AQGVAAGRAI-ARGNGERFPLCSNSTAEGRACNRRVEIQILP 221


>gi|323189288|gb|EFZ74571.1| inner membrane lipoprotein yiaD [Escherichia coli RN587/1]
          Length = 219

 Score =  127 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 55/219 (25%), Positives = 95/219 (43%), Gaps = 36/219 (16%)

Query: 1   MIKELGLSMFI---MTTISGCGLASREKKKVF---LHKSNDTDIVNKRFGS--------- 45
           M K + L   +      +SGC       ++        +    +V    G+         
Sbjct: 1   MKKRVYLIAAVVSGALAVSGCTTNPYTGEREAGKSAIGAGLGSLVGAGIGALSSSKKDRG 60

Query: 46  -------------------SLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEV 86
                               +D  E + + +++ TG+ V+R GD I   +P +V+F S  
Sbjct: 61  KGALIGAAAGAALGGGVGYYMDVQEAKLRDKMRGTGVSVTRSGDNIILNMPNNVTFDSSS 120

Query: 87  -FLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRG 145
             L+      L  +A +L ++P T + +  +TDS G    N+ +SQ+RAD + S LI +G
Sbjct: 121 ATLKLAGANTLTGVAMVLKEYPKTAVNVIGYTDSTGGHDLNMRLSQQRADSVASALITQG 180

Query: 146 VSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           V ++R I  +G     PI +N T  G+  N+R+EI + P
Sbjct: 181 VDASR-IRTQGLGPANPIASNSTSEGKAQNRRVEITLSP 218


>gi|308188742|ref|YP_003932873.1| OOP family outer membrane lipoprotein yiaD precursor [Pantoea
           vagans C9-1]
 gi|308059252|gb|ADO11424.1| Putative OOP family outer membrane lipoprotein yiaD precursor
           [Pantoea vagans C9-1]
          Length = 220

 Score =  127 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 46/180 (25%), Positives = 92/180 (51%), Gaps = 2/180 (1%)

Query: 6   GLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVV 65
           GL   +   +     + ++++K  L  +     +    G  +D  E + + +++ TG+ V
Sbjct: 40  GLGALVGAGVGVLSSSKKDRRKGALIGAAGGAALGGGVGYYMDVQEAKLRDKMRGTGVSV 99

Query: 66  SRIGDMITCYIPVHVSFVSEV-FLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLK 124
           +R GD I   +P +V+F S    L+      L  ++ +L ++P T + +  +TDS G+  
Sbjct: 100 TRNGDNIVLNMPNNVTFDSSSSNLKPAGANTLTGVSMVLKEYPKTAVNVVGYTDSTGSRA 159

Query: 125 NNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
            N+ +SQ+RA+ + S LI +   ++  +  +G     P+ TN T+ G+  N+R+EI + P
Sbjct: 160 LNMRLSQQRAESVASALIVQ-GVASDRLRTQGAGPDNPVATNSTEAGKAQNRRVEITLSP 218


>gi|150398661|ref|YP_001329128.1| OmpA/MotB domain-containing protein [Sinorhizobium medicae WSM419]
 gi|150030176|gb|ABR62293.1| OmpA/MotB domain protein [Sinorhizobium medicae WSM419]
          Length = 221

 Score =  127 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 55/218 (25%), Positives = 94/218 (43%), Gaps = 35/218 (16%)

Query: 1   MIKELGLSMFIMTTISGCGLASREKKKVFLHKSN-----------------DTDIVNKRF 43
           MIK+  +       +SGC        +  +  +                        +R 
Sbjct: 1   MIKKCAILAVAAIYLSGCTTTDPYTGEQKMSNTAGGALIGAGLGAATGLLVGGSAAGRRD 60

Query: 44  G----------------SSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSE-V 86
                            + +D+ E E + QLQ TG+ V+R GD I   +P +++F ++  
Sbjct: 61  AALVGAGIGALGGGLVGNYMDQQESELRAQLQGTGVSVTRAGDRIILNMPSNITFATDRD 120

Query: 87  FLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGV 146
            +   F   L  +A +L KF  T+I +  HTDS G+   N  +S+ RA  + +YL  R  
Sbjct: 121 QVIPAFYSTLDSVAIVLRKFSKTLIDVDGHTDSTGSASYNQGLSERRAASVANYLASR-G 179

Query: 147 SSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
              R +S  G+  + P+ +N +++GR  N+R+EI I P
Sbjct: 180 VDQRRMSAVGYGMERPVASNASEIGRVQNRRVEISIAP 217


>gi|304398041|ref|ZP_07379916.1| OmpA/MotB domain protein [Pantoea sp. aB]
 gi|304354327|gb|EFM18699.1| OmpA/MotB domain protein [Pantoea sp. aB]
          Length = 219

 Score =  127 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 46/180 (25%), Positives = 92/180 (51%), Gaps = 2/180 (1%)

Query: 6   GLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVV 65
           GL   +   +     + ++++K  L  +     +    G  +D  E + + +++ TG+ V
Sbjct: 40  GLGALVGAGVGVLSSSKKDRRKGALIGAAGGAALGGGVGYYMDVQEAKLRDKMRGTGVSV 99

Query: 66  SRIGDMITCYIPVHVSFVS-EVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLK 124
           +R GD I   +P +V+F S    L+      L  ++ +L ++P T + +  +TDS G+  
Sbjct: 100 TRNGDNIVLNMPNNVTFDSNSSNLKPAGANTLTGVSMVLKEYPKTAVNVVGYTDSTGSRA 159

Query: 125 NNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
            N+ +SQ+RA+ + S LI +   ++  +  +G     P+ TN T+ G+  N+R+EI + P
Sbjct: 160 LNMRLSQQRAESVASALIVQ-GVASDRLRTQGAGPDNPVATNSTEAGKAQNRRVEITLSP 218


>gi|330504865|ref|YP_004381734.1| OmpA/MotB domain-containing protein [Pseudomonas mendocina NK-01]
 gi|328919151|gb|AEB59982.1| OmpA/MotB domain-containing protein [Pseudomonas mendocina NK-01]
          Length = 218

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 45/178 (25%), Positives = 78/178 (43%), Gaps = 2/178 (1%)

Query: 6   GLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVV 65
           G+       I     + +++ K  L  +         +G  +D  E + +  LQ TG+ V
Sbjct: 39  GIGAATGAVIGAATSSKKDRTKGALIGAAVGGAAGGGYGYYVDTQEAKLRQTLQGTGVQV 98

Query: 66  SRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLK 124
            R GD +   +P +++F  +   +   F P L  +  +  +F    + I  HTDS G+ +
Sbjct: 99  QRNGDDLKLIMPGNITFASNSADISSSFYPTLNSLVLVFKEFNKNGVNIVGHTDSTGSQE 158

Query: 125 NNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
            N  +SQ RA  + +  +       + IS  G     PI +N T  GR  N+R+EI +
Sbjct: 159 LNQSLSQRRAQSVAN-YLTANGVPGQRISAYGAGPSQPIASNATDAGRAQNRRVEINL 215


>gi|153215326|ref|ZP_01949939.1| lipoprotein, putative [Vibrio cholerae 1587]
 gi|153826671|ref|ZP_01979338.1| lipoprotein, putative [Vibrio cholerae MZO-2]
 gi|153829618|ref|ZP_01982285.1| putative lipoprotein [Vibrio cholerae 623-39]
 gi|183179599|ref|ZP_02957810.1| lipoprotein, putative [Vibrio cholerae MZO-3]
 gi|229515575|ref|ZP_04405034.1| outer membrane protein [Vibrio cholerae TMA 21]
 gi|229520377|ref|ZP_04409802.1| outer membrane protein [Vibrio cholerae TM 11079-80]
 gi|229525804|ref|ZP_04415209.1| outer membrane protein [Vibrio cholerae bv. albensis VL426]
 gi|229529718|ref|ZP_04419108.1| outer membrane protein [Vibrio cholerae 12129(1)]
 gi|254226715|ref|ZP_04920292.1| lipoprotein, putative [Vibrio cholerae V51]
 gi|262191649|ref|ZP_06049827.1| outer membrane protein [Vibrio cholerae CT 5369-93]
 gi|297578794|ref|ZP_06940722.1| conserved hypothetical protein [Vibrio cholerae RC385]
 gi|124114769|gb|EAY33589.1| lipoprotein, putative [Vibrio cholerae 1587]
 gi|125620776|gb|EAZ49133.1| lipoprotein, putative [Vibrio cholerae V51]
 gi|148874894|gb|EDL73029.1| putative lipoprotein [Vibrio cholerae 623-39]
 gi|149739533|gb|EDM53761.1| lipoprotein, putative [Vibrio cholerae MZO-2]
 gi|183013010|gb|EDT88310.1| lipoprotein, putative [Vibrio cholerae MZO-3]
 gi|229333492|gb|EEN98978.1| outer membrane protein [Vibrio cholerae 12129(1)]
 gi|229339385|gb|EEO04402.1| outer membrane protein [Vibrio cholerae bv. albensis VL426]
 gi|229342475|gb|EEO07468.1| outer membrane protein [Vibrio cholerae TM 11079-80]
 gi|229347344|gb|EEO12304.1| outer membrane protein [Vibrio cholerae TMA 21]
 gi|262032491|gb|EEY51051.1| outer membrane protein [Vibrio cholerae CT 5369-93]
 gi|297536388|gb|EFH75221.1| conserved hypothetical protein [Vibrio cholerae RC385]
 gi|327483893|gb|AEA78300.1| Outer membrane protein [Vibrio cholerae LMA3894-4]
          Length = 223

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 58/222 (26%), Positives = 103/222 (46%), Gaps = 39/222 (17%)

Query: 1   MIKELGLSMFIMTTISGCGLASREKKKVFLHKSNDTD----------------------- 37
           M+ +  L +  +  +SGC    R+       ++N T                        
Sbjct: 1   MLNKTTLLLAAVVALSGCQATQRQNATTGETETNATTKGALLGALAGAAVGLATGDDAKE 60

Query: 38  -------------IVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIG-DMITCYIPVHVSFV 83
                         V    G   D+ E E +  L D+G+ V R+G + +   +   + F 
Sbjct: 61  RRKHALIGAAGGAAVGGGIGYYFDQQEAELRKALLDSGVQVVRVGENQLMLRMENGIGFT 120

Query: 84  SEVF-LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLI 142
           S  + L+      L+ +A IL ++P T + I+ HTDS G+   N ++S++RA+ ++S+L+
Sbjct: 121 SNSYQLDSYIHKTLRGVARILVEYPDTSLVIEGHTDSTGSDTTNQVLSEKRAESVRSFLL 180

Query: 143 QRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
            +GV++ R I  RG   ++P+ +N+T  GR  N+R+EIQI P
Sbjct: 181 SQGVAAGRAI-ARGNGERFPLCSNNTAEGRACNRRVEIQILP 221


>gi|307547058|ref|YP_003899537.1| OmpA/MotB domain protein [Halomonas elongata DSM 2581]
 gi|307219082|emb|CBV44352.1| OmpA/MotB domain protein [Halomonas elongata DSM 2581]
          Length = 223

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 44/167 (26%), Positives = 78/167 (46%), Gaps = 2/167 (1%)

Query: 19  GLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPV 78
           G  S  ++   L  +          G+ +D+ E + +  +Q TGI V R G+ I   +P 
Sbjct: 54  GDGSTSRRDRALIGAAAGAAAGGGIGAYMDRQEQQLRSSMQGTGIGVERQGNDIVLNMPS 113

Query: 79  HVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVI 137
            V+F      L       L  ++ +L ++  T I I  HTDS G    N  +S+ RA  +
Sbjct: 114 EVTFGFDSSDLTPAATSALNDVSNVLTQYTDTRINIAGHTDSTGDAGYNQRLSERRAQAV 173

Query: 138 KSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
               + +   S   ++++G+    P+ +NDT+ GR  N+R+E+ + P
Sbjct: 174 GQ-YLSQSGVSAGRLNMQGYGENQPVASNDTEAGRAQNRRVEMTLTP 219


>gi|157368311|ref|YP_001476300.1| putative outer membrane lipoprotein [Serratia proteamaculans 568]
 gi|157320075|gb|ABV39172.1| OmpA/MotB domain protein [Serratia proteamaculans 568]
          Length = 220

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 53/219 (24%), Positives = 95/219 (43%), Gaps = 36/219 (16%)

Query: 1   MIKELGL---SMFIMTTISGC-------------------------------GLASREKK 26
           M K + +   ++ I  T+S C                                 + +++ 
Sbjct: 1   MNKRIAIIAGAVSIALTLSACTTNPYTGESEAGKSGIGAGIGAALGAGVGMLSSSKKDRG 60

Query: 27  KVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEV 86
           K  L  +     +    G  +D  E + + +++ TG+ V+R GD I   +P +V+F S  
Sbjct: 61  KGALIGAAAGAALGGGAGYYMDVQEAKLRDKMKGTGVSVTRQGDNIVLNMPNNVTFDSSS 120

Query: 87  -FLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRG 145
             L+      L  +A +L ++P T + I  +TDS G+   N+ +SQ+RAD + S LI + 
Sbjct: 121 ATLKPAGANTLTGVAMVLKEYPKTAVNIIGYTDSTGSRALNMTLSQQRADGVGSALITQ- 179

Query: 146 VSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
             +   +   G     PI +N T  G+  N+R+EI + P
Sbjct: 180 GVAANRVRTSGAGPDNPIASNSTTEGKAQNRRVEITLSP 218


>gi|123444325|ref|YP_001008290.1| putative outer membrane lipoprotein [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|122091286|emb|CAL14172.1| putative lipoprotein [Yersinia enterocolitica subsp. enterocolitica
           8081]
          Length = 219

 Score =  126 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 49/219 (22%), Positives = 89/219 (40%), Gaps = 36/219 (16%)

Query: 1   MIKELGLSMFI---MTTISGC-------------------------------GLASREKK 26
           M K +  ++       T+S C                                 +  ++ 
Sbjct: 1   MKKRILATVAAVSVALTLSACTTNPYTGESQAGKSGYGAGIGAALGAGIGMLSSSKHDRG 60

Query: 27  KVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV-SE 85
           K  L  +     +    G  +D  E + + ++  TG+ V+R GD I   +P +V+F    
Sbjct: 61  KGALIGAAAGAALGGGAGYYMDVQEAKLREKMSGTGVSVTRQGDNIVLNMPNNVTFDTDS 120

Query: 86  VFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRG 145
             L+      L  +A +L ++  T + +  +TDS G   +N+ +SQ+RAD + S LI + 
Sbjct: 121 SNLKPAGANTLTGVAMVLKEYDKTAVNVTGYTDSTGARAHNMTLSQQRADSVGSALIVQ- 179

Query: 146 VSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
             +   I   G     P+ +N T  G+  N+R+EI + P
Sbjct: 180 GVAANRIRTSGAGPDNPVASNSTAAGKAQNRRVEITLSP 218


>gi|254292013|ref|ZP_04962792.1| lipoprotein, putative [Vibrio cholerae AM-19226]
 gi|150422090|gb|EDN14058.1| lipoprotein, putative [Vibrio cholerae AM-19226]
          Length = 223

 Score =  126 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 58/222 (26%), Positives = 102/222 (45%), Gaps = 39/222 (17%)

Query: 1   MIKELGLSMFIMTTISGCGLASREKKKVFLHKSNDTD----------------------- 37
           M+ +  L +  +  +SGC    R+       ++N T                        
Sbjct: 1   MLNKTTLLLAAVVALSGCQATQRQNATTGETETNATTKGALLGALAGAAVGLATGDDAKE 60

Query: 38  -------------IVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIG-DMITCYIPVHVSFV 83
                         V    G   D+ E E +  L D+G+ V R+G + +   +   + F 
Sbjct: 61  RRKHALIGAAGGAAVGGGIGYYFDQQEAELRKALMDSGVQVVRVGENQLMLRMENGIGFT 120

Query: 84  SEVF-LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLI 142
           S  + L+      L+ +A IL ++P T + I+ HTDS G+   N ++S++RA+ ++S+L+
Sbjct: 121 SNSYQLDSYIHKTLRGVARILVEYPDTSLVIEGHTDSTGSDSTNQVLSEKRAESVRSFLL 180

Query: 143 QRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
            +GV+  R I  RG   ++P+ +N+T  GR  N+R+EIQI P
Sbjct: 181 SQGVAEGRAI-ARGNGERFPLCSNNTAEGRACNRRVEIQILP 221


>gi|329297799|ref|ZP_08255135.1| putative outer membrane lipoprotein [Plautia stali symbiont]
          Length = 177

 Score =  126 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 44/167 (26%), Positives = 84/167 (50%), Gaps = 2/167 (1%)

Query: 19  GLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPV 78
             + +++ K  L  +     +    G  +D  E + + +++ TG+ V+R GD I   +P 
Sbjct: 10  SSSKKDRGKGALIGAASGAALGGGVGYYMDVQEAKLRDKMRGTGVSVTRQGDNIVLNMPN 69

Query: 79  HVSFVSEV-FLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVI 137
           +V+F S    L+      L  +A +L ++P   + +   TDS GT   N+ +SQ+RA+ +
Sbjct: 70  NVTFDSSSANLKPAGANTLTGVAMVLKEYPKAAVNVVGFTDSTGTRALNMRLSQQRAESV 129

Query: 138 KSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
            S LI +   +   +  +G     P+ +N T+ G+  N+R+EI + P
Sbjct: 130 ASALIVQ-GVAQNRLRTQGMGPDNPVASNSTEAGKAQNRRVEIPLSP 175


>gi|328473002|gb|EGF43850.1| putative lipoprotein [Vibrio parahaemolyticus 10329]
          Length = 219

 Score =  126 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 50/216 (23%), Positives = 94/216 (43%), Gaps = 39/216 (18%)

Query: 7   LSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFG---------------------- 44
           +++ ++  ++GC    R+      +++N T                              
Sbjct: 3   IALALVLALTGCQATQRQNATTGEYETNSTTQGALIGAIAGAAIGLATGDNAKERRKHAL 62

Query: 45  --------------SSLDKAEDEFQMQLQDTGIVVSRIG-DMITCYIPVHVSFVSEVF-L 88
                            D+ E E +  L ++G+ V R+G + +   +   + F S  + L
Sbjct: 63  IGAAAGGATGAGVGYYFDQQEAELRRALLNSGVQVQRVGENQLLLRMENGIGFSSSSYQL 122

Query: 89  EKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSS 148
           +      L+ +A IL ++P T + I  +TDS G+   N  +S+ RA+ ++ +L+ + V+ 
Sbjct: 123 DASIHNTLRGVARILVEYPDTSLVIDGYTDSTGSESYNQTLSERRAESVRQFLVSQKVAP 182

Query: 149 NRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
            R I  RG+  + PI +N T  GR  N+R+EIQI P
Sbjct: 183 GRAI-ARGYGERNPICSNQTSEGRACNRRVEIQILP 217


>gi|121596298|ref|YP_988194.1| OmpA/MotB domain-containing protein [Acidovorax sp. JS42]
 gi|222112527|ref|YP_002554791.1| ompa/motb domain-containing protein [Acidovorax ebreus TPSY]
 gi|120608378|gb|ABM44118.1| OmpA/MotB domain protein [Acidovorax sp. JS42]
 gi|221731971|gb|ACM34791.1| OmpA/MotB domain protein [Acidovorax ebreus TPSY]
          Length = 216

 Score =  126 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 44/210 (20%), Positives = 85/210 (40%), Gaps = 29/210 (13%)

Query: 1   MIKELGLSMFIMTTIS-GCG-------------------------LASREKKKVFLHKSN 34
           M K L +    +  ++ GC                          +      +  +  + 
Sbjct: 1   MRKPLLIGSLAVVMLATGCANMTDTQRRTATGAGVGALGGAAIGAMTGGHAAQGAVIGAG 60

Query: 35  DTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRI-GDMITCYIPVHVSFVSE-VFLEKKF 92
              +    +   +++ + + Q   Q TG+ V++   + +   IP  +SF +    ++  F
Sbjct: 61  VGALGTYIWSQHMERQKQDMQAATQGTGVTVTQTPDNQLKLDIPSDISFATNRSDIQPNF 120

Query: 93  LPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFI 152
            P+L   A  L   P+T + I  HTDS G+   N  +S +RA+  ++  +     +   I
Sbjct: 121 RPILDRFAEGLRNNPNTEVRIVGHTDSTGSDAINNPLSLDRAESTRN-YLTARGVNGNRI 179

Query: 153 SVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
            V G   + P+ +NDT  GR  N+R+EI +
Sbjct: 180 HVEGRGSREPVASNDTSDGRARNRRVEIYV 209


>gi|238793173|ref|ZP_04636801.1| Inner membrane lipoprotein yiaD [Yersinia intermedia ATCC 29909]
 gi|238727546|gb|EEQ19072.1| Inner membrane lipoprotein yiaD [Yersinia intermedia ATCC 29909]
          Length = 219

 Score =  126 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 49/219 (22%), Positives = 89/219 (40%), Gaps = 36/219 (16%)

Query: 1   MIKELGLSMFI---MTTISGC-------------------------------GLASREKK 26
           M K +  ++       T+S C                                 +  ++ 
Sbjct: 1   MKKRILATVAAVSVALTLSACTTNPYTGESQAGKSGYGAGIGAALGAGIGMLSSSKHDRG 60

Query: 27  KVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV-SE 85
           K  L  +     +    G  +D  E + + ++  TG+ V+R GD I   +P +V+F    
Sbjct: 61  KGALIGAAAGAALGGGAGYYMDVQEAKLREKMSGTGVSVTRQGDNIVLNMPNNVTFDTDS 120

Query: 86  VFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRG 145
             L+      L  +A +L ++  T + +  +TDS G   +N+ +SQ+RAD + S LI + 
Sbjct: 121 SNLKPAGANTLTGVAMVLKEYDKTAVNVTGYTDSSGARAHNMTLSQQRADSVGSALIVQ- 179

Query: 146 VSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
             +   I   G     P+ +N T  G+  N+R+EI + P
Sbjct: 180 GVAANRIRTSGAGPDNPVASNSTAAGKAQNRRVEITLSP 218


>gi|256827978|ref|YP_003156706.1| OmpA/MotB domain-containing protein [Desulfomicrobium baculatum DSM
           4028]
 gi|256577154|gb|ACU88290.1| OmpA/MotB domain protein [Desulfomicrobium baculatum DSM 4028]
          Length = 223

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 56/222 (25%), Positives = 95/222 (42%), Gaps = 34/222 (15%)

Query: 1   MIKELGLSMFIMTTISGCGLASREKKKV------FLHKSNDTDIVNKRFGSS-------- 46
           M K + + +     ISGC    ++ K            +    IV +  G          
Sbjct: 1   MKKLILIVLVAAIAISGCATMDQQSKTTKGATYGAAGGAAAGAIVGQIIGKDTKGTLIGA 60

Query: 47  -----------------LDKAEDEFQMQL-QDTGIVVSRIGDMITCYIPVHVSFV-SEVF 87
                            +D  E + +  L Q   + V R GD++   +   V+F      
Sbjct: 61  AAGAAIGGLAGAGVGRMMDNQEADMRQALSQSEEVAVRREGDLLALTLKGDVTFAVDSDV 120

Query: 88  LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVS 147
           +       ++ IA +L K+P T I ++ HTDS G+   N  +S+ RA  ++  L++RGV+
Sbjct: 121 VLPGLYTEIERIAQVLVKYPQTTIVVEGHTDSTGSDTYNQALSERRAWSVQRLLVERGVN 180

Query: 148 SNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGNIK 189
            +R I+  G+    P+ TNDT  GRQ N+R+EI++ P    +
Sbjct: 181 PSR-ITAMGYGESRPVATNDTPEGRQMNRRVEIRVNPNTTQQ 221


>gi|313205587|ref|YP_004044764.1| ompa/motb domain protein [Riemerella anatipestifer DSM 15868]
 gi|312444903|gb|ADQ81258.1| OmpA/MotB domain protein [Riemerella anatipestifer DSM 15868]
 gi|315022683|gb|EFT35708.1| OmpA/MotB domain protein [Riemerella anatipestifer RA-YM]
 gi|325334983|gb|ADZ11257.1| Outer membrane protein related peptidoglycan-associated
           (lipo)protein [Riemerella anatipestifer RA-GD]
          Length = 230

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 47/163 (28%), Positives = 67/163 (41%), Gaps = 1/163 (0%)

Query: 28  VFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVF 87
             +       +     GS +DK   E +  L    +     G  IT              
Sbjct: 63  GAVLGGIIGGVAGNVIGSKMDKQAKEIKEALPGAEVERVNEGIKITLNENTVNFGFDSAN 122

Query: 88  LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVS 147
           L       L  +A +L   P T I +  HTDS G    NL +S+ RA+ + SYL   G++
Sbjct: 123 LTSVAKTNLDKLAQVLKNNPDTNINVYGHTDSRGADDYNLRLSERRANAVVSYLSSLGIA 182

Query: 148 SNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGNIKK 190
           S+R I  +G     PI +NDT  GR  N+R+E  I    N+ K
Sbjct: 183 SSRMI-AKGVGEAEPIASNDTDEGRAKNRRVEFAITANENMIK 224


>gi|288575422|ref|ZP_06393704.1| OmpA family protein [Neisseria mucosa ATCC 25996]
 gi|288568103|gb|EFC89663.1| OmpA family protein [Neisseria mucosa ATCC 25996]
          Length = 190

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 50/182 (27%), Positives = 82/182 (45%), Gaps = 2/182 (1%)

Query: 10  FIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIG 69
                + G   A     +   + +     +    G  +D  E + +  L++T I V R G
Sbjct: 4   LGGAAVCGIVGALTHGGRGARNSALACGAIGAGVGGYMDYQEKKLRENLKNTNIEVERQG 63

Query: 70  DMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLL 128
           + I   +P +V+F      L       L   +  L ++P T + I  HTD+ G    N  
Sbjct: 64  NQIKLVMPENVTFATGSAALSDHARNALATASETLVQYPDTTLTINGHTDNTGNDAINEP 123

Query: 129 ISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGNI 188
           +S+ RA  +  YL  RGV+ +R ++  G+  ++PI +N T  GR  N+R+EI I P  N 
Sbjct: 124 LSRNRALAVADYLQSRGVNGSR-LTTAGYGSRHPIASNATVEGRAQNRRVEILINPDQNA 182

Query: 189 KK 190
            K
Sbjct: 183 IK 184


>gi|126666899|ref|ZP_01737875.1| Outer membrane protein and related peptidoglycan-associated
           (lipo)protein [Marinobacter sp. ELB17]
 gi|126628615|gb|EAZ99236.1| Outer membrane protein and related peptidoglycan-associated
           (lipo)protein [Marinobacter sp. ELB17]
          Length = 232

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 52/217 (23%), Positives = 99/217 (45%), Gaps = 34/217 (15%)

Query: 1   MIKELGLSMFIMTTISGC--------------------------------GLASREKKKV 28
           + K +        T+ GC                                  +  ++ K 
Sbjct: 15  VKKTILAVTLASLTLGGCMTYDPYTGEQKTSNATKGSVIGALGGAAIGAATSSKSDRGKG 74

Query: 29  FLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV-SEVF 87
            L  +    ++    G  +D+ E + + QL+ TG+ V R GD I+  +P +++F  ++  
Sbjct: 75  ALIGAAGGAVIGGGIGVYMDRQEVQLRQQLEGTGVRVVRNGDEISLVMPGNITFDLNQTS 134

Query: 88  LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVS 147
           +  +F   L+ +A +L +F  T+I I+ HTDS G    N L+S+ RA  ++ +L+ +   
Sbjct: 135 IRSQFAGTLESVALVLKEFDQTIIQIEGHTDSQGGDSYNQLLSERRASSVRDFLLNQ-GI 193

Query: 148 SNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
            +R     G+  +YP+ +NDT  GR+ N+R+E+ + P
Sbjct: 194 ESRRTRAVGYGERYPVASNDTSGGREQNRRVELTLVP 230


>gi|126175870|ref|YP_001052019.1| OmpA/MotB domain-containing protein [Shewanella baltica OS155]
 gi|152999218|ref|YP_001364899.1| OmpA/MotB domain-containing protein [Shewanella baltica OS185]
 gi|160873831|ref|YP_001553147.1| OmpA/MotB domain-containing protein [Shewanella baltica OS195]
 gi|217971891|ref|YP_002356642.1| OmpA/MotB domain-containing protein [Shewanella baltica OS223]
 gi|304411219|ref|ZP_07392834.1| OmpA/MotB domain protein [Shewanella baltica OS183]
 gi|307306514|ref|ZP_07586257.1| OmpA/MotB domain protein [Shewanella baltica BA175]
 gi|125999075|gb|ABN63150.1| OmpA/MotB domain protein [Shewanella baltica OS155]
 gi|151363836|gb|ABS06836.1| OmpA/MotB domain protein [Shewanella baltica OS185]
 gi|160859353|gb|ABX47887.1| OmpA/MotB domain protein [Shewanella baltica OS195]
 gi|217497026|gb|ACK45219.1| OmpA/MotB domain protein [Shewanella baltica OS223]
 gi|304350412|gb|EFM14815.1| OmpA/MotB domain protein [Shewanella baltica OS183]
 gi|306910805|gb|EFN41233.1| OmpA/MotB domain protein [Shewanella baltica BA175]
 gi|315266058|gb|ADT92911.1| OmpA/MotB domain protein [Shewanella baltica OS678]
          Length = 230

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 53/183 (28%), Positives = 86/183 (46%), Gaps = 2/183 (1%)

Query: 6   GLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVV 65
            +       I     +  ++ K  L  +     V    G  +D  E + + QL  TG+ V
Sbjct: 49  LIGAVAGAAIGVVSSSKSDRGKGALIGAASGAAVGGGIGYYMDVQETKLRQQLASTGVSV 108

Query: 66  SRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLK 124
           +R GD I   +P  V+F V +  L      +L  +A +  ++  T + +  +TDS G+  
Sbjct: 109 TRSGDNIILNMPNEVTFGVDQTELSDGAKRVLNSVAVVAKEYSKTQLNVLGYTDSSGSDS 168

Query: 125 NNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
            NL +SQ RA  + +YL+ +GV+S R  S +G     PI +N    GR  N+R+EI + P
Sbjct: 169 YNLRLSQVRAGEVGNYLMSKGVASARVKS-KGMGEASPIASNANANGRAQNRRVEIVLTP 227

Query: 185 RGN 187
            G 
Sbjct: 228 TGQ 230


>gi|149190355|ref|ZP_01868628.1| outer membrane protein [Vibrio shilonii AK1]
 gi|148835844|gb|EDL52808.1| outer membrane protein [Vibrio shilonii AK1]
          Length = 219

 Score =  125 bits (314), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 51/217 (23%), Positives = 100/217 (46%), Gaps = 36/217 (16%)

Query: 2   IKELGLSMFIMTTISGC-------GLASREKKKVFLHKSNDTDIVNKRFG---------- 44
           +K++ +++ +++ + GC             +       +    I     G          
Sbjct: 3   LKKVVVALGLISLV-GCQATQRQNATTGEYETNSATKGAVIGAIAGTAVGIASGGDSRGI 61

Query: 45  ---------------SSLDKAEDEFQMQLQDTGIVVSRIGDM-ITCYIPVHVSFVSEV-F 87
                             D+ E   + +L ++G+ V R+GD  +   +   + F S    
Sbjct: 62  LIGAASGAALGGGVGYYFDQQEKALRQELLNSGVQVERVGDNQLLLRLENGIGFDSNSHA 121

Query: 88  LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVS 147
           L       L+ +A IL ++P+T + I+ +TDS G+ + N  +S++RA+ ++S+LI + V+
Sbjct: 122 LNSSIHNTLRGVARILVEYPNTSLVIEGYTDSTGSAQYNQELSEKRAEQVRSFLISQNVA 181

Query: 148 SNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           + R +  RG   ++PI +N T  GRQ N+R+EI+I P
Sbjct: 182 AGRAV-ARGNGERFPICSNSTPEGRQCNRRVEIKILP 217


>gi|312884493|ref|ZP_07744197.1| putative lipoprotein [Vibrio caribbenthicus ATCC BAA-2122]
 gi|309367805|gb|EFP95353.1| putative lipoprotein [Vibrio caribbenthicus ATCC BAA-2122]
          Length = 222

 Score =  125 bits (314), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 53/221 (23%), Positives = 97/221 (43%), Gaps = 39/221 (17%)

Query: 2   IKELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFG----------------- 44
           + ++ L++     +SGC    R+       ++N T                         
Sbjct: 1   MNKMTLTLVATLILSGCQATQRQNATTGQDETNSTTQGAIIGAIAGAAIGLATGDNAKER 60

Query: 45  -------------------SSLDKAEDEFQMQLQDTGIVVSRIG-DMITCYIPVHVSFV- 83
                                 D+ E   + +L ++G+ V R G + +   +   + F  
Sbjct: 61  RNQALIGAAGGAAVGGGIGYYFDQQEAALRKELLNSGVQVERTGENQLRLRMENGIGFSS 120

Query: 84  SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQ 143
               L+      L+ +A IL ++P T + I+ +TDS G+ + N ++S++RA+ ++ YL+ 
Sbjct: 121 GSSTLDNSIHKTLRGVARILVEYPETSLVIEGNTDSTGSDRTNQILSEKRAESVRGYLVG 180

Query: 144 RGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           +GV+  R +S RG   + PI TN TK GR  N+R+EI+I P
Sbjct: 181 QGVAPGRAVS-RGLGERQPICTNSTKEGRACNRRVEIKILP 220


>gi|309787755|ref|ZP_07682366.1| inner membrane lipoyiaD domain protein [Shigella dysenteriae 1617]
 gi|308924505|gb|EFP70001.1| inner membrane lipoyiaD domain protein [Shigella dysenteriae 1617]
          Length = 147

 Score =  125 bits (314), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 48/146 (32%), Positives = 80/146 (54%), Gaps = 2/146 (1%)

Query: 40  NKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEV-FLEKKFLPMLQL 98
               G  +D  E + + +++ TG+ V+R GD I   +P +V+F S    L+      L  
Sbjct: 2   GGSVGYYMDVQEAKLRDKMRGTGVSVTRSGDNIILNMPNNVTFDSSSATLKPAGANTLTG 61

Query: 99  IATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFA 158
           +A +L ++P T + +  +TDS G    N+ +SQ+RAD + S LI +GV ++R I  +G  
Sbjct: 62  VAMVLKEYPKTAVNVIGYTDSTGGHDLNMRLSQQRADSVASALITQGVDASR-IRTQGLG 120

Query: 159 YKYPIDTNDTKVGRQNNQRIEIQIFP 184
              PI +N T  G+  N+R+EI + P
Sbjct: 121 PANPIASNSTAEGKAQNRRVEITLSP 146


>gi|322830754|ref|YP_004210781.1| OmpA/MotB domain protein [Rahnella sp. Y9602]
 gi|321165955|gb|ADW71654.1| OmpA/MotB domain protein [Rahnella sp. Y9602]
          Length = 220

 Score =  125 bits (314), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 49/167 (29%), Positives = 86/167 (51%), Gaps = 2/167 (1%)

Query: 19  GLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPV 78
             +  ++ K  L  +     +    G  +D  E + + +++ TG+ V+R GD I   +P 
Sbjct: 53  SSSKHDRGKGALIGAAAGAALGGGAGYYMDVQEAKLRDKMKGTGVSVTRQGDNIVLNMPN 112

Query: 79  HVSFV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVI 137
           +V+F  +   L+      L  +A +L ++P T + +  +TDS GT   N+ +SQ+RAD +
Sbjct: 113 NVTFDTNSSTLKPAGANTLTGVAMVLKEYPKTAVNVIGYTDSTGTRALNMKLSQQRADGV 172

Query: 138 KSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
            S LI +GV  +R  +  G     PI  N T+ G+  N+R+EI + P
Sbjct: 173 GSALITQGVEGSRVHTT-GAGPDNPIAGNSTEAGKAQNRRVEITLSP 218


>gi|262068085|ref|ZP_06027697.1| outer membrane porin F [Fusobacterium periodonticum ATCC 33693]
 gi|291378171|gb|EFE85689.1| outer membrane porin F [Fusobacterium periodonticum ATCC 33693]
          Length = 183

 Score =  125 bits (314), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 49/187 (26%), Positives = 82/187 (43%), Gaps = 5/187 (2%)

Query: 1   MIKELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQD 60
           M K +   + +    + C  + +  K   +   +      +   +S    ED        
Sbjct: 1   MKKRIFAVLILALLATACSGSKKVIKNTGVGVDSANKYAIEDTEASKKPLEDII--VFNQ 58

Query: 61  TGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDS 119
            G+ + R G+ +   +P  + F   +  +++   P L  +A  L +     I I  +TD 
Sbjct: 59  EGVTIRREGNNLILSMPELILFDFDKYAVKEGIKPSLATLAKALGENKDIHIKIDGYTDF 118

Query: 120 IGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIE 179
           IGT   NL +S +RA  IK +LI +G   +  IS+ G+  + P DTN T  GR  N+R+E
Sbjct: 119 IGTEAYNLDLSVKRARAIKDFLISKGAIGSN-ISIEGYGEQNPADTNQTAAGRSRNRRVE 177

Query: 180 IQIFPRG 186
             I  RG
Sbjct: 178 F-IISRG 183


>gi|163801079|ref|ZP_02194979.1| putative lipoprotein [Vibrio sp. AND4]
 gi|159175428|gb|EDP60225.1| putative lipoprotein [Vibrio sp. AND4]
          Length = 219

 Score =  125 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 51/216 (23%), Positives = 95/216 (43%), Gaps = 39/216 (18%)

Query: 7   LSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFG---------------------- 44
           +++ ++  ++GC    R+      +++N T                              
Sbjct: 3   IALALVLALTGCQATQRQNATTGEYETNSTTQGALIGAIAGAAIGLAVGDNAKERRKGAL 62

Query: 45  --------------SSLDKAEDEFQMQLQDTGIVVSRIG-DMITCYIPVHVSFVSEVF-L 88
                            D+ E E +  L ++G+ V R+G + +   +   + F S  + L
Sbjct: 63  IGAAAGGATGAGVGYYFDQQEAELRRALLNSGVQVERVGENQLLLRMENGIGFTSSSYQL 122

Query: 89  EKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSS 148
           +      L+ +A IL ++P T + I  +TDS G+   N  +S+ RA+ ++ YL+ + V++
Sbjct: 123 DSSIHNTLRGVARILVEYPDTSLVIDGYTDSTGSDSYNQTLSERRAESVRQYLVSQNVAA 182

Query: 149 NRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
            R I  RG+  + PI +N T  GR  N+R+EIQI P
Sbjct: 183 GRAI-ARGYGERNPICSNQTSDGRACNRRVEIQILP 217


>gi|262402450|ref|ZP_06079011.1| outer membrane protein [Vibrio sp. RC586]
 gi|262351232|gb|EEZ00365.1| outer membrane protein [Vibrio sp. RC586]
          Length = 223

 Score =  125 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 56/222 (25%), Positives = 101/222 (45%), Gaps = 39/222 (17%)

Query: 1   MIKELGLSMFIMTTISGCGLASREKKKVFLHKSNDTD----------------------- 37
           M+ +  L +  +  +SGC    R+       ++N                          
Sbjct: 1   MLNKATLLLAAVVALSGCQATQRQNATTGETETNSATKGALLGAIAGAAVGLATGDDAKE 60

Query: 38  -------------IVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIG-DMITCYIPVHVSFV 83
                         V    G   D+ E E +  L D+G+ V R+G + +   +   + F 
Sbjct: 61  RRKHALIGAAGGAAVGGGIGYYFDQQEAELRKALLDSGVQVVRVGENQLMLRMENGIGFT 120

Query: 84  SEVF-LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLI 142
           S  + L+      L+ +A IL ++P T + I+ HTDS G+   N ++S++RA+ ++++L+
Sbjct: 121 SSSYQLDSYIHKTLRGVARILVEYPDTSLVIEGHTDSTGSDTTNQVLSEKRAESVRAFLL 180

Query: 143 QRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
            +GV++ R I  RG   ++P+ +N T  GR  N+R+EIQI P
Sbjct: 181 SQGVAAGRAI-ARGNGERFPLCSNSTAEGRACNRRVEIQILP 221


>gi|146308664|ref|YP_001189129.1| OmpA/MotB domain-containing protein [Pseudomonas mendocina ymp]
 gi|145576865|gb|ABP86397.1| OmpA/MotB domain protein [Pseudomonas mendocina ymp]
          Length = 218

 Score =  125 bits (313), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 45/180 (25%), Positives = 78/180 (43%), Gaps = 2/180 (1%)

Query: 6   GLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVV 65
           G+       I     + +++ K  L  +         +G  +D  E + +  LQ TG+ V
Sbjct: 39  GIGAVTGAAIGAATSSKKDRAKGALIGAAVGGAAGGGYGYYVDTQEAKLRQTLQGTGVQV 98

Query: 66  SRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLK 124
            R GD +   +P +++F  +   +   F P L  +  +  +F    + I  HTDS G+ +
Sbjct: 99  QRNGDDLKLIMPGNITFASNSADISSSFYPTLNSLVLVFKEFNKNGVNIVGHTDSTGSQE 158

Query: 125 NNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
            N  +S  RA  + +  +       + IS  G     PI +N T  GR  N+R+EI + P
Sbjct: 159 LNQSLSSRRAQSVAN-YLTANGVPGQRISAYGAGPSQPIASNATDAGRAQNRRVEINLRP 217


>gi|88810246|ref|ZP_01125503.1| OmpA-OmpF family porin [Nitrococcus mobilis Nb-231]
 gi|88791876|gb|EAR22986.1| OmpA-OmpF family porin [Nitrococcus mobilis Nb-231]
          Length = 230

 Score =  125 bits (313), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 46/161 (28%), Positives = 79/161 (49%), Gaps = 2/161 (1%)

Query: 25  KKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV- 83
           + +  L  +     +    G  +D  E + + ++Q TG+ V+R GD I   +P +V+F  
Sbjct: 70  RGRGALIGAASGAALGGGVGYYMDVQEAKLREKMQGTGVSVTRQGDAIILNMPNNVTFDI 129

Query: 84  SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQ 143
               L+      L  +A +L ++  T + +  HTDS G   +N+ +S++RAD + S LI 
Sbjct: 130 DSSSLKPAGANTLTGVAMVLKEYDQTGVNVVGHTDSTGGHAHNMKLSKKRADSVASSLII 189

Query: 144 RGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           +   +   I   G     PI +N T  GR  N+R+EI + P
Sbjct: 190 Q-GVAANRIRTAGVGPDDPIASNSTAEGRAQNRRVEITLTP 229


>gi|332968653|gb|EGK07706.1| OmpA family protein [Psychrobacter sp. 1501(2011)]
          Length = 217

 Score =  125 bits (313), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 44/171 (25%), Positives = 80/171 (46%), Gaps = 3/171 (1%)

Query: 21  ASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGD-MITCYIPVH 79
           +           +    ++    G+ ++  + + + Q+  TG+ V   G   I   +P +
Sbjct: 48  SKVTGGDKTGRDAAIGAVLGGAVGTYMENQKRQLEQQMAGTGVEVKHDGQGNIDLIMPGN 107

Query: 80  VSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIK 138
           ++F      +   F   L  +A+ +N++  T + +  HTDS+G    N  +SQ RA  + 
Sbjct: 108 ITFAHDSTNINPSFYNTLDKLASTMNQYNQTTVTVMGHTDSVGNPTYNQGLSQRRAQSVA 167

Query: 139 SYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGNIK 189
            YL+ RGVS  R I   G+    PI  N T+ GR  N+R+EI++    N++
Sbjct: 168 GYLVNRGVSGAR-IQTLGYGQSQPIADNSTEQGRMQNRRVEIKLNAPQNLR 217


>gi|307578587|gb|ADN62556.1| OmpA family protein [Xylella fastidiosa subsp. fastidiosa GB514]
          Length = 240

 Score =  125 bits (313), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 50/172 (29%), Positives = 91/172 (52%), Gaps = 4/172 (2%)

Query: 14  TISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMIT 73
            ++G    + ++++  +  +    +     G+  D+ E   + +  +TGI V R GD IT
Sbjct: 60  LLTG--KNATKRRQRAMIAAGIGALGGAAIGNYQDRQERALRERTANTGIDVKRDGDNIT 117

Query: 74  CYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQE 132
             +P  ++F   +  L+ +F   L+ +A+ L ++  T+I +  +TDSIG+   N  +S++
Sbjct: 118 LNLPDGITFDFGKSMLKPQFYGALKNVASTLREYNQTMIEVVGYTDSIGSDVVNQRLSED 177

Query: 133 RADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           RA  + SYL  +GV   R   + G   +YPI  N T+ GR  N+R+EI + P
Sbjct: 178 RAGAVASYLAAQGVQRERM-EISGMGKRYPIADNSTEAGRSKNRRVEIHLIP 228


>gi|238020688|ref|ZP_04601114.1| hypothetical protein GCWU000324_00578 [Kingella oralis ATCC 51147]
 gi|237867668|gb|EEP68674.1| hypothetical protein GCWU000324_00578 [Kingella oralis ATCC 51147]
          Length = 224

 Score =  124 bits (312), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 51/187 (27%), Positives = 77/187 (41%), Gaps = 2/187 (1%)

Query: 2   IKELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDT 61
           I +  L         G   A     K   + +     V    G  +D  E + + QLQ +
Sbjct: 32  ISKTALYGLGGAATCGIVGALTHGGKGARNSALACGAVGAGVGGYMDYQEKKLREQLQGS 91

Query: 62  GIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSI 120
           G+ V R GD I   +P  V+F  +   L  +    L   A  L  +  T I I  HTD+ 
Sbjct: 92  GVAVDRQGDQIKLTMPAAVTFATNSATLSAQAQNSLSQAAQTLATYTDTTITIVGHTDNT 151

Query: 121 GTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEI 180
           G    N  +S  RA  + +  + +   +   +SV G   + P+  N T+ GR  N+R+EI
Sbjct: 152 GNDAINNPLSYNRAQSVAN-YLNQHGVAANRMSVSGQGSRQPVADNSTEAGRAQNRRVEI 210

Query: 181 QIFPRGN 187
            I P  N
Sbjct: 211 LINPDQN 217


>gi|332878199|ref|ZP_08445928.1| OmpA family protein [Capnocytophaga sp. oral taxon 329 str. F0087]
 gi|332683937|gb|EGJ56805.1| OmpA family protein [Capnocytophaga sp. oral taxon 329 str. F0087]
          Length = 229

 Score =  124 bits (312), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 40/222 (18%), Positives = 84/222 (37%), Gaps = 36/222 (16%)

Query: 1   MIKELGLSMFIMTTISGCGLASREKKK------------------------------VFL 30
           M K   L++     +  C   +   K                                 +
Sbjct: 1   MKKIAVLTLSAAILLVSCDAYNNSNKTQRGAVIGAAGGALLGAILGNNIGNGQNSELGAV 60

Query: 31  HKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVH---VSFVSEVF 87
             +          G+ +DK   + + ++   G  V R+ D I      +       ++  
Sbjct: 61  LGTVVGGAAGAVIGNQMDKQAKKIEEEIP--GAEVKRVDDGIVVTFDENSGVYFETAKHN 118

Query: 88  LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVS 147
           + +K    L  +  +L ++P T + +  +TDS+G  + N+ +S+ RA  + +Y    G++
Sbjct: 119 INEKSKETLNKLIAVLKEYPETNVVVAGYTDSVGKDEYNMGLSKRRAQSVTNYFTSNGLA 178

Query: 148 SNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGNIK 189
           ++R  + + F  + P+  N T  GR  N+R+ + I P   +K
Sbjct: 179 ASR-FTTKWFGEQNPVADNGTPEGRAKNRRVNVVIVPNEKMK 219


>gi|15836965|ref|NP_297653.1| hypothetical protein XF0363 [Xylella fastidiosa 9a5c]
 gi|9105193|gb|AAF83173.1|AE003888_6 conserved hypothetical protein [Xylella fastidiosa 9a5c]
          Length = 242

 Score =  124 bits (312), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 50/172 (29%), Positives = 91/172 (52%), Gaps = 4/172 (2%)

Query: 14  TISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMIT 73
            ++G    + ++++  +  +    +     G+  D+ E   + +  +TGI V R GD IT
Sbjct: 62  LLTG--KNATKRRQRAMIAAGIGALGGAAIGNYQDRQERALRERTANTGIDVKRDGDNIT 119

Query: 74  CYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQE 132
             +P  ++F   +  L+ +F   L+ +A+ L ++  T+I +  +TDSIG+   N  +S++
Sbjct: 120 LNLPDGITFDFGKSMLKPQFYGALKNVASTLREYNQTMIEVVGYTDSIGSDVVNQRLSED 179

Query: 133 RADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           RA  + SYL  +GV   R   + G   +YPI  N T+ GR  N+R+EI + P
Sbjct: 180 RAGAVASYLAGQGVQRERM-EISGMGKRYPIADNSTEAGRSKNRRVEIHLIP 230


>gi|71276562|ref|ZP_00652836.1| OmpA/MotB:Rickettsia 17 kDa surface antigen [Xylella fastidiosa
           Dixon]
 gi|71900206|ref|ZP_00682345.1| OmpA/MotB [Xylella fastidiosa Ann-1]
 gi|170730945|ref|YP_001776378.1| OmpA family protein [Xylella fastidiosa M12]
 gi|182682310|ref|YP_001830470.1| OmpA/MotB domain-containing protein [Xylella fastidiosa M23]
 gi|71162633|gb|EAO12361.1| OmpA/MotB:Rickettsia 17 kDa surface antigen [Xylella fastidiosa
           Dixon]
 gi|71730039|gb|EAO32131.1| OmpA/MotB [Xylella fastidiosa Ann-1]
 gi|167965738|gb|ACA12748.1| OmpA family protein [Xylella fastidiosa M12]
 gi|182632420|gb|ACB93196.1| OmpA/MotB domain protein [Xylella fastidiosa M23]
          Length = 241

 Score =  124 bits (312), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 50/172 (29%), Positives = 91/172 (52%), Gaps = 4/172 (2%)

Query: 14  TISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMIT 73
            ++G    + ++++  +  +    +     G+  D+ E   + +  +TGI V R GD IT
Sbjct: 61  LLTG--KNATKRRQRAMIAAGIGALGGAAIGNYQDRQERALRERTANTGIDVKRDGDNIT 118

Query: 74  CYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQE 132
             +P  ++F   +  L+ +F   L+ +A+ L ++  T+I +  +TDSIG+   N  +S++
Sbjct: 119 LNLPDGITFDFGKSMLKPQFYGALKNVASTLREYNQTMIEVVGYTDSIGSDVVNQRLSED 178

Query: 133 RADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           RA  + SYL  +GV   R   + G   +YPI  N T+ GR  N+R+EI + P
Sbjct: 179 RAGAVASYLAAQGVQRERM-EISGMGKRYPIADNSTEAGRSKNRRVEIHLIP 229


>gi|254463375|ref|ZP_05076791.1| OmpA family domain protein [Rhodobacterales bacterium HTCC2083]
 gi|206679964|gb|EDZ44451.1| OmpA family domain protein [Rhodobacteraceae bacterium HTCC2083]
          Length = 222

 Score =  124 bits (311), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 47/214 (21%), Positives = 80/214 (37%), Gaps = 35/214 (16%)

Query: 5   LGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFG-------------------- 44
           L +S   +  ++ C    R        K+     +    G                    
Sbjct: 8   LAISAASLLALTACATPERSANNNDFKKTTTGAAIGAGLGVIAGLISGDDSKERKQNAIK 67

Query: 45  -------------SSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEK 90
                        + LDK   E Q  L +  + ++  GD +   +P  ++F      L  
Sbjct: 68  GALIGGAGGAVVGNVLDKQAAELQKSLGNDRVTITNTGDRLIVSLPQDITFASDSATLSS 127

Query: 91  KFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNR 150
                L  +AT L  +P++ + +  HTDS G    N  +S +RA+ + + L   GVS  R
Sbjct: 128 GIQSDLNAVATNLQSYPNSTVQVIGHTDSTGEAGYNQNLSVQRANSVVNVLAGAGVSFTR 187

Query: 151 FISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
              + G     P+ +N T+ G+  N+R+EI I P
Sbjct: 188 LQGI-GRGEDQPVASNLTEEGKAQNRRVEIVILP 220


>gi|257470361|ref|ZP_05634452.1| Outer membrane porin F [Fusobacterium ulcerans ATCC 49185]
 gi|317064570|ref|ZP_07929055.1| outer membrane porin F [Fusobacterium ulcerans ATCC 49185]
 gi|313690246|gb|EFS27081.1| outer membrane porin F [Fusobacterium ulcerans ATCC 49185]
          Length = 186

 Score =  124 bits (311), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 44/170 (25%), Positives = 76/170 (44%), Gaps = 4/170 (2%)

Query: 14  TISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMIT 73
            ++GC     +  K  + +  +   V +    S    E+       + G+ + R G+ + 
Sbjct: 15  ILTGCSSVDNQPLKELVIEETENQFVMEDIDVSKKTLEEII--VFNEKGVTIRREGNNLV 72

Query: 74  CYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQE 132
             +P  V F  ++  ++ K    L  +A  L + P   I I  +TD IG+   NL +S +
Sbjct: 73  LSMPELVLFDFNKYEVKNKIKGSLNALAKALEENPDIRIKIDGYTDFIGSEGYNLELSVK 132

Query: 133 RADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           RAD IK   +         IS+ G+  + PI +N T+ GR  N+R+E  I
Sbjct: 133 RADAIKD-YLTNKGVKASNISIEGYGKQNPIASNQTETGRAKNRRVEFII 181


>gi|28199574|ref|NP_779888.1| OmpA family protein [Xylella fastidiosa Temecula1]
 gi|28057689|gb|AAO29537.1| OmpA family protein [Xylella fastidiosa Temecula1]
          Length = 242

 Score =  124 bits (311), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 50/172 (29%), Positives = 91/172 (52%), Gaps = 4/172 (2%)

Query: 14  TISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMIT 73
            ++G    + ++++  +  +    +     G+  D+ E   + +  +TGI V R GD IT
Sbjct: 62  LLTG--KNATKRRQRAMIAAGIGALGGAAIGNYQDRQERALRERTANTGIDVKRDGDNIT 119

Query: 74  CYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQE 132
             +P  ++F   +  L+ +F   L+ +A+ L ++  T+I +  +TDSIG+   N  +S++
Sbjct: 120 LNLPDGITFDFGKSMLKPQFYGALKNVASTLREYNQTMIEVVGYTDSIGSDVVNQRLSED 179

Query: 133 RADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           RA  + SYL  +GV   R   + G   +YPI  N T+ GR  N+R+EI + P
Sbjct: 180 RAGAVASYLAAQGVQRERM-EISGMGKRYPIADNSTEAGRSKNRRVEIHLIP 230


>gi|169634041|ref|YP_001707777.1| putative outer membrane protein [Acinetobacter baumannii SDF]
 gi|169152833|emb|CAP01862.1| putative outer membrane protein [Acinetobacter baumannii]
          Length = 217

 Score =  124 bits (311), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 47/185 (25%), Positives = 87/185 (47%), Gaps = 3/185 (1%)

Query: 3   KELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTG 62
           K    ++       G   ++    +     +    ++    G  LD+ E + + Q+  TG
Sbjct: 33  KATLGTLIGAAAGYGISKSNANSSRQNNRAAAIGAVLGAAGGLYLDQKEKKLREQMAGTG 92

Query: 63  IVVSRIGDM-ITCYIPVHVSFVS-EVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSI 120
           + V R  D  +   +P  ++F + +  ++  F   L  +A  L +   + I +  +TD+ 
Sbjct: 93  VEVGRNPDGSVQLIMPGSITFDTNKSNIKPNFYATLDKVAQTLAEDNKSAILVTGYTDNT 152

Query: 121 GTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEI 180
           G    N+ +SQ RA  +K+YL  +GV S+R I  +G+    PI  N T  GR+ N+R+EI
Sbjct: 153 GNDSINIPLSQARAQSVKNYLAGKGVPSSR-IDAQGYGSSNPIADNSTASGREQNRRVEI 211

Query: 181 QIFPR 185
            I+ +
Sbjct: 212 SIYAK 216


>gi|71901865|ref|ZP_00683927.1| OmpA/MotB [Xylella fastidiosa Ann-1]
 gi|71728370|gb|EAO30539.1| OmpA/MotB [Xylella fastidiosa Ann-1]
          Length = 241

 Score =  124 bits (311), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 50/172 (29%), Positives = 91/172 (52%), Gaps = 4/172 (2%)

Query: 14  TISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMIT 73
            ++G    + ++++  +  +    +     G+  D+ E   + +  +TGI V R GD IT
Sbjct: 61  LLTG--KNATKRRQRAMIAAGIGALGGAAIGNYQDRQERALRERTANTGIDVKRDGDNIT 118

Query: 74  CYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQE 132
             +P  ++F   +  L+ +F   L+ +A+ L ++  T+I +  +TDSIG+   N  +S++
Sbjct: 119 LNLPDGITFDFGKSMLKPQFYGALKNVASTLREYNQTMIEVVGYTDSIGSDVVNQRLSED 178

Query: 133 RADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           RA  + SYL  +GV   R   + G   +YPI  N T+ GR  N+R+EI + P
Sbjct: 179 RAGAVASYLAAQGVQRERM-EISGMGKRYPIADNSTEAGRSKNRRVEIHLIP 229


>gi|90581117|ref|ZP_01236916.1| Putative OmpA family protein [Vibrio angustum S14]
 gi|90437638|gb|EAS62830.1| Putative OmpA family protein [Vibrio angustum S14]
          Length = 229

 Score =  124 bits (311), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 52/180 (28%), Positives = 88/180 (48%), Gaps = 2/180 (1%)

Query: 6   GLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVV 65
            +       I     +  ++ K  L  +     +    G  +D  E + + QL  +GI V
Sbjct: 49  IIGALAGAAIGVASSSKHDRGKGALIGAASGAALGGGIGYYMDVQEAKLRKQLSSSGITV 108

Query: 66  SRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLK 124
           +R GD I   +P  ++F   +  L  + +  L  +A +  ++  T + +   TDS G   
Sbjct: 109 TRNGDNIVLNMPNEITFGFDQANLNDRAMNALHNVAIVAKEYEKTQLNVLGFTDSKGAAS 168

Query: 125 NNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
            NL +SQ RAD + +YLI++GV++NR +S +G     PI +N T  GR  N+R+EI + P
Sbjct: 169 YNLRLSQVRADAVANYLIRQGVNANRVVS-QGRGESNPIASNSTANGRAQNRRVEIILSP 227


>gi|325295240|ref|YP_004281754.1| OmpA/MotB domain protein [Desulfurobacterium thermolithotrophum DSM
           11699]
 gi|325065688|gb|ADY73695.1| OmpA/MotB domain protein [Desulfurobacterium thermolithotrophum DSM
           11699]
          Length = 251

 Score =  123 bits (310), Expect = 8e-27,   Method: Composition-based stats.
 Identities = 51/243 (20%), Positives = 89/243 (36%), Gaps = 59/243 (24%)

Query: 1   MIKELGLSMFIMTTISGCGLA------------------------------------SRE 24
           M + L L       + GC                                          
Sbjct: 1   MKRILALFTVSTLFLGGCATTQTQQGQVTTNKTNKTAAGAAIGAVVGGTLGAVTGPRDAN 60

Query: 25  KKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQL---------------------QDTGI 63
           K K  L  +    ++    G  LD+  ++    L                     ++  +
Sbjct: 61  KGKRVLIGAIAGALIGGTIGYILDQQANQISKDLGVKPIDNTNPEAPQVTGAPITENKPV 120

Query: 64  VVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGT 122
            V +  + +   +   V F  +   L+ +    L+ +A  L++ P TVI I   TDS G+
Sbjct: 121 AVVKEPNRVRVVLKDSVLFGFNSYQLKPEAKETLRRLARTLSQNPDTVIVISGFTDSTGS 180

Query: 123 LKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
              N+ +S++RA+ +K+ L+  GV   R + V G   K PI  N+T  GR  N+R+EI +
Sbjct: 181 FDYNVRLSEKRAESVKNELVLNGVDPTRIL-VFGCGPKKPIAPNNTPEGRALNRRVEILV 239

Query: 183 FPR 185
           +P+
Sbjct: 240 YPK 242


>gi|332969616|gb|EGK08634.1| OmpA family protein [Kingella kingae ATCC 23330]
          Length = 258

 Score =  123 bits (310), Expect = 8e-27,   Method: Composition-based stats.
 Identities = 51/214 (23%), Positives = 85/214 (39%), Gaps = 28/214 (13%)

Query: 3   KELGLSMFIMTTISGCGLASREKKK--------------------------VFLHKSNDT 36
           K + ++      +SGC   ++ +++                             + +   
Sbjct: 44  KLIIIATTSALALSGCVTNAQGQQQASKTAVYGVGAAVACGIVGALTHGSTGARNSALAC 103

Query: 37  DIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPM 95
             +    G  +D  E + + QL +TG+ V R G+ I   +P +V+F      L       
Sbjct: 104 GALGAGVGGYMDYQETKLREQLANTGVEVERQGNQIKLTMPENVTFATGRYDLSPAAQSA 163

Query: 96  LQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVR 155
           L   A  L  +  T I I  HTDS G+   N  +S  RA+ + S  + +   +   +SV 
Sbjct: 164 LANAAQTLATYNETTITIVGHTDSTGSDAINNPLSYNRANAVAS-YLNQRGVAANRMSVS 222

Query: 156 GFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGNIK 189
           G   + PI  N T  GR  N+R+EI I P  N +
Sbjct: 223 GQGSRQPIADNSTDYGRAQNRRVEILINPNPNAQ 256


>gi|254510549|ref|ZP_05122616.1| OmpA domain protein [Rhodobacteraceae bacterium KLH11]
 gi|221534260|gb|EEE37248.1| OmpA domain protein [Rhodobacteraceae bacterium KLH11]
          Length = 223

 Score =  123 bits (310), Expect = 8e-27,   Method: Composition-based stats.
 Identities = 44/216 (20%), Positives = 81/216 (37%), Gaps = 34/216 (15%)

Query: 5   LGLSMFIMTTISGCGLASR-----EKKKVFLHKSNDTDIVNKRFG--------------- 44
           L + +     +  C          +  +     +    ++    G               
Sbjct: 8   LTVGLCSALFLGACADPGTLNLPADPNQNAKQGALLGGLIGAGVGAIANDSDPLLGALAG 67

Query: 45  ------------SSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKK 91
                       + LD+   E + QL + GI+++  GD +   +P  ++F      +   
Sbjct: 68  GAIGAAGGGVIGNQLDRQAAELRQQLANDGIIITNAGDRLIVTVPNDITFATDSSTVNPA 127

Query: 92  FLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRF 151
               L  +   L ++P++ + +  HTDS G    N  +S+ RA  +   L   GV+  R 
Sbjct: 128 LRADLVRVGQNLVRYPNSSVQVIGHTDSTGEASYNQGLSERRARSVADILQANGVNGAR- 186

Query: 152 ISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGN 187
           +S  G     P  +N T  GR  N+R++I+I P GN
Sbjct: 187 LSTIGLGENRPAASNLTPEGRARNRRVDIEIIPNGN 222


>gi|119944065|ref|YP_941745.1| OmpA/MotB domain-containing protein [Psychromonas ingrahamii 37]
 gi|119862669|gb|ABM02146.1| OmpA/MotB domain protein [Psychromonas ingrahamii 37]
          Length = 215

 Score =  123 bits (310), Expect = 9e-27,   Method: Composition-based stats.
 Identities = 54/214 (25%), Positives = 93/214 (43%), Gaps = 32/214 (14%)

Query: 1   MIKELGLSMFIMTTISGC-----GLASREKKKVFLHK----------------------- 32
           M K+L  ++ ++T +SGC          ++                              
Sbjct: 1   MNKKLVTALMVVTLLSGCVNRQNATTGEQEMNTATKSAIGGAIAGALAGAATGKKNGALF 60

Query: 33  -SNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDM--ITCYIPVHVSFVSEVFLE 89
            +     +    G   D+ E   + +L ++G+ V R+G+                   L 
Sbjct: 61  GAVGGAAIGGGVGYYFDQQEAALRQELLNSGVQVKRVGEYELQLIMADGIGFDTGNYQLS 120

Query: 90  KKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSN 149
                 L  +A +LN++P + + I  HTDS+G+ ++NL +S+ RA+ + +YL+QR V S 
Sbjct: 121 GSIFSTLNGVAKVLNEYPKSSLRIIGHTDSVGSSESNLTLSERRAESVSNYLMQRNVKSG 180

Query: 150 RFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
           R +S  G+  + PI TNDT  GR  N+R+EI I 
Sbjct: 181 R-LSTLGYGERRPIATNDTPYGRAANRRVEINII 213


>gi|258626412|ref|ZP_05721259.1| putative lipoprotein [Vibrio mimicus VM603]
 gi|258581464|gb|EEW06366.1| putative lipoprotein [Vibrio mimicus VM603]
          Length = 223

 Score =  123 bits (309), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 57/222 (25%), Positives = 102/222 (45%), Gaps = 39/222 (17%)

Query: 1   MIKELGLSMFIMTTISGCGLASREKKKVFLHKSNDTD----------------------- 37
           M+ +  L +  +  +SGC    R+       ++N T                        
Sbjct: 1   MLNKATLLLAAVVALSGCQATQRQNATTGEMETNSTTKGALLGALAGAAVGLATGDDAKE 60

Query: 38  -------------IVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIG-DMITCYIPVHVSFV 83
                         V    G   D+ E E +  L D+G+ V R+G + +   +   + F 
Sbjct: 61  RRKHALIGAAGGAAVGGGIGYYFDQQEAELRKALLDSGVQVVRVGENQLMLRMENGIGFT 120

Query: 84  SEVF-LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLI 142
           S  + L+      L+ +A IL  +P T + I+ HTDS G+   N ++S++RA+ ++++L+
Sbjct: 121 SSSYQLDSYIHKTLRGVARILVAYPDTSLVIEGHTDSTGSDTTNQVLSEKRAESVRAFLL 180

Query: 143 QRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
            +GV++ R I  RG   ++P+ +N+T  GR  N+R+EIQI P
Sbjct: 181 SQGVAAGRAI-ARGNGERFPLCSNNTAEGRACNRRVEIQILP 221


>gi|89074695|ref|ZP_01161153.1| Putative OmpA family protein [Photobacterium sp. SKA34]
 gi|89049459|gb|EAR55020.1| Putative OmpA family protein [Photobacterium sp. SKA34]
          Length = 229

 Score =  123 bits (309), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 52/180 (28%), Positives = 88/180 (48%), Gaps = 2/180 (1%)

Query: 6   GLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVV 65
            +       I     +  ++ K  L  +     +    G  +D  E + + QL  +GI V
Sbjct: 49  IIGALAGAAIGVASSSKHDRGKGALIGAASGAALGGGIGYYMDVQEAKLRKQLSSSGITV 108

Query: 66  SRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLK 124
           +R GD I   +P  ++F   +  L  + +  L  +A +  ++  T + +   TDS G   
Sbjct: 109 TRNGDNIVLNMPNEITFGFDQANLNDRAMNALHNVAIVAKEYEKTQLNVLGFTDSKGAES 168

Query: 125 NNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
            NL +SQ RAD + +YLI++GV++NR +S +G     PI +N T  GR  N+R+EI + P
Sbjct: 169 YNLRLSQVRADAVANYLIRQGVNANRVVS-QGRGESNPIASNSTSNGRAQNRRVEIILSP 227


>gi|50084108|ref|YP_045618.1| putative outer membrane protein [Acinetobacter sp. ADP1]
 gi|49530084|emb|CAG67796.1| putative outer membrane protein [Acinetobacter sp. ADP1]
          Length = 217

 Score =  123 bits (309), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 43/180 (23%), Positives = 84/180 (46%), Gaps = 3/180 (1%)

Query: 8   SMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSR 67
           ++       G   +S    +     +    I+    G  LD+ E + + Q+  TG+ V+R
Sbjct: 38  TLIGAAAGYGISKSSANSSRQNNRAAAIGAILGGASGLYLDQKEKKLRQQMAGTGVEVNR 97

Query: 68  IGDM-ITCYIPVHVSFV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKN 125
             D  +   +P +++F  ++  ++  F   L  +A  L +   + I +  +TD+ G    
Sbjct: 98  NPDGSVGLVMPGNITFDTNKSNIKPNFYSTLNKVAQTLAEDNKSAILVTGYTDNTGNDSI 157

Query: 126 NLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPR 185
           N+ +SQ RA  + +  +     S+  I+ +G+    PI +N T  GR+ N+R+EI I+ R
Sbjct: 158 NIPLSQARAQSVAN-YLSGQGVSSSRINAQGYGSSNPIASNATAQGREQNRRVEISIYER 216


>gi|258622653|ref|ZP_05717674.1| putative lipoprotein [Vibrio mimicus VM573]
 gi|262171774|ref|ZP_06039452.1| outer membrane protein [Vibrio mimicus MB-451]
 gi|258585109|gb|EEW09837.1| putative lipoprotein [Vibrio mimicus VM573]
 gi|261892850|gb|EEY38836.1| outer membrane protein [Vibrio mimicus MB-451]
          Length = 223

 Score =  123 bits (309), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 57/222 (25%), Positives = 101/222 (45%), Gaps = 39/222 (17%)

Query: 1   MIKELGLSMFIMTTISGCGLASREKKKVFLHKSNDTD----------------------- 37
           M+ +  L +  +  +SGC    R+       ++N T                        
Sbjct: 1   MLNKATLLLAAVVALSGCQATQRQNATTGEMETNSTTKGALLGALAGAAVGLATGDDAKE 60

Query: 38  -------------IVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIG-DMITCYIPVHVSFV 83
                         V    G   D+ E E +  L D+G+ V R+G + +   +   + F 
Sbjct: 61  RRKHALIGAAGGAAVGGGIGYYFDQQEAELRKALLDSGVQVVRVGENQLMLRMENGIGFT 120

Query: 84  SEVF-LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLI 142
           S  + L+      L+ +A IL  +P T + I+ HTDS G+   N ++S++RA+ ++++L+
Sbjct: 121 SSSYQLDSYIHKTLRGVARILVAYPDTSLVIEGHTDSTGSDTTNQVLSEKRAESVRAFLL 180

Query: 143 QRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
            +GV++ R I  RG   ++P+ +N T  GR  N+R+EIQI P
Sbjct: 181 SQGVAAGRAI-ARGNGERFPLCSNSTAEGRACNRRVEIQILP 221


>gi|326336372|ref|ZP_08202543.1| lipoprotein PG3 [Capnocytophaga sp. oral taxon 338 str. F0234]
 gi|325691546|gb|EGD33514.1| lipoprotein PG3 [Capnocytophaga sp. oral taxon 338 str. F0234]
          Length = 231

 Score =  123 bits (309), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 39/223 (17%), Positives = 89/223 (39%), Gaps = 36/223 (16%)

Query: 1   MIKELGLSMFIMTTISGCGL--ASREKKKVFLHKSNDTDIVNKRFGS------------- 45
           + + + L +   + ++GC     S + ++  +  +    I+    G+             
Sbjct: 4   VFRNITLFLVTASLLAGCEAYNNSNKTQRGAVVGAASGAILGAILGNNVGSGGNSELGAV 63

Query: 46  ---------------SLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVH---VSFVSEVF 87
                           +D+   + + ++   G  V R+ D I              ++  
Sbjct: 64  IGTAVGGAAGAIIGNQMDRQAKKIEEEIP--GAEVKRVDDGIVVTFDEKSGVTFEFNKAT 121

Query: 88  LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVS 147
           L  +   +L  + ++L ++P T + +  HTDS G    N+ +S++RA  + ++    G++
Sbjct: 122 LTSEAQTILNKMVSVLKEYPDTNVIVAGHTDSTGKAAYNMTLSEKRAKAVTNFFTTNGLN 181

Query: 148 SNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGNIKK 190
           ++R  + + F    P   N T  GR  N+R+ + I P   +K+
Sbjct: 182 ASR-FTTKWFGATQPAYDNSTAEGRAKNRRVNVVIVPNEKMKE 223


>gi|218783104|ref|YP_002434422.1| OmpA/MotB domain protein [Desulfatibacillum alkenivorans AK-01]
 gi|218764488|gb|ACL06954.1| OmpA/MotB domain protein [Desulfatibacillum alkenivorans AK-01]
          Length = 217

 Score =  123 bits (309), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 48/167 (28%), Positives = 76/167 (45%), Gaps = 5/167 (2%)

Query: 19  GLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPV 78
           G    E  K  L  S     V    G  + K   E   Q+ +T + V    D +   +  
Sbjct: 53  GSTQGEMGKGALIGSVAGAAVGTAVGHKMGKQAQEL-EQIPNTQVEVQ--EDKVVVTMDN 109

Query: 79  HVSFV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVI 137
            + F  +   ++      L+ IA ++ K+P T I ++ HTDS G  + N  +S+ RA+V+
Sbjct: 110 SILFAVNSSTVQPAAQGTLRDIAQVMVKYPDTQIMVKGHTDSTGGEEYNQQLSERRANVV 169

Query: 138 KSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           K+ LI         I+  G     PI +NDT  GR  N+R+EI++ P
Sbjct: 170 KNILIS-YGVPAHRITAIGLGEVMPIASNDTPDGRAMNRRVEIEVRP 215


>gi|311277523|ref|YP_003939754.1| OmpA/MotB domain-containing protein [Enterobacter cloacae SCF1]
 gi|308746718|gb|ADO46470.1| OmpA/MotB domain protein [Enterobacter cloacae SCF1]
          Length = 220

 Score =  123 bits (309), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 54/219 (24%), Positives = 92/219 (42%), Gaps = 36/219 (16%)

Query: 1   MIKELGLSMFI---MTTISGC-------------------------------GLASREKK 26
           M K + +   +      ISGC                                 + +++ 
Sbjct: 1   MKKRVLMIAAMVSGALVISGCTTNPYTGEREAGKSGIGAGLGALAGAGIGALSSSKKDRG 60

Query: 27  KVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEV 86
           K  L  +     V    G  +D  E + + ++Q TG+ V+R GD I   +P +V+F S  
Sbjct: 61  KGALIGAAAGAAVGGGIGYYMDVQEAKLRQKMQGTGVSVTRSGDNIILNMPNNVTFDSSS 120

Query: 87  -FLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRG 145
             L+      L  +A +L ++  T + +  +TDS G+   N+ +SQ+RAD + S LI + 
Sbjct: 121 ANLKPAGANTLTGVAMVLKEYEKTAVNVVGYTDSTGSKDLNMRLSQQRADSVASSLITQ- 179

Query: 146 VSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
             +   I   G     PI +N T  G+  N+R+EI + P
Sbjct: 180 GVAANRIRTTGMGQANPIASNSTAEGKAQNRRVEITLSP 218


>gi|170728573|ref|YP_001762599.1| OmpA/MotB domain-containing protein [Shewanella woodyi ATCC 51908]
 gi|169813920|gb|ACA88504.1| OmpA/MotB domain protein [Shewanella woodyi ATCC 51908]
          Length = 224

 Score =  123 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 52/167 (31%), Positives = 81/167 (48%), Gaps = 2/167 (1%)

Query: 19  GLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPV 78
             +  ++ K  L  +     +    G  +D  E E + QLQ TG+ V+R GD I   +P 
Sbjct: 57  SSSKSDRGKGALIGAASGAALGGGIGYYMDTQEAELRKQLQSTGVSVTRSGDNIILNMPN 116

Query: 79  HVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVI 137
            V+F V E  L      +L  +A +  ++  T + +   TDS G+   NL +S+ RA  +
Sbjct: 117 EVTFGVDETHLSAGAKRVLNSVALVAKEYDKTRLNVLGFTDSSGSESYNLRLSKVRAVEV 176

Query: 138 KSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
             YL+ + V   R  S  G   + PI +N TK GR  N+R+EI + P
Sbjct: 177 ADYLVSQKVEYVRVKS-DGMGEERPIASNATKEGRAENRRVEIILSP 222


>gi|319764890|ref|YP_004128827.1| ompa/motb domain protein [Alicycliphilus denitrificans BC]
 gi|330827094|ref|YP_004390397.1| OmpA/MotB domain-containing protein [Alicycliphilus denitrificans
           K601]
 gi|317119451|gb|ADV01940.1| OmpA/MotB domain protein [Alicycliphilus denitrificans BC]
 gi|329312466|gb|AEB86881.1| OmpA/MotB domain protein [Alicycliphilus denitrificans K601]
          Length = 214

 Score =  123 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 55/208 (26%), Positives = 89/208 (42%), Gaps = 29/208 (13%)

Query: 1   MIKELGL-SMFIMTTISGCGLASREKK-------------------------KVFLHKSN 34
           M K L + ++ ++   +GC   S  ++                            +  + 
Sbjct: 1   MRKPLLIGTVAVVMLATGCADMSETQRRTAIGAGAGALGGAAIGAMTGGRAGTGAVIGAG 60

Query: 35  DTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDM-ITCYIPVHVSFVSE-VFLEKKF 92
              +    +   ++K + E Q   Q TG+ V++  D  +   IP  +SF +    ++  F
Sbjct: 61  VGALGTYIWSQHMEKQKQEMQAATQGTGVTVTQTADNQLKLDIPSDISFATNRSDIQPSF 120

Query: 93  LPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFI 152
            P+L   A  L   P+  + I  HTDS G    N  +S +RA   ++YL  RGVS  R I
Sbjct: 121 RPILDRFAEGLRNNPNAEVRIIGHTDSTGNDAINDPLSLDRATSTRNYLTARGVSGAR-I 179

Query: 153 SVRGFAYKYPIDTNDTKVGRQNNQRIEI 180
            V G   + PI +NDT  GR  N+R+EI
Sbjct: 180 HVDGRGSREPIASNDTAEGRARNRRVEI 207


>gi|117919117|ref|YP_868309.1| OmpA/MotB domain-containing protein [Shewanella sp. ANA-3]
 gi|117611449|gb|ABK46903.1| OmpA/MotB domain protein [Shewanella sp. ANA-3]
          Length = 230

 Score =  123 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 52/167 (31%), Positives = 83/167 (49%), Gaps = 2/167 (1%)

Query: 22  SREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVS 81
             ++ K  L  +     V    G  +D  E + + QL  TG+ V+R GD I   +P  V+
Sbjct: 65  KSDRGKGALIGAASGAAVGGGIGYYMDVQETKLRQQLASTGVSVTRDGDNIVLNMPNEVT 124

Query: 82  F-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSY 140
           F V +  L      +L  +A +  ++  T + +  +TDS G+   NL +SQ RA  + +Y
Sbjct: 125 FGVDQTELSDGAKRVLNSVALVAKEYSKTQLNVLGYTDSSGSDSYNLRLSQVRASEVGNY 184

Query: 141 LIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGN 187
           L+ +GV+S R  S +G     PI +N    GR  N+R+EI + P G 
Sbjct: 185 LMSKGVASARVKS-KGMGEASPIASNANAAGRAQNRRVEIVLTPTGQ 230


>gi|119476926|ref|ZP_01617207.1| ompA family protein [marine gamma proteobacterium HTCC2143]
 gi|119449733|gb|EAW30970.1| ompA family protein [marine gamma proteobacterium HTCC2143]
          Length = 213

 Score =  123 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 50/212 (23%), Positives = 98/212 (46%), Gaps = 29/212 (13%)

Query: 2   IKELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVN--------------------- 40
           +K++ +S+  +  ++ C       ++   + +                            
Sbjct: 4   LKKI-ISISTLAILTACTTNPYTSERKASNTALYGAGAAIICGIIGSRESSKHARNAAAG 62

Query: 41  -----KRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVF-LEKKFLP 94
                   G+ +D  E   + QLQ +G+ V R GD I   +P  ++F ++ + L + F P
Sbjct: 63  CGAIGAGIGAYMDVQESALREQLQGSGVRVVREGDNIRLIMPGSITFETDSYVLRRSFSP 122

Query: 95  MLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISV 154
           +L+ +  +L K+  T++ +  HTD+ G  + N  +S++RA  + S L+ +GV  NR + +
Sbjct: 123 VLESVGLVLAKYNETMMRVTGHTDNTGGEQYNQRLSEDRAQSVASNLMSQGVDGNR-LYI 181

Query: 155 RGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRG 186
           +G     PI  N+T  GR +N+R+E+ I P  
Sbjct: 182 QGSGETMPIADNNTSSGRASNRRVELYILPNN 213


>gi|238783060|ref|ZP_04627087.1| Inner membrane lipoprotein yiaD [Yersinia bercovieri ATCC 43970]
 gi|238716061|gb|EEQ08046.1| Inner membrane lipoprotein yiaD [Yersinia bercovieri ATCC 43970]
          Length = 219

 Score =  123 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 43/167 (25%), Positives = 79/167 (47%), Gaps = 2/167 (1%)

Query: 19  GLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPV 78
             +  ++ K  L  +     +    G  +D  E + + ++  TG+ V+R GD I   +P 
Sbjct: 53  SSSKHDRGKGALIGAAAGAALGGGAGYYMDVQEAKLREKMNGTGVSVTRQGDNIVLNMPN 112

Query: 79  HVSFV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVI 137
           +V+F      L+      L  +A +L ++  T + +   TDS G   +N+ +SQ+RAD +
Sbjct: 113 NVTFDTDSSNLKPAGANTLTGVAMVLKEYDKTAVNVTGFTDSSGARAHNMTLSQQRADSV 172

Query: 138 KSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
            S LI +   +   +   G     P+ +N T  G+  N+R+EI + P
Sbjct: 173 GSALIMQ-GVAANRVRTSGAGPDNPVASNSTAAGKAQNRRVEITLSP 218


>gi|126640934|ref|YP_001083918.1| putative outer membrane protein [Acinetobacter baumannii ATCC
           17978]
 gi|169796935|ref|YP_001714728.1| putative outer membrane protein [Acinetobacter baumannii AYE]
 gi|184157155|ref|YP_001845494.1| outer membrane protein, related peptidoglycan-associated
           (lipo)protein [Acinetobacter baumannii ACICU]
 gi|213156662|ref|YP_002318323.1| OmpA/MotB domain protein [Acinetobacter baumannii AB0057]
 gi|215484397|ref|YP_002326628.1| Inner membrane lipoprotein yiaD precursor [Acinetobacter baumannii
           AB307-0294]
 gi|239503181|ref|ZP_04662491.1| Inner membrane lipoprotein yiaD precursor [Acinetobacter baumannii
           AB900]
 gi|260555775|ref|ZP_05827995.1| type VI secretion system OmpA/MotB [Acinetobacter baumannii ATCC
           19606]
 gi|301347224|ref|ZP_07227965.1| Inner membrane lipoprotein yiaD precursor [Acinetobacter baumannii
           AB056]
 gi|301512729|ref|ZP_07237966.1| Inner membrane lipoprotein yiaD precursor [Acinetobacter baumannii
           AB058]
 gi|301597873|ref|ZP_07242881.1| Inner membrane lipoprotein yiaD precursor [Acinetobacter baumannii
           AB059]
 gi|332853740|ref|ZP_08434952.1| OmpA family protein [Acinetobacter baumannii 6013150]
 gi|332871140|ref|ZP_08439738.1| OmpA family protein [Acinetobacter baumannii 6013113]
 gi|332874156|ref|ZP_08442080.1| OmpA family protein [Acinetobacter baumannii 6014059]
 gi|126386818|gb|ABO11316.1| putative outer membrane protein [Acinetobacter baumannii ATCC
           17978]
 gi|169149862|emb|CAM87753.1| putative outer membrane protein [Acinetobacter baumannii AYE]
 gi|183208749|gb|ACC56147.1| Outer membrane protein, related peptidoglycan-associated
           (lipo)protein [Acinetobacter baumannii ACICU]
 gi|213055822|gb|ACJ40724.1| OmpA/MotB domain protein [Acinetobacter baumannii AB0057]
 gi|213988304|gb|ACJ58603.1| Inner membrane lipoprotein yiaD precursor [Acinetobacter baumannii
           AB307-0294]
 gi|260410686|gb|EEX03984.1| type VI secretion system OmpA/MotB [Acinetobacter baumannii ATCC
           19606]
 gi|322507052|gb|ADX02506.1| Putative outer membrane protein [Acinetobacter baumannii 1656-2]
 gi|323516919|gb|ADX91300.1| Outer membrane protein, related peptidoglycan-associated
           (lipo)protein [Acinetobacter baumannii TCDC-AB0715]
 gi|332728426|gb|EGJ59801.1| OmpA family protein [Acinetobacter baumannii 6013150]
 gi|332731726|gb|EGJ63007.1| OmpA family protein [Acinetobacter baumannii 6013113]
 gi|332737631|gb|EGJ68534.1| OmpA family protein [Acinetobacter baumannii 6014059]
          Length = 217

 Score =  123 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 46/180 (25%), Positives = 86/180 (47%), Gaps = 3/180 (1%)

Query: 8   SMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSR 67
           ++       G   ++    +     +    ++    G  LD+ E + + Q+  TG+ V R
Sbjct: 38  TLIGAAAGYGISKSNANSSRQNNRAAAIGAVLGAAGGLYLDQKEKKLREQMAGTGVEVGR 97

Query: 68  IGDM-ITCYIPVHVSFVS-EVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKN 125
             D  +   +P  ++F + +  ++  F   L  +A  L +   + I +  +TD+ G    
Sbjct: 98  NPDGSVQLIMPGSITFDTNKSNIKPNFYATLDKVAQTLAEDNKSAILVTGYTDNTGNDSI 157

Query: 126 NLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPR 185
           N+ +SQ RA  +K+YL  +GV S+R I  +G+    PI  N T  GR+ N+R+EI I+ +
Sbjct: 158 NIPLSQARAQSVKNYLAGKGVPSSR-IDAQGYGSSNPIADNSTASGREQNRRVEISIYAK 216


>gi|113969010|ref|YP_732803.1| OmpA/MotB domain-containing protein [Shewanella sp. MR-4]
 gi|113883694|gb|ABI37746.1| OmpA/MotB domain protein [Shewanella sp. MR-4]
          Length = 230

 Score =  123 bits (308), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 52/167 (31%), Positives = 83/167 (49%), Gaps = 2/167 (1%)

Query: 22  SREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVS 81
             ++ K  L  +     V    G  +D  E + + QL  TG+ V+R GD I   +P  V+
Sbjct: 65  KSDRGKGALIGAASGAAVGGGIGYYMDVQETKLRQQLASTGVSVTRDGDNIILNMPNEVT 124

Query: 82  F-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSY 140
           F V +  L      +L  +A +  ++  T + +  +TDS G+   NL +SQ RA  + +Y
Sbjct: 125 FGVDQTELSDGAKRVLNSVALVAKEYSKTQLNVLGYTDSSGSDSYNLRLSQVRASEVGNY 184

Query: 141 LIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGN 187
           L+ +GV+S R  S +G     PI +N    GR  N+R+EI + P G 
Sbjct: 185 LMSKGVASARVKS-KGMGEASPIASNANAAGRAQNRRVEIVLTPTGQ 230


>gi|153949077|ref|YP_001403078.1| outer membrane lipoprotein [Yersinia pseudotuberculosis IP 31758]
 gi|152960572|gb|ABS48033.1| OmpA family protein [Yersinia pseudotuberculosis IP 31758]
          Length = 219

 Score =  123 bits (308), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 48/219 (21%), Positives = 90/219 (41%), Gaps = 36/219 (16%)

Query: 1   MIKELGL---SMFIMTTISGC-------------------------------GLASREKK 26
           M K L      + +   +S C                                 +  ++ 
Sbjct: 1   MKKRLLAPVAIVSVALILSACTTNPYTGESQAGKSGYGAGIGAALGAGIGLLSSSKHDRG 60

Query: 27  KVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVS-E 85
           K  L  +     +    G  +D  E + + ++  TG+ V+R G+ I   +P +V+F +  
Sbjct: 61  KGALIGAAAGAALGGGAGYYMDVQEAKLREKMSGTGVSVTRQGENIVLNMPNNVTFDTNS 120

Query: 86  VFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRG 145
             L+      L  +A +L ++  T + +  +TDS G   +N+++SQ+RAD + S LI + 
Sbjct: 121 SNLKPAGANTLTGVAMVLKEYDKTAVNVTGYTDSTGARAHNIVLSQQRADNVASALIVQ- 179

Query: 146 VSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
             +   I   G     P+ +N T  G+  N+R+EI + P
Sbjct: 180 GVAANRIRTYGAGPDNPVASNSTAAGKAQNRRVEITLSP 218


>gi|238754016|ref|ZP_04615375.1| Inner membrane lipoprotein yiaD [Yersinia ruckeri ATCC 29473]
 gi|238707768|gb|EEQ00127.1| Inner membrane lipoprotein yiaD [Yersinia ruckeri ATCC 29473]
          Length = 219

 Score =  123 bits (308), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 46/180 (25%), Positives = 88/180 (48%), Gaps = 2/180 (1%)

Query: 6   GLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVV 65
           G+   +   I     + +++ K  L  +     +    G  +D  E + + +++ TG+ V
Sbjct: 40  GIGAVLGAGIGVLSSSKKDRGKGALIGAAAGAALGGGAGYYMDVQEAKLRDKMRGTGVSV 99

Query: 66  SRIGDMITCYIPVHVSFV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLK 124
           +R GD I   +P +V+F  +   L+      L  +A +L ++  T + +  +TDS G   
Sbjct: 100 TRQGDNIVLNMPNNVTFDTNSSNLKPAGANTLTGVAMVLKEYEKTAVNVTGYTDSTGARA 159

Query: 125 NNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           +N+++SQ+RA+ + S LI +   +   I   G     P+ TN T  G+  N+R+EI + P
Sbjct: 160 HNMILSQQRAETVGSALITQ-GVAANRIRTIGAGPDNPVATNSTTAGKAQNRRVEITLSP 218


>gi|114048845|ref|YP_739395.1| OmpA/MotB domain-containing protein [Shewanella sp. MR-7]
 gi|113890287|gb|ABI44338.1| OmpA/MotB domain protein [Shewanella sp. MR-7]
          Length = 230

 Score =  122 bits (307), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 52/167 (31%), Positives = 83/167 (49%), Gaps = 2/167 (1%)

Query: 22  SREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVS 81
             ++ K  L  +     V    G  +D  E + + QL  TG+ V+R GD I   +P  V+
Sbjct: 65  KSDRGKGALIGAASGAAVGGGIGYYMDVQETKLREQLASTGVSVTRDGDNIILNMPNEVT 124

Query: 82  F-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSY 140
           F V +  L      +L  +A +  ++  T + +  +TDS G+   NL +SQ RA  + +Y
Sbjct: 125 FGVDQTELSDGAKRVLNSVALVAKEYSKTQLNVLGYTDSSGSDSYNLRLSQVRASEVGNY 184

Query: 141 LIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGN 187
           L+ +GV+S R  S +G     PI +N    GR  N+R+EI + P G 
Sbjct: 185 LMSKGVASARVKS-KGMGEASPIASNANAAGRAQNRRVEIVLTPTGQ 230


>gi|22127962|ref|NP_671385.1| putative outer membrane lipoprotein [Yersinia pestis KIM 10]
 gi|45443710|ref|NP_995249.1| putative outer membrane lipoprotein [Yersinia pestis biovar
           Microtus str. 91001]
 gi|51598197|ref|YP_072388.1| outer membrane lipoprotein [Yersinia pseudotuberculosis IP 32953]
 gi|108808999|ref|YP_652915.1| putative outer membrane lipoprotein [Yersinia pestis Antiqua]
 gi|108813881|ref|YP_649648.1| putative outer membrane lipoprotein [Yersinia pestis Nepal516]
 gi|145597343|ref|YP_001161418.1| putative outer membrane lipoprotein [Yersinia pestis Pestoides F]
 gi|150260986|ref|ZP_01917714.1| putative lipoprotein [Yersinia pestis CA88-4125]
 gi|162420588|ref|YP_001608097.1| putative outer membrane lipoprotein [Yersinia pestis Angola]
 gi|165926066|ref|ZP_02221898.1| OmpA family protein [Yersinia pestis biovar Orientalis str.
           F1991016]
 gi|165936922|ref|ZP_02225488.1| OmpA family protein [Yersinia pestis biovar Orientalis str. IP275]
 gi|166009516|ref|ZP_02230414.1| OmpA family protein [Yersinia pestis biovar Antiqua str. E1979001]
 gi|166213252|ref|ZP_02239287.1| OmpA family protein [Yersinia pestis biovar Antiqua str. B42003004]
 gi|167398489|ref|ZP_02304013.1| OmpA family protein [Yersinia pestis biovar Antiqua str. UG05-0454]
 gi|167421106|ref|ZP_02312859.1| OmpA family protein [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167425514|ref|ZP_02317267.1| OmpA family protein [Yersinia pestis biovar Mediaevalis str.
           K1973002]
 gi|167467912|ref|ZP_02332616.1| OmpA family protein [Yersinia pestis FV-1]
 gi|170022281|ref|YP_001718786.1| putative outer membrane lipoprotein [Yersinia pseudotuberculosis
           YPIII]
 gi|186897420|ref|YP_001874532.1| putative outer membrane lipoprotein [Yersinia pseudotuberculosis
           PB1/+]
 gi|218931056|ref|YP_002348931.1| putative outer membrane lipoprotein [Yersinia pestis CO92]
 gi|229839783|ref|ZP_04459942.1| putative lipoprotein [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|229841867|ref|ZP_04462023.1| putative lipoprotein [Yersinia pestis biovar Orientalis str. India
           195]
 gi|229896745|ref|ZP_04511909.1| putative lipoprotein [Yersinia pestis Pestoides A]
 gi|229904405|ref|ZP_04519516.1| putative lipoprotein [Yersinia pestis Nepal516]
 gi|270488345|ref|ZP_06205419.1| OmpA family protein [Yersinia pestis KIM D27]
 gi|294505605|ref|YP_003569667.1| putative lipoprotein [Yersinia pestis Z176003]
 gi|21961106|gb|AAM87636.1|AE014011_3 putative outer membrane protein [Yersinia pestis KIM 10]
 gi|45438580|gb|AAS64126.1| putative lipoprotein [Yersinia pestis biovar Microtus str. 91001]
 gi|51591479|emb|CAH23150.1| OmpA-OmpF family porin [Yersinia pseudotuberculosis IP 32953]
 gi|108777529|gb|ABG20048.1| lipoprotein [Yersinia pestis Nepal516]
 gi|108780912|gb|ABG14970.1| putative lipoprotein [Yersinia pestis Antiqua]
 gi|115349667|emb|CAL22647.1| putative lipoprotein [Yersinia pestis CO92]
 gi|145209039|gb|ABP38446.1| lipoprotein [Yersinia pestis Pestoides F]
 gi|149290394|gb|EDM40471.1| putative lipoprotein [Yersinia pestis CA88-4125]
 gi|162353403|gb|ABX87351.1| OmpA family protein [Yersinia pestis Angola]
 gi|165915164|gb|EDR33775.1| OmpA family protein [Yersinia pestis biovar Orientalis str. IP275]
 gi|165921926|gb|EDR39103.1| OmpA family protein [Yersinia pestis biovar Orientalis str.
           F1991016]
 gi|165991438|gb|EDR43739.1| OmpA family protein [Yersinia pestis biovar Antiqua str. E1979001]
 gi|166205550|gb|EDR50030.1| OmpA family protein [Yersinia pestis biovar Antiqua str. B42003004]
 gi|166961235|gb|EDR57256.1| OmpA family protein [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167050993|gb|EDR62401.1| OmpA family protein [Yersinia pestis biovar Antiqua str. UG05-0454]
 gi|167055528|gb|EDR65321.1| OmpA family protein [Yersinia pestis biovar Mediaevalis str.
           K1973002]
 gi|169748815|gb|ACA66333.1| OmpA/MotB domain protein [Yersinia pseudotuberculosis YPIII]
 gi|186700446|gb|ACC91075.1| OmpA/MotB domain protein [Yersinia pseudotuberculosis PB1/+]
 gi|229678523|gb|EEO74628.1| putative lipoprotein [Yersinia pestis Nepal516]
 gi|229691206|gb|EEO83259.1| putative lipoprotein [Yersinia pestis biovar Orientalis str. India
           195]
 gi|229696149|gb|EEO86196.1| putative lipoprotein [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|229700284|gb|EEO88319.1| putative lipoprotein [Yersinia pestis Pestoides A]
 gi|262363769|gb|ACY60490.1| putative lipoprotein [Yersinia pestis D106004]
 gi|262367705|gb|ACY64262.1| putative lipoprotein [Yersinia pestis D182038]
 gi|270336849|gb|EFA47626.1| OmpA family protein [Yersinia pestis KIM D27]
 gi|294356064|gb|ADE66405.1| putative lipoprotein [Yersinia pestis Z176003]
 gi|320017406|gb|ADW00978.1| putative lipoprotein [Yersinia pestis biovar Medievalis str. Harbin
           35]
          Length = 219

 Score =  122 bits (307), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 47/219 (21%), Positives = 90/219 (41%), Gaps = 36/219 (16%)

Query: 1   MIKELGL---SMFIMTTISGC-------------------------------GLASREKK 26
           M K +      + +   +S C                                 +  ++ 
Sbjct: 1   MKKRILAPVAIVSVALILSACTTNPYTGESQAGKSGYGAGIGAALGAGIGLLSSSKHDRG 60

Query: 27  KVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVS-E 85
           K  L  +     +    G  +D  E + + ++  TG+ V+R G+ I   +P +V+F +  
Sbjct: 61  KGALIGAAAGAALGGGAGYYMDVQEAKLREKMSGTGVSVTRQGENIVLNMPNNVTFDTNS 120

Query: 86  VFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRG 145
             L+      L  +A +L ++  T + +  +TDS G   +N+++SQ+RAD + S LI + 
Sbjct: 121 SNLKPAGANTLTGVAMVLKEYDKTAVNVTGYTDSTGARAHNIVLSQQRADNVASALIVQ- 179

Query: 146 VSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
             +   I   G     P+ +N T  G+  N+R+EI + P
Sbjct: 180 GVAANRIRTYGAGPDNPVASNSTAAGKAQNRRVEITLSP 218


>gi|146328667|ref|YP_001209012.1| OmpA family protein [Dichelobacter nodosus VCS1703A]
 gi|146232137|gb|ABQ13115.1| OmpA family protein [Dichelobacter nodosus VCS1703A]
          Length = 225

 Score =  122 bits (307), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 55/210 (26%), Positives = 88/210 (41%), Gaps = 29/210 (13%)

Query: 1   MIKELGLSMFIMTTISGCGLASR--EKKKVFLHKSNDTDIVNKRFG-------------- 44
           M K +  +      ISGC          +     +    +     G              
Sbjct: 1   MKKIVLTASIAAFMISGCVSNGGGLSANQSAAIGTAVGALAGGVLGHQLNDDNGRYVGAA 60

Query: 45  ----------SSLDKAEDEFQMQLQDTGIVVSRIGDM-ITCYIPVHVSFVSE-VFLEKKF 92
                     + +D+ + + Q Q+Q TGI V RI    +   IP  V F ++   +   F
Sbjct: 61  AGALAGAAIGNYMDRQQQQLQQQVQGTGINVQRIDQGTLQLNIPGDVLFATDEYQIRPNF 120

Query: 93  LPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFI 152
              L  +A  +N++P T++ I  HTDS G    N  +S+ RA+    YL+Q+GV+  R +
Sbjct: 121 YQTLNSVAQTMNQYPQTIVHIYGHTDSTGRAAYNQGLSERRANSAAQYLMQQGVNMQRIL 180

Query: 153 SVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           S +G+   YP   N T  GR  N+R+E+ I
Sbjct: 181 S-KGYGQNYPRANNATPDGRAQNRRVEVYI 209


>gi|78221730|ref|YP_383477.1| surface antigen protein [Geobacter metallireducens GS-15]
 gi|78192985|gb|ABB30752.1| OmpA/MotB:Rickettsia 17 kDa surface antigen [Geobacter
           metallireducens GS-15]
          Length = 218

 Score =  122 bits (307), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 49/219 (22%), Positives = 84/219 (38%), Gaps = 34/219 (15%)

Query: 2   IKELGLSMF--IMTTISGCGLASREKKKVFLHKSNDTDIVNKR----------------- 42
           +K   L      M  ++GC       +      +     V                    
Sbjct: 1   MKRTALCALTIAMAALTGCAQPMTRTQTGAALGTGVGAAVGAGLGQAIGRNTESTLIGAA 60

Query: 43  ------------FGSSLDKAEDEFQMQLQD-TGIVVSRIGDMITCYIPVHVSFV-SEVFL 88
                        G+ +DK E   +  + +  G  + R  +++       + F  +   L
Sbjct: 61  AGALAGGLTGGAIGNYMDKQEQAMRQAVANVEGASIQRDQNVLAVTFKSDILFPINSAVL 120

Query: 89  EKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSS 148
           +      +  +A +L ++P+T I I  HTDS G+   N  +S+ RA  +K+ L  RGV+ 
Sbjct: 121 QPGANDEITRVAQVLTQYPATTITIAGHTDSTGSDALNQTLSERRATAVKNALAARGVAP 180

Query: 149 NRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGN 187
            R  ++ GF    PI  N T+ GR  N+R+EI I P+  
Sbjct: 181 ARMNAI-GFGKSKPIADNSTEAGRSMNRRVEITIVPQQQ 218


>gi|117620195|ref|YP_854667.1| putative outer membrane lipoprotein [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
 gi|117561602|gb|ABK38550.1| inner membrane lipoprotein YiaD [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
          Length = 218

 Score =  122 bits (307), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 54/215 (25%), Positives = 96/215 (44%), Gaps = 33/215 (15%)

Query: 2   IKELGLSMFIMTTISGC-------------------------------GLASREKKKVFL 30
            K L  ++ ++  ++GC                                 +  ++KK  L
Sbjct: 3   FKTLVPAVALLVALTGCTTNPYTGESQTSKGAWGALAGAATGAAVGALSSSKGDRKKGIL 62

Query: 31  HKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEV-FLE 89
                   +    G  +D  E + + +LQ TG+ V+R GD +   +P +V+F S    L+
Sbjct: 63  TGVAAGAALGGGIGYYMDVQEAKLREKLQGTGVSVTRNGDQLILNMPNNVTFDSSSAQLK 122

Query: 90  KKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSN 149
                 L  +A ++ +F  T + +  HTDS G+ + N+ +S +RAD + + LI +GV+ +
Sbjct: 123 AAGANTLSGVAMVVGEFDKTRLNVVGHTDSTGSRELNMKLSAQRADAVAAQLIGQGVTGS 182

Query: 150 RFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           R IS  G     P+ TN T  G+  N+R+ I + P
Sbjct: 183 R-ISTSGVGPDQPVATNSTAEGKAQNRRVTITLTP 216


>gi|326562151|gb|EGE12479.1| OmpA/MotB domain protein [Moraxella catarrhalis 7169]
 gi|326565667|gb|EGE15830.1| OmpA/MotB domain protein [Moraxella catarrhalis 12P80B1]
 gi|326566236|gb|EGE16388.1| OmpA/MotB domain protein [Moraxella catarrhalis 103P14B1]
 gi|326567112|gb|EGE17234.1| OmpA/MotB domain protein [Moraxella catarrhalis BC1]
 gi|326576199|gb|EGE26114.1| OmpA/MotB domain protein [Moraxella catarrhalis CO72]
          Length = 224

 Score =  122 bits (307), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 51/181 (28%), Positives = 89/181 (49%), Gaps = 5/181 (2%)

Query: 10  FIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIG 69
            +   + G  ++     +     +     V    G+ +++   + + Q+Q TG+ V+   
Sbjct: 44  AVAGALGGTAISKATGGEKTGRDAILGAAVGAAAGAYMERQAKQIEQQMQGTGVTVTHDT 103

Query: 70  D--MITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNN 126
           D   I   +P +++F   +  L   FL  L  +A  +N++  T I I  HTDS G    N
Sbjct: 104 DTGNINLTMPGNITFAHDDDTLNSAFLGRLNQLANTMNQYHETTIVIVGHTDSTGQAAYN 163

Query: 127 LLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIF-PR 185
             +S+ RAD ++ YLI +GV   R  +V G+  + PI +N T+ GR  N+R+E+ I  P+
Sbjct: 164 QELSERRADSVRYYLINQGVDPYRIQTV-GYGMRQPIASNATEAGRAQNRRVELMILAPQ 222

Query: 186 G 186
           G
Sbjct: 223 G 223


>gi|329847657|ref|ZP_08262685.1| inner membrane lipoprotein yiaD [Asticcacaulis biprosthecum C19]
 gi|328842720|gb|EGF92289.1| inner membrane lipoprotein yiaD [Asticcacaulis biprosthecum C19]
          Length = 208

 Score =  122 bits (307), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 54/166 (32%), Positives = 87/166 (52%), Gaps = 2/166 (1%)

Query: 20  LASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVH 79
               + +K  +  +    +     G+ +D+   + + +L+   + V+R GD I   +P  
Sbjct: 41  KKGDQARKNAILGAGIGALAGGGVGAYMDRQNKDLRSELEGRNVYVTRSGDNIILSMPGD 100

Query: 80  VSFV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIK 138
           V+F      L   F+P+L  +ATILN++PST I +  H DS GT   N+ +S+ RA+ + 
Sbjct: 101 VTFSSGSADLNGGFMPVLNDVATILNQYPSTYIDVVGHADSQGTDAFNMDLSERRANAVA 160

Query: 139 SYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
            YL+ + V S R I V G     PI +NDT  GR  N+R+EI + P
Sbjct: 161 GYLVGQKVKSER-IYVAGAGESSPIASNDTADGRARNRRVEITLRP 205


>gi|24375456|ref|NP_719499.1| OmpA family protein [Shewanella oneidensis MR-1]
 gi|24350304|gb|AAN56943.1|AE015827_15 OmpA family protein [Shewanella oneidensis MR-1]
          Length = 228

 Score =  122 bits (307), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 51/166 (30%), Positives = 83/166 (50%), Gaps = 2/166 (1%)

Query: 22  SREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVS 81
             ++ K  L  +     +    G  +D  E + + QL  TG+ V+R GD I   +P  V+
Sbjct: 64  KSDRGKGALIGAASGAALGGGIGYYMDVQETKLRQQLASTGVSVTRSGDNIILNMPNEVT 123

Query: 82  F-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSY 140
           F V +  L      +L  +A +  ++  T + +  +TDS G+   NL +SQ RA  + +Y
Sbjct: 124 FGVDQTELSDGAKRVLNSVALVAKEYSKTQLNVLGYTDSSGSDSYNLRLSQVRASEVGNY 183

Query: 141 LIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRG 186
           L+ +GV+S R  S +G     PI +N    GR  N+R+EI + P G
Sbjct: 184 LMSKGVASARVKS-KGMGEASPIASNANAEGRAQNRRVEIVLTPTG 228


>gi|310780073|ref|YP_003968405.1| OmpA/MotB domain protein [Ilyobacter polytropus DSM 2926]
 gi|309749396|gb|ADO84057.1| OmpA/MotB domain protein [Ilyobacter polytropus DSM 2926]
          Length = 216

 Score =  122 bits (307), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 60/214 (28%), Positives = 100/214 (46%), Gaps = 32/214 (14%)

Query: 1   MIKELGLSMFIMTTISGCGLAS-----------------------------REKKKVFLH 31
           M K+L  +  I+T +S C   +                              +  +  L 
Sbjct: 1   MTKKLLAAALIITALSACQSTNPYTREGQFNKTSKYAAGGAVVGAVAGQVIGKDTEGTLT 60

Query: 32  KSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDM-ITCYIPVHVSFV-SEVFLE 89
            +     +    G   D+ E   + +L+ TG+ + R  D  +   +P +++F      + 
Sbjct: 61  GAAAGTALGAGLGYYFDRQEAALRQELERTGVSLRRTADNTLELVMPGNLTFRTGSSDIN 120

Query: 90  KKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSN 149
             F  +L  +ATIL ++  T I +  HTD+ G+L  N  +SQERA+ +  YL  RGV S+
Sbjct: 121 SGFYDVLDSVATILVEYKDTTIFVSGHTDNTGSLATNQRLSQERANSVGRYLSSRGVLSS 180

Query: 150 RFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
           R IS +GF Y++PI +N T  GR+ N+R+EI+I 
Sbjct: 181 R-ISSQGFDYQFPIASNSTASGREQNRRVEIEIT 213


>gi|330504866|ref|YP_004381735.1| OmpA/MotB domain-containing protein [Pseudomonas mendocina NK-01]
 gi|328919152|gb|AEB59983.1| OmpA/MotB domain-containing protein [Pseudomonas mendocina NK-01]
          Length = 222

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 51/218 (23%), Positives = 90/218 (41%), Gaps = 35/218 (16%)

Query: 1   MIKELGLSM-FIMTTISGCGLAS--------------------------------REKKK 27
           M +   +++      +SGC   +                                  + K
Sbjct: 1   MFRLSLIALCSSALLLSGCASQNPYDQSAPSSNRTATYGGLGALAGAAAGALINHDNRGK 60

Query: 28  VFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEV 86
             L  +         +G   DK E+E +  +Q TG+ V R GD+I   +P +++F     
Sbjct: 61  GALIGAAVAGAAAAGYGYYADKQEEELRRSMQGTGVEVQRQGDVIQLIMPGNITFATDSA 120

Query: 87  FLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGV 146
            +   F   L  +A    ++    I +  HTDS G+  +N+ +SQ RA  +  YL+ +G+
Sbjct: 121 QIASSFYQPLNNLANSFRQYNQNSIEVVGHTDSTGSHSHNMALSQRRAQSVADYLLAQGI 180

Query: 147 SSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
             +R +S RG     P+ +N T  GR  N+R+E+ + P
Sbjct: 181 DPSR-VSTRGMGPDQPVASNATADGRAQNRRVEVTLRP 217


>gi|71066360|ref|YP_265087.1| OmpA/OmpF family outer membrane protein [Psychrobacter arcticus
           273-4]
 gi|71039345|gb|AAZ19653.1| outer membrane protein, OmpA/OmpF family [Psychrobacter arcticus
           273-4]
          Length = 217

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 40/218 (18%), Positives = 90/218 (41%), Gaps = 31/218 (14%)

Query: 2   IKELGLSMFIM--TTISGCGLASREKKK----------------VFLHKSNDTDIVNKR- 42
           ++   +   I     ++GC       ++                  + K+   +   +  
Sbjct: 1   MRNTLMVAAIASGLVLTGCVTDPSTGQQRLNKTAIGALAGAAGGATISKATGGEKTGRDA 60

Query: 43  ---------FGSSLDKAEDEFQMQLQDTGIVVSRIGD-MITCYIPVHVSF-VSEVFLEKK 91
                     G  +++   + + Q+  TG+ V+   +  I   +P  ++F   +  L   
Sbjct: 61  AIGAAIGAGVGYYMERQAKQLEQQMAGTGVTVTPNANGNIDLVMPGSITFSFDDATLNNS 120

Query: 92  FLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRF 151
           F P L  +A  +N++    I I  HTDS GT   N+ +S++RA  + +  +     ++  
Sbjct: 121 FKPTLDKLAATMNEYNQNTITIAGHTDSKGTDAYNMKLSRDRAYAVAN-YLSARGVASNR 179

Query: 152 ISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGNIK 189
           I+V  +    P+  N+++ GRQ N+R+E+ +    +++
Sbjct: 180 INVVAYGESRPVADNNSEYGRQQNRRVELTVNAPQSVR 217


>gi|294638308|ref|ZP_06716561.1| OmpA family protein [Edwardsiella tarda ATCC 23685]
 gi|291088561|gb|EFE21122.1| OmpA family protein [Edwardsiella tarda ATCC 23685]
          Length = 219

 Score =  122 bits (306), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 49/167 (29%), Positives = 86/167 (51%), Gaps = 2/167 (1%)

Query: 19  GLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPV 78
             +  ++ K  L  +     +    G  +D  E + + +++ TG+ V+R GD I   +P 
Sbjct: 53  SSSKSDRGKGALIGAAAGAALGGGIGYYMDVQEAKLRDKMRGTGVSVTRQGDNIVLNMPN 112

Query: 79  HVSFVS-EVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVI 137
           +V+F S    L+      L  +A +L ++  T + +  +TDS G+   N+ +SQ+RAD +
Sbjct: 113 NVTFDSNSSNLKPAGANTLTGVAMVLKEYQKTAVNVVGYTDSTGSRDLNMRLSQQRADSV 172

Query: 138 KSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
            S LI +GV++ R I   G     PI +N T  G+  N+R+EI + P
Sbjct: 173 ASALITQGVAAGR-IRTIGMGPANPIASNSTAAGKAQNRRVEITLSP 218


>gi|83644388|ref|YP_432823.1| outer membrane protein and related peptidoglycan-associated
           (lipo)protein [Hahella chejuensis KCTC 2396]
 gi|83632431|gb|ABC28398.1| Outer membrane protein and related peptidoglycan-associated
           (lipo)protein [Hahella chejuensis KCTC 2396]
          Length = 219

 Score =  122 bits (306), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 54/166 (32%), Positives = 92/166 (55%), Gaps = 2/166 (1%)

Query: 20  LASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVH 79
            + +++ K  L  +     V    G  +DK E E + +L+ TG+ V R GD IT  +P +
Sbjct: 52  SSKKDRGKGALIGAAAGGAVGGGIGYYMDKQESELRHRLEGTGVRVVRNGDEITLVMPGN 111

Query: 80  VSFV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIK 138
           ++F      ++  F   L  +  +L +F  T+I +  HTDS G+L  N  +S++RA  + 
Sbjct: 112 ITFDTGRAEVKANFYDTLDSVGLVLKEFDKTIIQVSGHTDSTGSLDLNQRLSEQRAGSVG 171

Query: 139 SYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
            YLI +GV S+R  ++ G+  +YP+ TN T  GR  N+R+E+++ P
Sbjct: 172 RYLISQGVLSSRVQTI-GYGPRYPVATNSTTEGRAANRRVELKLVP 216


>gi|3493603|gb|AAC33455.1| outer membrane protein homolog [Vitreoscilla sp. C1]
          Length = 217

 Score =  122 bits (306), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 50/211 (23%), Positives = 88/211 (41%), Gaps = 29/211 (13%)

Query: 2   IKELGLSMFIMTTISGCGLAS---------------------------REKKKVFLHKSN 34
            K   ++      +S C                                   K   + + 
Sbjct: 5   KKFSLMATVAAVALSACATDPMTGQVDRNNTVLGALGGAATCGIVGALTHGSKGARNSAL 64

Query: 35  DTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFL 93
               +    G+ +D  E + +  L +T + V+R+GD I   +P  ++F      L     
Sbjct: 65  ACGAIGAGVGAYMDHQERQLRQSLANTQVEVNRVGDEIRLVMPESITFATGSYQLNSSAS 124

Query: 94  PMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFIS 153
             L  ++++L ++  T I I  HTDS G+   N  +S+ RA  + +YL+ R V+SNR I+
Sbjct: 125 TSLNSVSSVLAQYTDTTINIVGHTDSTGSDAINEPLSRNRASAVANYLVSRNVASNR-IT 183

Query: 154 VRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
             G   + P+ +N+T  GR  N+R+EI + P
Sbjct: 184 TVGAGCRQPVASNNTVAGRAENRRVEITVNP 214


>gi|238918002|ref|YP_002931516.1| outer membrane lipoprotein [Edwardsiella ictaluri 93-146]
 gi|238867570|gb|ACR67281.1| inner membrane lipoprotein YiaD [Edwardsiella ictaluri 93-146]
          Length = 219

 Score =  122 bits (305), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 51/167 (30%), Positives = 86/167 (51%), Gaps = 2/167 (1%)

Query: 19  GLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPV 78
             +  ++ K  L  +     +    G  +D  E + + +++ TG+ V+R GD I   +P 
Sbjct: 53  SSSKSDRGKGALIGAAAGAALGGGIGYYMDVQEAKLRDKMRGTGVSVTRQGDNIVLNMPN 112

Query: 79  HVSFVS-EVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVI 137
           +V+F S    L+      L  +A +L ++  T + +  +TDS G+   N+ +SQ+RAD +
Sbjct: 113 NVTFDSNSSNLKPAGANTLTGVAMVLKEYQKTAVNVVGYTDSTGSRDLNMRLSQQRADSV 172

Query: 138 KSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
            S LI +GVS+ R I   G     PI TN T  G+  N+R+EI + P
Sbjct: 173 ASALIVQGVSAGR-IRTIGMGPANPIATNSTAAGKAQNRRVEITLSP 218


>gi|114569157|ref|YP_755837.1| OmpA/MotB domain-containing protein [Maricaulis maris MCS10]
 gi|114339619|gb|ABI64899.1| OmpA/MotB domain protein [Maricaulis maris MCS10]
          Length = 227

 Score =  122 bits (305), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 55/222 (24%), Positives = 100/222 (45%), Gaps = 37/222 (16%)

Query: 1   MIKELGLSMFIMTTISGCGLA----------------------------------SREKK 26
           M++   L++    T++ C                                     S E +
Sbjct: 7   MLRTTVLTVA-ALTMAACTTTDPYTGETRANNTGRGVLLGAAAGAALGYLTNTNDSEEGR 65

Query: 27  KVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSE 85
              L  +    +     G+ +D+ E   +  L DTG+ V R G+ +   +P  V+F  + 
Sbjct: 66  TNALIGAGIGALAGGAIGNYMDRQETAMREALSDTGVGVRREGNDLRLIMPGDVTFATNS 125

Query: 86  VFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRG 145
             ++ +F  +L  ++T+LN++P+T + +  H DS+G    N  +S+ RA  + +YLI +G
Sbjct: 126 ADIQGQFYGILSDVSTVLNRYPATYVDVVGHADSVGAADYNQQLSERRALSVGNYLIAQG 185

Query: 146 VSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGN 187
           V  +R   + G   + PI +N+T  GRQ N+R+EI I P  +
Sbjct: 186 VLRDR-FYIAGMGERSPIASNETAAGRQQNRRVEILIRPHAS 226


>gi|269137375|ref|YP_003294075.1| putative outer membrane lipoprotein [Edwardsiella tarda EIB202]
 gi|267983035|gb|ACY82864.1| putative outer membrane lipoprotein [Edwardsiella tarda EIB202]
 gi|304557476|gb|ADM40140.1| Outer membrane protein [Edwardsiella tarda FL6-60]
          Length = 219

 Score =  122 bits (305), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 51/167 (30%), Positives = 86/167 (51%), Gaps = 2/167 (1%)

Query: 19  GLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPV 78
             +  ++ K  L  +     +    G  +D  E + + +++ TG+ V+R GD I   +P 
Sbjct: 53  SSSKSDRGKGALIGAAAGAALGGGIGYYMDVQEAKLRDKMRGTGVSVTRQGDNIVLNMPN 112

Query: 79  HVSFVS-EVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVI 137
           +V+F S    L+      L  +A +L ++  T + +  +TDS G+   N+ +SQ+RAD +
Sbjct: 113 NVTFDSNSSNLKPAGANTLTGVAMVLKEYQKTAVNVVGYTDSTGSRDLNMRLSQQRADSV 172

Query: 138 KSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
            S LI +GVS+ R I   G     PI TN T  G+  N+R+EI + P
Sbjct: 173 ASALIVQGVSAGR-IRTIGMGPANPIATNSTAAGKAQNRRVEITLSP 218


>gi|300779346|ref|ZP_07089204.1| proteobacterial sortase system OmpA family protein
           [Chryseobacterium gleum ATCC 35910]
 gi|300504856|gb|EFK35996.1| proteobacterial sortase system OmpA family protein
           [Chryseobacterium gleum ATCC 35910]
          Length = 229

 Score =  122 bits (305), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 49/192 (25%), Positives = 81/192 (42%), Gaps = 9/192 (4%)

Query: 3   KELGLSMFIMTTISGCGLASREKKKVFLHKSN----DTDIVNKRFGSSLDKAEDEFQMQL 58
           +   + +     + G    +  K       +        +     G+ +DK   + +  L
Sbjct: 33  RGTAVGVASGAVLGGILGNNVGKGGNGAIGAVLGGIIGGVAGNVIGNKMDKQARDIKETL 92

Query: 59  QDTGIVVSRIGDMITCYIPVHV--SFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSH 116
              G  V R+GD I   +   +         L       L  +A +L   P T I I  H
Sbjct: 93  P--GAQVERVGDGIKVTMNESIVNFAFDSSNLTSVAQTNLDKLAEVLANNPDTNINIYGH 150

Query: 117 TDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQ 176
           TDS G+   NL +SQ RAD +K+YL  +G++S+R  + +G     P+ +NDT+ GR  N+
Sbjct: 151 TDSKGSDDYNLKLSQRRADAVKAYLTGKGIASSRMFT-KGEGEAMPVASNDTEEGRAKNR 209

Query: 177 RIEIQIFPRGNI 188
           R+E  I     +
Sbjct: 210 RVEFAITANEKM 221


>gi|153841945|ref|ZP_01993455.1| inner membrane lipoprotein YiaD [Vibrio parahaemolyticus AQ3810]
 gi|149745429|gb|EDM56680.1| inner membrane lipoprotein YiaD [Vibrio parahaemolyticus AQ3810]
          Length = 170

 Score =  122 bits (305), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 50/168 (29%), Positives = 88/168 (52%), Gaps = 3/168 (1%)

Query: 19  GLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIG-DMITCYIP 77
           G  ++E++K  L  +          G   D+ E E +  L ++G+ V R+G + +   + 
Sbjct: 2   GDNAKERRKHALIGAAAGGATGAGVGYYFDQQEAELRRALLNSGVQVQRVGENQLLLRME 61

Query: 78  VHVSFVSEVF-LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADV 136
             + F S  + L+      L+ +A IL ++P T + I  +TDS G+   N  +S+ RA+ 
Sbjct: 62  NGIGFSSSSYQLDASIHNTLRGVARILVEYPDTSLVIDGYTDSTGSESYNQTLSERRAES 121

Query: 137 IKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           ++ +L+ + V+  R I  RG+  + PI +N T  GR  N+R+EIQI P
Sbjct: 122 VRQFLVSQKVAPGRAI-ARGYGERNPICSNQTSEGRACNRRVEIQILP 168


>gi|262280028|ref|ZP_06057813.1| OmpA/MotB domain-containing protein [Acinetobacter calcoaceticus
           RUH2202]
 gi|262260379|gb|EEY79112.1| OmpA/MotB domain-containing protein [Acinetobacter calcoaceticus
           RUH2202]
          Length = 217

 Score =  122 bits (305), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 43/180 (23%), Positives = 82/180 (45%), Gaps = 3/180 (1%)

Query: 8   SMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSR 67
           ++       G   ++          +    ++    G  LD+ E + + Q+  TG+ V R
Sbjct: 38  TLIGAAAGYGISKSNANSSGQNNRAAAIGAVLGAAGGVYLDQKEKKLRQQMAGTGVDVGR 97

Query: 68  IGDM-ITCYIPVHVSFVS-EVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKN 125
             D  +   +P  ++F + +  ++  F   L  +A  L +   + I +  +TD+ G    
Sbjct: 98  NPDGSVQLIMPGSITFDTNKSNIKPNFYSTLDKVAQTLAEDNKSAILVTGYTDNTGNDSI 157

Query: 126 NLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPR 185
           N+ +SQ RA  +K+YL  +   S+  I  +G+    PI  N T  GR+ N+R+EI I+ +
Sbjct: 158 NIPLSQSRAQSVKNYLAGK-GLSSSRIDAQGYGSSNPIADNSTASGREQNRRVEISIYAK 216


>gi|157963436|ref|YP_001503470.1| OmpA/MotB domain-containing protein [Shewanella pealeana ATCC
           700345]
 gi|157848436|gb|ABV88935.1| OmpA/MotB domain protein [Shewanella pealeana ATCC 700345]
          Length = 224

 Score =  122 bits (305), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 50/167 (29%), Positives = 85/167 (50%), Gaps = 2/167 (1%)

Query: 19  GLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPV 78
             +  ++ K  L  +     +    G  +D  E E + QLQ +G+ V+R GD I   +P 
Sbjct: 55  SSSKSDRAKGALIGAASGAALGGGIGYYMDVQEAELRKQLQSSGVSVTRSGDNIILNMPN 114

Query: 79  HVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVI 137
            V+F V +  L ++   +L  +  +  ++  T + +  HTDS G    NL +SQ RA  +
Sbjct: 115 DVTFGVDQTDLSQRAKQVLNSVVLVALEYDETKLNVMGHTDSSGAESYNLRLSQVRASEV 174

Query: 138 KSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
            +YL ++ V + R ++  G     PI +N+TK GR  N+R+EI + P
Sbjct: 175 ANYLTRQKVPAQR-VASHGMGESKPIASNETKQGRAENRRVEIILSP 220


>gi|260552490|ref|ZP_05825866.1| inner membrane lipoprotein yiaD [Acinetobacter sp. RUH2624]
 gi|260405297|gb|EEW98793.1| inner membrane lipoprotein yiaD [Acinetobacter sp. RUH2624]
          Length = 217

 Score =  122 bits (305), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 41/171 (23%), Positives = 77/171 (45%), Gaps = 3/171 (1%)

Query: 17  GCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDM-ITCY 75
           G   +S    +     +    ++    G  LD+ E + + Q+  TG+ V R  D  +   
Sbjct: 47  GISKSSANSSRQNNRAAAIGAVLGAAGGLYLDQKEKKLREQMAGTGVEVGRNPDGSVQLI 106

Query: 76  IPVHVSFVS-EVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERA 134
           +P  ++F + +  ++  F   L  +A  L +   + I +  +TD+ G    N+ +SQ RA
Sbjct: 107 MPGSITFDTNKSNIKPNFYATLDKVAQTLAEDNKSAILVTGYTDNTGNDSINIPLSQARA 166

Query: 135 DVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPR 185
             +    +     S+  I  +G+    PI  N T  GR+ N+R+EI I+ +
Sbjct: 167 QSV-KIYLAGKGVSSSRIDAQGYGSSNPIADNSTASGREQNRRVEISIYAK 216


>gi|153834734|ref|ZP_01987401.1| inner membrane lipoprotein YiaD [Vibrio harveyi HY01]
 gi|148868823|gb|EDL67889.1| inner membrane lipoprotein YiaD [Vibrio harveyi HY01]
          Length = 222

 Score =  122 bits (305), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 51/221 (23%), Positives = 96/221 (43%), Gaps = 39/221 (17%)

Query: 2   IKELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFG----------------- 44
           +K++ +++ ++  ++GC    R+      +++N T                         
Sbjct: 1   MKKMSIALALVLALTGCQATQRQNATTGEYETNSTTQGALIGAIAGAAIGLAVGDNAKER 60

Query: 45  -------------------SSLDKAEDEFQMQLQDTGIVVSRIG-DMITCYIPVHVSFVS 84
                                 D+ E E +  L ++G+ V R+G + +   +   + F S
Sbjct: 61  RKGALIGAAAGGATGAGVGYYFDQQEAELRRALLNSGVQVERVGENQLLLRMENGIGFSS 120

Query: 85  EVFLEKKF-LPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQ 143
             +         L+ +A IL ++P T + I  +TDS G+   N  +S+ RA+ ++ YL+ 
Sbjct: 121 SSYQLDSSIHNTLRGVARILVEYPDTSLVIDGYTDSTGSDSYNQTLSERRAESVRQYLVS 180

Query: 144 RGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           + V+  R I  RG+  + PI +N T  GR  N+R+EIQI P
Sbjct: 181 QNVAPGRAI-ARGYGERNPICSNQTSEGRACNRRVEIQILP 220


>gi|296113807|ref|YP_003627745.1| OmpA/MotB domain protein [Moraxella catarrhalis RH4]
 gi|295921501|gb|ADG61852.1| OmpA/MotB domain protein [Moraxella catarrhalis RH4]
          Length = 224

 Score =  121 bits (304), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 51/181 (28%), Positives = 89/181 (49%), Gaps = 5/181 (2%)

Query: 10  FIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIG 69
            +   + G  ++     +     +     V    G+ +++   + + Q+Q TG+ V+   
Sbjct: 44  AVAGALGGTAISKATGGEKTGRDAILGAAVGAAAGAYMERQAKQIEQQMQGTGVTVTHDT 103

Query: 70  D--MITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNN 126
           D   I   +P +++F   +  L   FL  L  +A  +N++  T I I  HTDS G    N
Sbjct: 104 DTGNINLTMPGNITFAHDDDTLNSAFLGRLNQLANTMNQYHETTIVIVGHTDSTGQAAYN 163

Query: 127 LLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIF-PR 185
             +S+ RAD ++ YLI +GV   R  +V G+  + PI +N T+ GR  N+R+E+ I  P+
Sbjct: 164 QELSERRADSVRYYLINQGVDPYRIQTV-GYGIRQPIASNATEAGRAQNRRVELMILAPQ 222

Query: 186 G 186
           G
Sbjct: 223 G 223


>gi|149203135|ref|ZP_01880106.1| OmpA/MotB [Roseovarius sp. TM1035]
 gi|149143681|gb|EDM31717.1| OmpA/MotB [Roseovarius sp. TM1035]
          Length = 210

 Score =  121 bits (304), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 44/181 (24%), Positives = 74/181 (40%), Gaps = 4/181 (2%)

Query: 8   SMFIMTTISGC-GLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVS 66
           ++      +G   + S  K K  L       +     G++LD+ E E + QL    + + 
Sbjct: 32  AIIGGLIGAGTGAIVSDSKGKGALLGGVLGAVGGAAIGNALDRQEAELRQQLDGD-VRIV 90

Query: 67  RIGDMITCYIPVHVSFV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKN 125
             GD +   +P  + F      +       L  ++  L  +P+T + +  HTDS G    
Sbjct: 91  NTGDRLILTMPQDILFPVDGATVAPALRDDLFKVSQSLQAYPNTTVQVVGHTDSDGDAGY 150

Query: 126 NLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPR 185
           N  +S  RA+ +   L   GV   R +   G     P+ +N T  G+  N+R+EI I P 
Sbjct: 151 NQGLSLRRANAVADVLASGGVPYAR-LRAIGRGEDQPVASNLTSEGKAQNRRVEIVILPN 209

Query: 186 G 186
            
Sbjct: 210 A 210


>gi|167625617|ref|YP_001675911.1| OmpA/MotB domain-containing protein [Shewanella halifaxensis
           HAW-EB4]
 gi|167355639|gb|ABZ78252.1| OmpA/MotB domain protein [Shewanella halifaxensis HAW-EB4]
          Length = 224

 Score =  121 bits (304), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 44/167 (26%), Positives = 78/167 (46%), Gaps = 2/167 (1%)

Query: 19  GLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPV 78
             +  ++ K  L  +     +    G  +D  E E +  LQ +G+ V+R GD I   +P 
Sbjct: 55  SSSKNDRGKGALIGAASGAALGGGIGYYMDVQEAELRKLLQSSGVSVTRSGDNIILNMPN 114

Query: 79  HVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVI 137
            V+F V +  L ++   +L  +  +  ++  T + +  +TDS G    NL +SQ RA  +
Sbjct: 115 DVTFGVDQTDLSQRAQQVLNSVVLVALEYDETKLNVMGYTDSSGAESYNLRLSQVRASEV 174

Query: 138 KSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
            +  +       + ++  G     PI +N TK GR  N+R+EI + P
Sbjct: 175 AN-YLTNHKVPAQRVASHGMGESKPIASNQTKQGRAENRRVEIILSP 220


>gi|326564485|gb|EGE14711.1| OmpA/MotB domain protein [Moraxella catarrhalis 46P47B1]
 gi|326568376|gb|EGE18456.1| OmpA/MotB domain protein [Moraxella catarrhalis BC7]
 gi|326572277|gb|EGE22272.1| OmpA/MotB domain protein [Moraxella catarrhalis BC8]
 gi|326574291|gb|EGE24238.1| OmpA/MotB domain protein [Moraxella catarrhalis O35E]
 gi|326574875|gb|EGE24805.1| OmpA/MotB domain protein [Moraxella catarrhalis 101P30B1]
          Length = 224

 Score =  121 bits (304), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 51/181 (28%), Positives = 89/181 (49%), Gaps = 5/181 (2%)

Query: 10  FIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIG 69
            +   + G  ++     +     +     V    G+ +++   + + Q+Q TG+ V+   
Sbjct: 44  AVAGALGGTAISKATGGEKTGRDAILGAAVGAAAGAYMERQAKQIEQQMQGTGVTVTHDT 103

Query: 70  D--MITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNN 126
           D   I   +P +++F   +  L   FL  L  +A  +N++  T I I  HTDS G    N
Sbjct: 104 DTGNINLTMPGNITFAHDDDTLNSAFLGRLNQLANTMNQYHETTIVIVGHTDSTGQAAYN 163

Query: 127 LLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIF-PR 185
             +S+ RAD ++ YLI +GV   R  +V G+  + PI +N T+ GR  N+R+E+ I  P+
Sbjct: 164 QELSERRADSVRYYLINQGVDPYRIQTV-GYGIRQPIASNATEAGRAQNRRVELMILAPQ 222

Query: 186 G 186
           G
Sbjct: 223 G 223


>gi|313144174|ref|ZP_07806367.1| OmpA family protein [Helicobacter cinaedi CCUG 18818]
 gi|313129205|gb|EFR46822.1| OmpA family protein [Helicobacter cinaedi CCUG 18818]
          Length = 156

 Score =  121 bits (304), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 47/146 (32%), Positives = 77/146 (52%), Gaps = 4/146 (2%)

Query: 39  VNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV-SEVFLEKKFLPMLQ 97
                G  +D  + + + +LQ TG+ VSR GD I   +P  ++F      L   F  +L 
Sbjct: 2   AGGAVGGYMDYQDKQLRKELQGTGVSVSREGDGIILNMPGDITFKSGSDDLSSDFYKVLN 61

Query: 98  LIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGF 157
               +LNK+  T++ +   TD+ G+ K NL +S++RA+ + +YL  + V + RF+ V G 
Sbjct: 62  K--KVLNKYDKTIVTVVGFTDNTGSDKTNLALSKKRAESVAAYLQNQKVKTERFV-VDGL 118

Query: 158 AYKYPIDTNDTKVGRQNNQRIEIQIF 183
               PI +N T  GR  N+R+EI + 
Sbjct: 119 GESEPIASNKTAEGRAKNRRVEISLT 144


>gi|104780138|ref|YP_606636.1| OmpA family outer membrane protein [Pseudomonas entomophila L48]
 gi|95109125|emb|CAK13822.1| putative outer membrane protein, OmpA family [Pseudomonas
           entomophila L48]
          Length = 239

 Score =  121 bits (304), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 50/221 (22%), Positives = 88/221 (39%), Gaps = 39/221 (17%)

Query: 2   IKELGLSMFIMTTISGCGLASREKKKVFLHKSND-------------------------- 35
           ++ L +       +SGC   +    +    +S                            
Sbjct: 4   MRRLIIVATAAALMSGCASPNPYDNQGQSQESTGMSKTAKYGGLGALAGAIAGAAIDHNN 63

Query: 36  -----------TDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-V 83
                             +G   DK E E + ++ +TG+ V R GD I   +P +++F  
Sbjct: 64  RGKGALIGAAAVGAAAAGYGYYADKQEAELRAKMANTGVEVQRQGDQIKLIMPGNITFAT 123

Query: 84  SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQ 143
               +   F   L  +A    +F    I +   TDS G+ ++N+ +SQ RA  + +YL  
Sbjct: 124 DSANISPSFYSPLNNLANSFKQFNQNTIEVVGFTDSTGSRQHNMDLSQRRAQAVSTYLTS 183

Query: 144 RGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           +GV ++R ++VRG     PI +N    GR  N+R+E+ + P
Sbjct: 184 QGVDASR-VTVRGMGPDQPIASNADANGRAQNRRVEVNLKP 223


>gi|188036026|pdb|2K1S|A Chain A, Solution Nmr Structure Of The Folded C-Terminal Fragment
           Of Yiad From Escherichia Coli. Northeast Structural
           Genomics Consortium Target Er553
          Length = 149

 Score =  121 bits (304), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 47/141 (33%), Positives = 79/141 (56%), Gaps = 2/141 (1%)

Query: 45  SSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEV-FLEKKFLPMLQLIATIL 103
             +D  E + + +++ TG+ V+R GD I   +P +V+F S    L+      L  +A +L
Sbjct: 1   YYMDVQEAKLRDKMRGTGVSVTRSGDNIILNMPNNVTFDSSSATLKPAGANTLTGVAMVL 60

Query: 104 NKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPI 163
            ++P T + +  +TDS G    N+ +SQ+RAD + S LI +GV ++R I  +G     PI
Sbjct: 61  KEYPKTAVNVIGYTDSTGGHDLNMRLSQQRADSVASALITQGVDASR-IRTQGLGPANPI 119

Query: 164 DTNDTKVGRQNNQRIEIQIFP 184
            +N T  G+  N+R+EI + P
Sbjct: 120 ASNSTAEGKAQNRRVEITLSP 140


>gi|255264641|ref|ZP_05343983.1| inner membrane lipoprotein YiaD [Thalassiobium sp. R2A62]
 gi|255106976|gb|EET49650.1| inner membrane lipoprotein YiaD [Thalassiobium sp. R2A62]
          Length = 223

 Score =  121 bits (304), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 45/216 (20%), Positives = 79/216 (36%), Gaps = 34/216 (15%)

Query: 1   MIKELGLSMFIMTTISGCGL------ASREKKKVFLHKSNDTDIVN-------------- 40
           M     L++  +  ++ C         +R  ++  L  +     V               
Sbjct: 9   MKTPAALALTGVLALTACETIQDPNNPNRNTQQGALIGAATGIAVGILAGDDPEERRRGA 68

Query: 41  -----------KRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFL 88
                         G  LD+ E   +  L    + ++  G  +   +P  + F      L
Sbjct: 69  LLGAVVGGGGGALIGQRLDQQEVALRQSL-GGNVGITNTGSELIVSLPQDILFATDSSTL 127

Query: 89  EKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSS 148
                  L  +A  LN++P+T + +  HTD++G    N  +S  RA  + + ++     S
Sbjct: 128 TGGLQSDLNALANNLNQYPNTTVNVIGHTDNVGDAGYNDGLSTRRATAVAN-VLLNAGVS 186

Query: 149 NRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           +  I+  G     PI TN T  GR  N+R+EI I P
Sbjct: 187 SGRINAFGRGEAQPIATNLTDEGRAQNRRVEIVITP 222


>gi|260428759|ref|ZP_05782736.1| inner membrane lipoprotein YiaD [Citreicella sp. SE45]
 gi|260419382|gb|EEX12635.1| inner membrane lipoprotein YiaD [Citreicella sp. SE45]
          Length = 221

 Score =  121 bits (304), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 54/222 (24%), Positives = 86/222 (38%), Gaps = 39/222 (17%)

Query: 1   MIK---ELGLSMFIMTTISGCGLASR---------------------------------E 24
           MI+    + +S+     ++ CG                                     +
Sbjct: 1   MIRARTSIFVSLAAAMALTACGEGQTFGEGNPNRNTNSGVLLGALGGAAAGRIIGGNNDD 60

Query: 25  KKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV- 83
             K  L  +    I     G+ LDK E E + QL    + ++  GD +   +P  + F  
Sbjct: 61  STKNALAGAAVGAIAGGLIGNQLDKQEAELRQQL-GNNVSINNTGDRLVVTMPQDILFPF 119

Query: 84  SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQ 143
               L       ++ +   L ++P+T + +  HTDS G    N  +S  RA  + S LI 
Sbjct: 120 DSAALRSDLQADIRTVGRSLLQYPNTTVQVLGHTDSDGDAAYNQKLSLRRAQAVSSVLIA 179

Query: 144 RGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPR 185
            GV S+R  S+ G     PI +N T  G+Q N+R+EI I P 
Sbjct: 180 EGVPSSRIQSI-GRGEDQPIASNLTAEGKQQNRRVEIVILPN 220


>gi|163749262|ref|ZP_02156511.1| OmpA family protein [Shewanella benthica KT99]
 gi|161330981|gb|EDQ01907.1| OmpA family protein [Shewanella benthica KT99]
          Length = 220

 Score =  121 bits (304), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 53/167 (31%), Positives = 82/167 (49%), Gaps = 2/167 (1%)

Query: 19  GLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPV 78
             +  ++ K  L  +     +    G  +D  E E + QLQ TG+ V+R GD I   +P 
Sbjct: 53  SSSKSDRGKGALIGAASGAALGGGIGYYMDVQEAELRKQLQSTGVSVTRSGDNIVLNMPN 112

Query: 79  HVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVI 137
            V+F V EV L      +L  +A +  ++  T + I  +TDS G+   NL +S+ RA  +
Sbjct: 113 EVTFGVDEVHLNPGAKKVLNSVALVAKEYDQTQLNILGYTDSSGSESYNLRLSKIRAIEV 172

Query: 138 KSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
            +YL+ + V   R  S  G     PI +N T  GR  N+R+EI + P
Sbjct: 173 GNYLVGQNVEYARVKS-EGIGEARPISSNTTAAGRAQNRRVEIILSP 218


>gi|260574860|ref|ZP_05842862.1| OmpA/MotB domain protein [Rhodobacter sp. SW2]
 gi|259022865|gb|EEW26159.1| OmpA/MotB domain protein [Rhodobacter sp. SW2]
          Length = 218

 Score =  121 bits (303), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 44/180 (24%), Positives = 79/180 (43%), Gaps = 3/180 (1%)

Query: 6   GLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVV 65
            ++  ++    G     R +    L  +    +V    G++LD+   + + Q+ ++ + V
Sbjct: 38  AVAGALIGGTLGATQHGRNRFGNALLGATLGGLVGGAIGNTLDQQAADLRSQMSNSTM-V 96

Query: 66  SRIGDMITCYIPVHVSFV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLK 124
           +  G+ +   +P  + F      L       L+ ++  L  +P + I +  HTD  G+  
Sbjct: 97  TNTGNSLVVTMPQDILFALDSANLRPDLQADLRAVSNNLLDYPDSTIEVVGHTDDSGSAA 156

Query: 125 NNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
            N  +S+ RA  + + L   GV   R IS  G     PI +N T  GR  N+R+EI I P
Sbjct: 157 YNQDLSERRARAVAAVLRNGGVPGGR-ISAYGRGEDQPIASNQTVNGRAQNRRVEIIIHP 215


>gi|85858041|ref|YP_460243.1| outer membrane OmpA family protein [Syntrophus aciditrophicus SB]
 gi|85721132|gb|ABC76075.1| outer membrane OmpA family protein [Syntrophus aciditrophicus SB]
          Length = 223

 Score =  121 bits (303), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 47/221 (21%), Positives = 93/221 (42%), Gaps = 35/221 (15%)

Query: 2   IKELGLSMFIMTTISGCGLASREKKKV------FLHKSNDTDIVNKRFGSS--------- 46
           +K +   +  +  ++GC     + K            +    ++ +  G S         
Sbjct: 3   MKRIS-VLLCLLFLAGCAAPQTQTKTTKGGLYGAAGGAAAGALIGQVIGRSTSGTLIGAA 61

Query: 47  ----------------LDKAEDEFQMQLQ-DTGIVVSRIGDMITCYIPVHVSFV-SEVFL 88
                           +D  E + +  L       VSR G+++       V+F  +   +
Sbjct: 62  IGAAVGGAGGAAVGKMMDNQERDMRNVLATSDAAAVSREGNLLAVTFKGDVTFDTNSAEV 121

Query: 89  EKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSS 148
                  +  +A ++ ++P T+I ++ HTDS+G+   N+ +S  RA+ +   L+ +   +
Sbjct: 122 RPGLYSEINRVAGVMTQYPETLIRVEGHTDSVGSDAYNMDLSTRRANAV-KTLLVQRGVA 180

Query: 149 NRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGNIK 189
           +  I V G+    PI TNDT+ GRQ N+R+EI+I P+   +
Sbjct: 181 DSRIEVVGYGETMPIATNDTEAGRQKNRRVEIKIAPQTQAQ 221


>gi|212633550|ref|YP_002310075.1| OmpA protein [Shewanella piezotolerans WP3]
 gi|212555034|gb|ACJ27488.1| OmpA [Shewanella piezotolerans WP3]
          Length = 222

 Score =  121 bits (303), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 53/167 (31%), Positives = 86/167 (51%), Gaps = 2/167 (1%)

Query: 19  GLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPV 78
             +  ++ K  L  +     +    G  +D  E E + QLQ +G+ V+R GD I   +P 
Sbjct: 55  SSSKSDRGKGALIGAASGAALGGGIGYYMDVQEAELRKQLQSSGVSVTRSGDTIILNMPN 114

Query: 79  HVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVI 137
            V+F V +  L ++   +L  +A +  ++  T + +  HTDS G    N+ +SQ RA  +
Sbjct: 115 DVTFGVDQTDLSQRAKQVLNSVALVALEYDETKLNVMGHTDSSGAASYNMRLSQVRASEV 174

Query: 138 KSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
            SYL+ R V S R +S  G     P+ +N+TK GR  N+R+EI + P
Sbjct: 175 ASYLMSRKVPSARVVS-HGVGEDRPVASNETKAGRAENRRVEIILSP 220


>gi|261380477|ref|ZP_05985050.1| OmpA family protein [Neisseria subflava NJ9703]
 gi|284796724|gb|EFC52071.1| OmpA family protein [Neisseria subflava NJ9703]
          Length = 226

 Score =  120 bits (302), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 49/182 (26%), Positives = 79/182 (43%), Gaps = 2/182 (1%)

Query: 4   ELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGI 63
           +  +       + G   A     K   + +     V    G  +D  E + +  L +T I
Sbjct: 34  KTAMYGLGGAAVCGIVGALTHGGKGARNSALACGAVGAGIGGYMDYQEKKLRQSLANTNI 93

Query: 64  VVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGT 122
            V R G+ I   +P +V+F      L       L   A  L ++P T + I  HTD+ G 
Sbjct: 94  EVERQGNQIKLVMPENVTFATGSAALSGHAQSALSAAAQTLVQYPDTTLTINGHTDNTGN 153

Query: 123 LKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
              N  +S+ RA+ + ++L  R   S+  +S  G+  + PI +N T  GR  N+R+EI I
Sbjct: 154 DAINEPLSRNRAESVATFLQSR-GVSSTRLSTFGYGSRQPIASNATVEGRAQNRRVEILI 212

Query: 183 FP 184
            P
Sbjct: 213 NP 214


>gi|77919760|ref|YP_357575.1| outer membrane protein [Pelobacter carbinolicus DSM 2380]
 gi|77545843|gb|ABA89405.1| outer membrane protein [Pelobacter carbinolicus DSM 2380]
          Length = 224

 Score =  120 bits (301), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 50/218 (22%), Positives = 89/218 (40%), Gaps = 32/218 (14%)

Query: 1   MIKELGLSMFIMTTISGCGLASREKKKVFLHKSNDTD----------------------- 37
           M + L +   +    +GC       +K     +                           
Sbjct: 1   MKRFLTVVAVLSLVAAGCSQPMTRTQKGTAIGAGAGAAVGAGLGQLIGGDTEGTLIGAGI 60

Query: 38  ------IVNKRFGSSLDKAEDEFQMQLQD-TGIVVSRIGDMITCYIPVHVSFV-SEVFLE 89
                  V   + + ++K E   + QL    G  + R  +++       V F  +   ++
Sbjct: 61  GAALGGTVGGFYANYMEKQEQAMRQQLAGVEGASIQRDAEVLAVTFKSDVLFDVNSYSVK 120

Query: 90  KKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSN 149
                 LQ +A +LN +P T I I  HTDS G+ + N+ +S++RA+ +K+ L+  GV+  
Sbjct: 121 SGGYDELQRVAGVLNNYPQTSIQIAGHTDSTGSEQYNMQLSRQRAEAVKNVLVGYGVAPA 180

Query: 150 RFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGN 187
           R ++V G+    PI +N  + GRQ N+R+ I I P   
Sbjct: 181 RLMTV-GYGESKPIASNANEAGRQINRRVAITITPNQQ 217


>gi|299771293|ref|YP_003733319.1| Inner membrane lipoprotein yiaD precursor [Acinetobacter sp. DR1]
 gi|298701381|gb|ADI91946.1| Inner membrane lipoprotein yiaD precursor [Acinetobacter sp. DR1]
          Length = 217

 Score =  120 bits (301), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 48/180 (26%), Positives = 87/180 (48%), Gaps = 3/180 (1%)

Query: 8   SMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSR 67
           ++       G   +S    +     +    ++    G  LD+ E + + Q+  TG+ V R
Sbjct: 38  TLIGAAAGYGISKSSANSSRQNNRAAAIGAVLGGASGLYLDQKEKKLRQQMAGTGVDVGR 97

Query: 68  IGDM-ITCYIPVHVSFVS-EVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKN 125
             D  +   +P  ++F + +  ++  F   L  +A  L +   + I +  +TD+ G    
Sbjct: 98  NPDGSVQLIMPGSITFDTNKSNIKPNFYSTLNKVAQTLAEDNKSAILVTGYTDNTGNDSI 157

Query: 126 NLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPR 185
           N+ +SQ RA  ++SYL  +GVS++R I  +GF    PI  N T  GR+ N+R+EI I+ +
Sbjct: 158 NIPLSQARAQSVRSYLASQGVSASR-IDAQGFGSSNPIADNSTATGREQNRRVEISIYAK 216


>gi|237748606|ref|ZP_04579086.1| OmpA/MotB domain-containing protein [Oxalobacter formigenes OXCC13]
 gi|229379968|gb|EEO30059.1| OmpA/MotB domain-containing protein [Oxalobacter formigenes OXCC13]
          Length = 217

 Score =  120 bits (301), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 52/214 (24%), Positives = 88/214 (41%), Gaps = 33/214 (15%)

Query: 1   MIKELGL-SMFIMTTISGCGLASREKKKVFL-----------------HKSNDTDIVNKR 42
           M  +L   ++     ++GC   + ++K                             V   
Sbjct: 1   MRTKLTACALIAAIAVTGCANMTEKQKTTTTGAGIGAVAGAAIGALTGPGGWGRAAVGAA 60

Query: 43  FG------------SSLDKAEDEFQMQLQDTGIVVSRIGDM-ITCYIPVHVSF-VSEVFL 88
            G            + ++K + E Q   Q TG+ V +  +  I   IP  VSF      L
Sbjct: 61  IGGLLGGGGGYLWGNHMEKQKQEMQAATQGTGVEVVQTENNMIRVSIPSDVSFATGSSTL 120

Query: 89  EKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSS 148
             +F  +L+ +AT L   PS+ I +  +TD+ G+   NL +S++RA  +  YL+ +   +
Sbjct: 121 SPQFKTILRDLATTLKNNPSSSIFVVGYTDNTGSDSVNLPLSRKRAMSVMEYLVSQ-GVA 179

Query: 149 NRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
               +V G   K PI +N T  GR  N+R+EI +
Sbjct: 180 ANRFTVEGMGSKDPIASNATAEGRAQNRRVEIYV 213


>gi|87201185|ref|YP_498442.1| OmpA/MotB [Novosphingobium aromaticivorans DSM 12444]
 gi|87136866|gb|ABD27608.1| OmpA/MotB [Novosphingobium aromaticivorans DSM 12444]
          Length = 230

 Score =  120 bits (301), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 50/140 (35%), Positives = 75/140 (53%), Gaps = 4/140 (2%)

Query: 48  DKAEDEFQMQLQDTGIVVSRIGDM--ITCYIPVHVSFV-SEVFLEKKFLPMLQLIATILN 104
           DK   E + Q   TG+ V+   +   I   +P  V+F      ++  F   L  +A  L 
Sbjct: 79  DKQIRELREQTAGTGVDVTETDNGQAILVNLPNGVTFDVDSSTVKPAFATTLDRVAQSLV 138

Query: 105 KFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPID 164
           ++P+++I +  HTDS G+   N  +S+ RA  +  YLI RGV   R I  +GF    PI 
Sbjct: 139 QYPNSLIDVYGHTDSTGSDAYNQALSERRARAVADYLISRGVGYAR-IRSQGFGESQPIA 197

Query: 165 TNDTKVGRQNNQRIEIQIFP 184
           +NDT+ GRQ N+R+EI+I P
Sbjct: 198 SNDTEQGRQANRRVEIKIVP 217


>gi|326319363|ref|YP_004237035.1| OmpA/MotB domain-containing protein [Acidovorax avenae subsp.
           avenae ATCC 19860]
 gi|323376199|gb|ADX48468.1| OmpA/MotB domain protein [Acidovorax avenae subsp. avenae ATCC
           19860]
          Length = 217

 Score =  120 bits (301), Expect = 9e-26,   Method: Composition-based stats.
 Identities = 53/207 (25%), Positives = 84/207 (40%), Gaps = 28/207 (13%)

Query: 3   KELGLSMFIMTTISGCGL-------------------------ASREKKKVFLHKSNDTD 37
           + L  +   +   SGC                                    L  +    
Sbjct: 5   RTLIAATAAVLLASGCANMTDTQRRTATGAGVGAAGGAVLGAVTGGNAGTGALIGAGVGA 64

Query: 38  IVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDM-ITCYIPVHVSFVSE-VFLEKKFLPM 95
           +    +   +++ + E Q   Q TG+VV++  D  +   IP  +SF +    ++  F P+
Sbjct: 65  LGTYIWSQHMERQKQEMQQVTQGTGVVVTQTQDNQLKLDIPSDISFATNRSDIQPNFAPV 124

Query: 96  LQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVR 155
           L   A  L   P+  + I  +TDS G    N  +S +RA   ++YL  RGVS  R I V 
Sbjct: 125 LDRFAEGLRNNPNAEVRIVGYTDSTGNDSINNPLSLDRATSTRNYLTSRGVSGAR-IQVE 183

Query: 156 GFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           G   + P+ TNDT  GR  N+R+EI +
Sbjct: 184 GRGAREPVATNDTAEGRARNRRVEIYV 210


>gi|152986735|ref|YP_001350031.1| hypothetical protein PSPA7_4687 [Pseudomonas aeruginosa PA7]
 gi|150961893|gb|ABR83918.1| lipoprotein, putative [Pseudomonas aeruginosa PA7]
          Length = 237

 Score =  120 bits (301), Expect = 9e-26,   Method: Composition-based stats.
 Identities = 49/163 (30%), Positives = 78/163 (47%), Gaps = 2/163 (1%)

Query: 23  REKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF 82
             + K  L  +         +G   DK E E + Q++ TG+ V R GD I   +P +++F
Sbjct: 62  NNRGKGALIGAAVAGAAAAGYGYYADKQEAELRRQMEGTGVEVQRQGDDIKLIMPGNITF 121

Query: 83  -VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYL 141
                 +   F   L  +A    ++    I I  +TDS G+ ++N+ +SQ RA  +  YL
Sbjct: 122 ATDSANIAPSFYAPLNNLANSFKQYNQNTIEIVGYTDSTGSRQHNMDLSQRRAQSVAGYL 181

Query: 142 IQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
             +GV   R +S RG     PI +N T  GR  N+R+E+ + P
Sbjct: 182 TAQGVDGTR-LSTRGMGPDQPIASNSTADGRAQNRRVEVNLRP 223


>gi|294139179|ref|YP_003555157.1| OmpA family protein [Shewanella violacea DSS12]
 gi|6141577|dbj|BAA85891.1| unnamed protein product [Shewanella violacea]
 gi|293325648|dbj|BAJ00379.1| OmpA family protein [Shewanella violacea DSS12]
          Length = 220

 Score =  120 bits (301), Expect = 9e-26,   Method: Composition-based stats.
 Identities = 58/219 (26%), Positives = 94/219 (42%), Gaps = 37/219 (16%)

Query: 2   IKELGLSMFIM---TTISGC--------------------------------GLASREKK 26
           + +L LS+ ++     ++GC                                  +  ++ 
Sbjct: 1   MNKLVLSVAVLATSILVAGCQTTNPYTNEGQNAKATNGTIIGAIAGAAIGVASSSKSDRG 60

Query: 27  KVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSE 85
           K  L  +     +    G  +D  E E + QL+ TG+ V+R GD I   +P  V+F V E
Sbjct: 61  KGALIGAASGAALGGGIGYYMDVQEAELRKQLRSTGVSVTRSGDNIVLNMPNEVTFGVDE 120

Query: 86  VFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRG 145
           V L      +L  +A +  ++ +T I I  +TDS G+   NL +S+ RA  +  YLI + 
Sbjct: 121 VHLNPGAKNVLNSVALVAKEYDNTQINILGYTDSSGSESYNLRLSKVRAVEVADYLISQK 180

Query: 146 VSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           V   R +   G     PI +N T  GR  N+R+EI + P
Sbjct: 181 VEYAR-VRSEGIGEARPIASNSTAQGRTQNRRVEIILSP 218


>gi|296390816|ref|ZP_06880291.1| hypothetical protein PaerPAb_21793 [Pseudomonas aeruginosa PAb1]
          Length = 237

 Score =  120 bits (301), Expect = 9e-26,   Method: Composition-based stats.
 Identities = 49/163 (30%), Positives = 78/163 (47%), Gaps = 2/163 (1%)

Query: 23  REKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF 82
             + K  L  +         +G   DK E E + Q++ TG+ V R GD I   +P +++F
Sbjct: 62  NNRGKGALIGAAVAGGAAAGYGYYADKQEAELRRQMEGTGVEVQRQGDDIKLIMPGNITF 121

Query: 83  -VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYL 141
                 +   F   L  +A    ++    I I  +TDS G+ ++N+ +SQ RA  +  YL
Sbjct: 122 ATDSANIAPSFYAPLNNLANSFKQYNQNTIEIVGYTDSTGSRQHNMDLSQRRAQSVAGYL 181

Query: 142 IQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
             +GV   R +S RG     PI +N T  GR  N+R+E+ + P
Sbjct: 182 TAQGVDGTR-LSTRGMGPDQPIASNSTADGRAQNRRVEVNLRP 223


>gi|15596030|ref|NP_249524.1| hypothetical protein PA0833 [Pseudomonas aeruginosa PAO1]
 gi|107100290|ref|ZP_01364208.1| hypothetical protein PaerPA_01001315 [Pseudomonas aeruginosa PACS2]
 gi|116048755|ref|YP_792445.1| hypothetical protein PA14_53500 [Pseudomonas aeruginosa UCBPP-PA14]
 gi|254239185|ref|ZP_04932508.1| hypothetical protein PACG_05376 [Pseudomonas aeruginosa C3719]
 gi|254245120|ref|ZP_04938442.1| hypothetical protein PA2G_06007 [Pseudomonas aeruginosa 2192]
 gi|313105709|ref|ZP_07791972.1| hypothetical protein PA39016_000110006 [Pseudomonas aeruginosa
           39016]
 gi|9946728|gb|AAG04222.1|AE004518_3 hypothetical protein PA0833 [Pseudomonas aeruginosa PAO1]
 gi|115583976|gb|ABJ09991.1| hypothetical protein PA14_53500 [Pseudomonas aeruginosa UCBPP-PA14]
 gi|126171116|gb|EAZ56627.1| hypothetical protein PACG_05376 [Pseudomonas aeruginosa C3719]
 gi|126198498|gb|EAZ62561.1| hypothetical protein PA2G_06007 [Pseudomonas aeruginosa 2192]
 gi|310878474|gb|EFQ37068.1| hypothetical protein PA39016_000110006 [Pseudomonas aeruginosa
           39016]
          Length = 237

 Score =  120 bits (301), Expect = 9e-26,   Method: Composition-based stats.
 Identities = 49/163 (30%), Positives = 78/163 (47%), Gaps = 2/163 (1%)

Query: 23  REKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF 82
             + K  L  +         +G   DK E E + Q++ TG+ V R GD I   +P +++F
Sbjct: 62  NNRGKGALIGAAVAGAAAAGYGYYADKQEAELRRQMEGTGVEVQRQGDDIKLIMPGNITF 121

Query: 83  -VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYL 141
                 +   F   L  +A    ++    I I  +TDS G+ ++N+ +SQ RA  +  YL
Sbjct: 122 ATDSANIAPSFYAPLNNLANSFKQYNQNTIEIVGYTDSTGSRQHNMDLSQRRAQSVAGYL 181

Query: 142 IQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
             +GV   R +S RG     PI +N T  GR  N+R+E+ + P
Sbjct: 182 TAQGVDGTR-LSTRGMGPDQPIASNSTADGRAQNRRVEVNLRP 223


>gi|193212466|ref|YP_001998419.1| OmpA/MotB domain-containing protein [Chlorobaculum parvum NCIB
           8327]
 gi|193085943|gb|ACF11219.1| OmpA/MotB domain protein [Chlorobaculum parvum NCIB 8327]
          Length = 232

 Score =  120 bits (301), Expect = 9e-26,   Method: Composition-based stats.
 Identities = 42/203 (20%), Positives = 88/203 (43%), Gaps = 30/203 (14%)

Query: 14  TISGCGLASREKKKVFLHKSNDTDIVNKRFGS-------------------------SLD 48
             +GC   +    +     +    ++    GS                          +D
Sbjct: 25  VTTGCQSTTNA-GRGAGIGATSGAVIGGIIGSRSGSWAQGALIGAAIGGAGGAIIGDYMD 83

Query: 49  KAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKFP 107
           K  +E + ++      V R+G+ I       + F  +   L       ++ +A +LN++P
Sbjct: 84  KQAEEIRQEV--GNADVERVGEGIRVVFDTGLLFSTNSSTLNPNSRYNIENLARVLNRYP 141

Query: 108 STVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTND 167
            T + ++ HTDSIG+   N ++S+ RA+ + S L++        ++  G+    P+ TN+
Sbjct: 142 DTNVVVEGHTDSIGSEATNQVLSERRAESVVS-LLRAYGVYGNRLTAVGYGETRPVATNE 200

Query: 168 TKVGRQNNQRIEIQIFPRGNIKK 190
           T++GR+ N+R+E+ I+    +K+
Sbjct: 201 TEMGRRQNRRVEVLIYANNELKR 223


>gi|120600257|ref|YP_964831.1| OmpA/MotB domain-containing protein [Shewanella sp. W3-18-1]
 gi|146291813|ref|YP_001182237.1| OmpA/MotB domain-containing protein [Shewanella putrefaciens CN-32]
 gi|120560350|gb|ABM26277.1| OmpA/MotB domain protein [Shewanella sp. W3-18-1]
 gi|145563503|gb|ABP74438.1| OmpA/MotB domain protein [Shewanella putrefaciens CN-32]
 gi|319425048|gb|ADV53122.1| OmpA/MotB domain protein [Shewanella putrefaciens 200]
          Length = 228

 Score =  120 bits (301), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 53/214 (24%), Positives = 91/214 (42%), Gaps = 34/214 (15%)

Query: 6   GLSMFIMTTISGCGLA--------------------------------SREKKKVFLHKS 33
             ++     +SGC                                     ++ K  L  +
Sbjct: 16  FAAIIGTFVVSGCSTVNPYTNEQQTAKATSGAIIGAVAGAAVGVASSSKSDRGKGALIGA 75

Query: 34  NDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKF 92
                V    G  +D  E + + QL  TG+ V+R GD I   +P  V+F V +  L    
Sbjct: 76  ASGAAVGGGIGYYMDVQETKLRQQLASTGVSVTRNGDNIILNMPNEVTFGVDQTELSDGA 135

Query: 93  LPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFI 152
             +L  +A +  ++  T + +  +TDS G+   NL +SQ RA  + +YL+ +G++++R  
Sbjct: 136 SRVLNSVALVAKEYSKTQLNVLGYTDSSGSDAYNLRLSQVRASEVANYLMSKGIAASRVK 195

Query: 153 SVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRG 186
           S +G     PI +N +  GR  N+R+EI + P G
Sbjct: 196 S-KGMGKASPIASNASAEGRAQNRRVEIVLTPTG 228


>gi|332828413|gb|EGK01122.1| hypothetical protein HMPREF9455_02644 [Dysgonomonas gadei ATCC
           BAA-286]
          Length = 224

 Score =  120 bits (301), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 45/154 (29%), Positives = 69/154 (44%), Gaps = 3/154 (1%)

Query: 38  IVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPML 96
                 G+ +DK + E   Q+    +     G  I       + F  +   L       L
Sbjct: 67  TAGAVIGNKMDKQKKEL-EQINGAQVESINDGQAIKVTFESGILFATNSSTLNSASQSAL 125

Query: 97  QLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRG 156
              AT LN  P T + I  HTD+ G+   N  +S++RA  + ++L  +GVS +R +S +G
Sbjct: 126 TSFATSLNNNPDTDVQIYGHTDNTGSDAINNPLSEKRAQSVYNFLQTKGVSGSRMVS-QG 184

Query: 157 FAYKYPIDTNDTKVGRQNNQRIEIQIFPRGNIKK 190
           F    P+  N T  GR  N+R+EI I P   + K
Sbjct: 185 FGSTQPVADNSTVAGRSQNRRVEIYILPNEKMIK 218


>gi|325121211|gb|ADY80734.1| OmpA domain protein [Acinetobacter calcoaceticus PHEA-2]
          Length = 217

 Score =  120 bits (301), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 46/180 (25%), Positives = 87/180 (48%), Gaps = 3/180 (1%)

Query: 8   SMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSR 67
           ++       G   ++    +     +    ++    G  LD+ E + + Q+  TG+ V R
Sbjct: 38  TLIGAAAGYGISKSNANSSRQNNRAAAIGAVLGAAGGVYLDQKEKKLRQQMAGTGVDVGR 97

Query: 68  IGDM-ITCYIPVHVSFVS-EVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKN 125
             D  +   +P  ++F + +  ++  F   L  +A  L +   + I +  +TD+ G    
Sbjct: 98  NPDGSVQLIMPGSITFDTNKSNIKPNFYATLNKVAQTLAEDNKSAILVTGYTDNTGNDSI 157

Query: 126 NLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPR 185
           N+ +SQ RA  ++SYL  +GVS++R I  +G+    PI  N T  GR+ N+R+EI I+ +
Sbjct: 158 NIPLSQARAQSVRSYLASQGVSASR-IDAQGYGSSNPIADNSTASGREQNRRVEISIYAK 216


>gi|319638563|ref|ZP_07993325.1| hypothetical protein HMPREF0604_00949 [Neisseria mucosa C102]
 gi|317400312|gb|EFV80971.1| hypothetical protein HMPREF0604_00949 [Neisseria mucosa C102]
          Length = 226

 Score =  120 bits (301), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 49/182 (26%), Positives = 80/182 (43%), Gaps = 2/182 (1%)

Query: 4   ELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGI 63
           +  +       + G   A     K   + +     V    G  +D  E + +  L +T I
Sbjct: 34  KTAMYGLGGAAVCGIVGALTHGGKGARNSALACGAVGAGIGGYMDYQEKKLRQSLANTNI 93

Query: 64  VVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGT 122
            V R G+ I   +P +V+F      L  +    L   A  L ++P T + I  HTD+ G 
Sbjct: 94  EVERQGNQIKLVMPENVTFATGSAALSGQAQSALSAAAQTLVQYPDTTLTINGHTDNTGN 153

Query: 123 LKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
              N  +S+ RA+ + ++L  R   S+  +S  G+  + PI +N T  GR  N+R+EI I
Sbjct: 154 DAINEPLSRNRAESVATFLQSR-GVSSTRLSTFGYGSRQPIASNATVEGRAQNRRVEILI 212

Query: 183 FP 184
            P
Sbjct: 213 NP 214


>gi|116327052|ref|YP_796772.1| OmpA-family protein [Leptospira borgpetersenii serovar Hardjo-bovis
           L550]
 gi|116332289|ref|YP_802007.1| OmpA-family protein [Leptospira borgpetersenii serovar Hardjo-bovis
           JB197]
 gi|116119796|gb|ABJ77839.1| OmpA-family protein [Leptospira borgpetersenii serovar Hardjo-bovis
           L550]
 gi|116125978|gb|ABJ77249.1| OmpA-family protein [Leptospira borgpetersenii serovar Hardjo-bovis
           JB197]
          Length = 458

 Score =  120 bits (301), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 35/159 (22%), Positives = 69/159 (43%), Gaps = 3/159 (1%)

Query: 28  VFLHKSNDTDIVNKRFGSSLDKAEDEFQMQ---LQDTGIVVSRIGDMITCYIPVHVSFVS 84
               +   +    +   S  ++ E++ + +   +  + + + R  + I   +   +   +
Sbjct: 298 ESGSEQKKSSNPPRETLSWPEEEENKTKQETMKVSGSPVEIRRTEEGIAISLNSVLFDYN 357

Query: 85  EVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQR 144
              L+ +    L+ IA++L K+    I I  HTD+ G  + N  +S+ERA  +   L   
Sbjct: 358 SSQLKDEAKLELRRIASVLKKYGDREIRISGHTDNSGGDEYNRKLSRERALSVLKELRDE 417

Query: 145 GVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
                + +S  G+    PI  N T  GRQ N+R++I I 
Sbjct: 418 QGLEEKRMSYEGYGKSKPIADNSTAQGRQKNRRVDITIV 456


>gi|49081952|gb|AAT50376.1| PA0833 [synthetic construct]
          Length = 238

 Score =  120 bits (300), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 49/163 (30%), Positives = 78/163 (47%), Gaps = 2/163 (1%)

Query: 23  REKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF 82
             + K  L  +         +G   DK E E + Q++ TG+ V R GD I   +P +++F
Sbjct: 62  NNRGKGALIGAAVAGAAAAGYGHYADKQEAELRRQMEGTGVEVQRQGDDIKLIMPGNITF 121

Query: 83  -VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYL 141
                 +   F   L  +A    ++    I I  +TDS G+ ++N+ +SQ RA  +  YL
Sbjct: 122 ATDSANIAPSFYAPLNNLANSFKQYNQNTIEIVGYTDSTGSRQHNMDLSQRRAQSVAGYL 181

Query: 142 IQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
             +GV   R +S RG     PI +N T  GR  N+R+E+ + P
Sbjct: 182 TAQGVDGTR-LSTRGMGPDQPIASNSTADGRAQNRRVEVNLRP 223


>gi|148653943|ref|YP_001281036.1| OmpA/MotB domain-containing protein [Psychrobacter sp. PRwf-1]
 gi|148573027|gb|ABQ95086.1| OmpA/MotB domain protein [Psychrobacter sp. PRwf-1]
          Length = 218

 Score =  120 bits (300), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 45/218 (20%), Positives = 89/218 (40%), Gaps = 31/218 (14%)

Query: 1   MIKELGL-SMFIMTTISGCGLASREKKKVFLHK--------------------------S 33
           M  +L + ++     ++GC       ++                               +
Sbjct: 1   MKNKLMIGALASTLALAGCATDPATGQQSINKGVLGALGGAAAGAGISKVTGGEKIGRDA 60

Query: 34  NDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGD--MITCYIPVHVSF-VSEVFLEK 90
                +    G  ++  E + + Q+  TG+ V+R  +   I   +P +++F      +  
Sbjct: 61  AIGAALGGAVGLYMENQEKQLKQQMAGTGVEVNRNPNTGNIDLVMPGNITFAHDSTNING 120

Query: 91  KFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNR 150
            F   L  +A+ + ++  T + +  HTDS+G    N  +S+ RA  + SYLI +   S+ 
Sbjct: 121 SFYNTLDKLASTMVQYGDTTVNVMGHTDSVGNPSYNQGLSERRAQAVASYLI-QRGVSSN 179

Query: 151 FISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGNI 188
            I   G+    P+ +N T+ GR  N+R+EIQI    ++
Sbjct: 180 RIRTMGYGQNQPVASNSTESGRLQNRRVEIQIVAPQSV 217


>gi|45656490|ref|YP_000576.1| peptidoglycan-associated cytoplasmic membrane protein [Leptospira
           interrogans serovar Copenhageni str. Fiocruz L1-130]
 gi|45599725|gb|AAS69213.1| peptidoglycan-associated cytoplasmic membrane protein [Leptospira
           interrogans serovar Copenhageni str. Fiocruz L1-130]
          Length = 475

 Score =  120 bits (300), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 35/133 (26%), Positives = 63/133 (47%)

Query: 51  EDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTV 110
           E++ Q   + + + + R  + I   +   +   +   L+++    L+ IA++L K+    
Sbjct: 341 EEDNQAAPEGSPVEIRRTEEGIAISLNSVLFDHNSSELKQEAKLELKRIASVLKKYADRE 400

Query: 111 IAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKV 170
           I I  HTD+ G  + N  +S+ERA  +   L        + +S  G+    PI  N T  
Sbjct: 401 IRISGHTDNSGGEEYNRKLSRERALSVLKELRDEQGLEEKRMSYEGYGKSKPIADNSTIQ 460

Query: 171 GRQNNQRIEIQIF 183
           GRQ N+R++I I 
Sbjct: 461 GRQKNRRVDITIV 473


>gi|329888485|ref|ZP_08267083.1| inner membrane lipoprotein yiaD [Brevundimonas diminuta ATCC 11568]
 gi|328847041|gb|EGF96603.1| inner membrane lipoprotein yiaD [Brevundimonas diminuta ATCC 11568]
          Length = 224

 Score =  119 bits (299), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 51/166 (30%), Positives = 88/166 (53%), Gaps = 2/166 (1%)

Query: 20  LASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVH 79
            +  + +K  L  +    +     G  +D  +   + +L  TG+ V+R GD +   +P  
Sbjct: 57  SSGEQGRKNALIGAGIGALAGAGVGQYMDGQQRALEAELSGTGVGVARQGDNLVLRMPSD 116

Query: 80  VSFVSE-VFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIK 138
           V+F +    L+ +FLP+L  +A +LN++  +++ +  HTDS G    N  +S+ RA  + 
Sbjct: 117 VTFATNQSDLDPRFLPVLDDVARVLNQYDRSMVDVVGHTDSSGGDAINQPLSERRAASVA 176

Query: 139 SYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           ++LI RGV   R I V G + + PI +N T  G+  N+R+EI I P
Sbjct: 177 AHLINRGVMRER-IYVAGMSARAPIGSNATPEGKAQNRRVEILIRP 221


>gi|257126323|ref|YP_003164437.1| OmpA/MotB domain protein [Leptotrichia buccalis C-1013-b]
 gi|257050262|gb|ACV39446.1| OmpA/MotB domain protein [Leptotrichia buccalis C-1013-b]
          Length = 215

 Score =  119 bits (299), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 48/167 (28%), Positives = 82/167 (49%), Gaps = 3/167 (1%)

Query: 23  REKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDM-ITCYIPVHVS 81
            +  K  L  +     V    G+  D+ E E + +L+ TG+ V R G+  I    P +++
Sbjct: 50  GKDTKGTLIGTAGGAAVGAAIGNIFDRQEKELKDKLKGTGVEVRRTGEGEIKLTAPENIT 109

Query: 82  FV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSY 140
           F  +   ++ +F   L  +AT+L  +P + I +  HTD+ G    N  +S  RA  + SY
Sbjct: 110 FDLNSYVVKPQFRGTLDSVATVLKTYPDSTIIVSGHTDTSGNDAINNPLSVNRAASVASY 169

Query: 141 LIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGN 187
           L  +   ++  ++ RG+  K PI +N T+ GR  N+R+EI I     
Sbjct: 170 LQSQ-GIASSRMTYRGYGSKMPIASNATEAGRAQNRRVEIAIIANQK 215


>gi|300902742|ref|ZP_07120699.1| OmpA family protein [Escherichia coli MS 84-1]
 gi|300405215|gb|EFJ88753.1| OmpA family protein [Escherichia coli MS 84-1]
          Length = 211

 Score =  119 bits (299), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 52/212 (24%), Positives = 90/212 (42%), Gaps = 36/212 (16%)

Query: 1   MIKELGLSMFI---MTTISGCGLASREKKKVF---LHKSNDTDIVNKRFGS--------- 45
           M K + L   +      +SGC       ++        +    +V    G+         
Sbjct: 1   MKKRVYLIAAVVSGALAVSGCTTNPYTGEREAGKSAIGAGLGSLVGAGIGALSSSKKDRG 60

Query: 46  -------------------SLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEV 86
                               +D  E + + +++ TG+ V+R GD I   +P +V+F S  
Sbjct: 61  KGALIGAAAGAALGGGVGYYMDVQEAKLRDKMRGTGVSVTRSGDNIILNMPNNVTFDSSS 120

Query: 87  -FLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRG 145
             L+      L  +A +L ++P T + +  +TDS G    N+ +SQ+RAD + S LI +G
Sbjct: 121 ATLKPAGANTLTGVAMVLKEYPKTAVNVIGYTDSTGGHDLNMRLSQQRADSVASALITQG 180

Query: 146 VSSNRFISVRGFAYKYPIDTNDTKVGRQNNQR 177
           V ++R I  +G     PI +N T  G+  N+R
Sbjct: 181 VDASR-IRTQGLGPANPIASNSTAEGKAQNRR 211


>gi|120613283|ref|YP_972961.1| OmpA/MotB domain-containing protein [Acidovorax citrulli AAC00-1]
 gi|120591747|gb|ABM35187.1| OmpA/MotB domain protein [Acidovorax citrulli AAC00-1]
          Length = 217

 Score =  119 bits (299), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 51/207 (24%), Positives = 84/207 (40%), Gaps = 28/207 (13%)

Query: 3   KELGLSMFIMTTISGCGL-------------------------ASREKKKVFLHKSNDTD 37
           + L  +   +   SGC                                    L  +    
Sbjct: 5   RTLIAATAAVLLASGCANMTDTQRRTATGAGVGAAGGAVLGAVTGGNAGTGALIGAGVGA 64

Query: 38  IVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDM-ITCYIPVHVSFVSE-VFLEKKFLPM 95
           +    +   +++ + E Q   Q TG+VV++  D  +   IP  +SF +    ++  F P+
Sbjct: 65  LGTYIWSQHMERQKQEMQQVTQGTGVVVTQTQDNQLKLDIPSDISFATNRSDIQPNFAPV 124

Query: 96  LQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVR 155
           L   A  L   P+  + I  +TDS G    N  +S +RA   ++YL  RGV+  R + V 
Sbjct: 125 LDRFAEGLRNNPNAEVRIVGYTDSTGNDAINNPLSLDRATSTRNYLTARGVNGAR-VQVE 183

Query: 156 GFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           G   + P+ TNDT  GR  N+R+EI +
Sbjct: 184 GRGAREPVATNDTAEGRARNRRVEIYV 210


>gi|218893200|ref|YP_002442069.1| hypothetical protein PLES_44851 [Pseudomonas aeruginosa LESB58]
 gi|218773428|emb|CAW29240.1| hypothetical protein PLES_44851 [Pseudomonas aeruginosa LESB58]
          Length = 237

 Score =  119 bits (299), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 44/163 (26%), Positives = 74/163 (45%), Gaps = 2/163 (1%)

Query: 23  REKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF 82
             + K  L  +         +G   DK E E + Q++ TG+ V R GD I   +P +++F
Sbjct: 62  NNRGKGALIGAAVAGAAAAGYGYYADKQEAELRRQMEGTGVEVQRQGDDIKLIMPGNITF 121

Query: 83  -VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYL 141
                 +   F   L  +A    ++    I I  +TDS G+ ++N+ +SQ RA  + +  
Sbjct: 122 ATDSANIAPSFYAPLNNLANSFKQYNQNTIEIVGYTDSTGSRQHNMDLSQRRAQSV-AGY 180

Query: 142 IQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           +         +S RG     PI +N T  GR  N+R+E+ + P
Sbjct: 181 LTALGVDGTRLSTRGMGPDQPIASNSTADGRAQNRRVEVNLRP 223


>gi|308048148|ref|YP_003911714.1| OmpA/MotB domain protein [Ferrimonas balearica DSM 9799]
 gi|307630338|gb|ADN74640.1| OmpA/MotB domain protein [Ferrimonas balearica DSM 9799]
          Length = 219

 Score =  119 bits (299), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 50/181 (27%), Positives = 87/181 (48%), Gaps = 2/181 (1%)

Query: 6   GLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVV 65
            +       I     +  ++ K  L  +     V    G  +D+ E   + +L  TG+ V
Sbjct: 39  LIGAVSGALIGAASSSKSDRGKGILIGAASGAAVGGGIGHYMDRQEAALREKLAGTGVSV 98

Query: 66  SRIGDMITCYIPVHVSFV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLK 124
            R GD I   +P  ++F      L+   +  L  +A ++++F  T + I  HTDS G   
Sbjct: 99  KRDGDHIQLVMPNSLTFDVGSDRLKMPAINALSGVAMVVSEFDETNLQITGHTDSTGGRD 158

Query: 125 NNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
            N+ +S+ERA+ + S L+++ +S+ R  S  G     PI +N ++ GR  N+R+EI + P
Sbjct: 159 LNMRLSRERAEAVASELLRQSISATRM-STYGAGPDRPIASNQSEAGRAENRRVEIVLTP 217

Query: 185 R 185
           R
Sbjct: 218 R 218


>gi|167031827|ref|YP_001667058.1| OmpA/MotB domain-containing protein [Pseudomonas putida GB-1]
 gi|166858315|gb|ABY96722.1| OmpA/MotB domain protein [Pseudomonas putida GB-1]
          Length = 240

 Score =  119 bits (299), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 52/221 (23%), Positives = 87/221 (39%), Gaps = 39/221 (17%)

Query: 2   IKELGLSMFIMTTISGCGLASREKKKVFLHKSND-------------------------- 35
           ++ L +       ++GC   +    +     S                            
Sbjct: 4   MRRLIIVATAAALMTGCASQNPYDNQGQAQGSTGMSKTAKYGGLGALAGAIAGAAIDHNN 63

Query: 36  -----------TDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-V 83
                             +G   DK E E + Q+ +TG+ V R GD I   +P +++F  
Sbjct: 64  RGKGALIGAAAVGAAAAGYGYYADKQEAELRAQMANTGVEVQRQGDQIKLIMPGNITFAT 123

Query: 84  SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQ 143
               +   F   L  +A    +F    I +   TDS G+ ++N+ +SQ RA  + +YL  
Sbjct: 124 DSANIAPSFYSPLNNLAGSFKQFNQNTIEVVGFTDSTGSRQHNMDLSQRRAQAVSTYLTS 183

Query: 144 RGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           +GV ++R ISVRG     PI +N    GR  N+R+E+ + P
Sbjct: 184 QGVDASR-ISVRGMGPDQPIASNADANGRAQNRRVEVNLKP 223


>gi|304321111|ref|YP_003854754.1| hypothetical protein PB2503_07784 [Parvularcula bermudensis
           HTCC2503]
 gi|303300013|gb|ADM09612.1| hypothetical protein PB2503_07784 [Parvularcula bermudensis
           HTCC2503]
          Length = 231

 Score =  119 bits (299), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 51/200 (25%), Positives = 93/200 (46%), Gaps = 29/200 (14%)

Query: 13  TTISGCGLASREKKKVFLHKS-----------NDTDIVNKRF----------------GS 45
             ISGC       ++   + +               I                     G+
Sbjct: 30  LVISGCTTDPYTGEEKVSNTARGAGLGALAGGVIGAIAGDDEAALAGAAAGAALGGGIGA 89

Query: 46  SLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILN 104
            +D+ E E + +L  TG+ V R+G+ I   +P +++F   +  +  +F   L  +A ++ 
Sbjct: 90  YMDRQEQELRRELASTGVRVQRVGNDIRLIMPGNITFATGQASVRPEFYATLNSVAKVIE 149

Query: 105 KFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPID 164
           ++  T + ++ HTDS+GT  +N+ +S  RA+ + +YL  +GV+  R I   G+    P+ 
Sbjct: 150 RYQQTAVLVEGHTDSVGTEDSNVQLSIARAESVGNYLAAQGVAVPR-IRAIGYGESQPVA 208

Query: 165 TNDTKVGRQNNQRIEIQIFP 184
           +N T  GRQ N+R+EIQ+ P
Sbjct: 209 SNGTDSGRQQNRRVEIQLSP 228


>gi|24216314|ref|NP_713795.1| OmpA family protein [Leptospira interrogans serovar Lai str. 56601]
 gi|24197586|gb|AAN50813.1| OmpA family protein [Leptospira interrogans serovar Lai str. 56601]
          Length = 475

 Score =  119 bits (298), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 35/133 (26%), Positives = 63/133 (47%)

Query: 51  EDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTV 110
           E++ Q   + + + + R  + I   +   +   +   L+++    L+ IA++L K+    
Sbjct: 341 EEDNQAAPESSPVEIRRTEEGIAISLNSVLFDHNSSELKQEAKLELKRIASVLKKYADRE 400

Query: 111 IAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKV 170
           I I  HTD+ G  + N  +S+ERA  +   L        + +S  G+    PI  N T  
Sbjct: 401 IRISGHTDNSGGEEYNRKLSRERALSVLKELRDEQGLEEKRMSYEGYGKSKPIADNSTIQ 460

Query: 171 GRQNNQRIEIQIF 183
           GRQ N+R++I I 
Sbjct: 461 GRQKNRRVDITIV 473


>gi|85706177|ref|ZP_01037272.1| OmpA domain protein [Roseovarius sp. 217]
 gi|85669341|gb|EAQ24207.1| OmpA domain protein [Roseovarius sp. 217]
          Length = 219

 Score =  119 bits (298), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 45/166 (27%), Positives = 71/166 (42%), Gaps = 3/166 (1%)

Query: 22  SREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVS 81
           S +K K  L             G++LD+ E E + QL +  + +   GD +   +P  + 
Sbjct: 56  SDDKGKGALIGGILGAAGGATIGNALDRQEAELRQQLDND-VQIVNTGDRLILTMPQDIL 114

Query: 82  FV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSY 140
           F      +       L  +A  L  +P T + +  HTDS G    N  +S+ RA+ +   
Sbjct: 115 FPVDSFTVASVLRDDLLKVAQSLQAYPDTTVQVVGHTDSDGAASYNQSLSERRANAVADV 174

Query: 141 LIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRG 186
           L   GVS  R +   G     P+ +N T  G+  N+R+EI I P  
Sbjct: 175 LASGGVSYGR-LRAFGRGEDQPVASNLTPQGKAQNRRVEIVILPNA 219


>gi|298208747|ref|YP_003716926.1| OmpA family protein [Croceibacter atlanticus HTCC2559]
 gi|83848674|gb|EAP86543.1| OmpA family protein [Croceibacter atlanticus HTCC2559]
          Length = 233

 Score =  119 bits (298), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 44/220 (20%), Positives = 86/220 (39%), Gaps = 36/220 (16%)

Query: 2   IKELGLSMFIMTTISGCGLA--SREKKKVFLHKSNDTDIVNK------------------ 41
           IK +           GC     +  K+K  +  +    I+                    
Sbjct: 5   IKTILAVAVASILFVGCEATKNANNKQKGGVIGATGGAILGAIIGNNVGDGNNSELGAVI 64

Query: 42  ----------RFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVH---VSFVSEVFL 88
                       G+ +DK   + + ++   G  V RI D I      +       ++  +
Sbjct: 65  GGVVGGATGVIIGNKMDKQAQKIEQEIP--GAQVERIDDGIVVTFDENSGVYFDTNKSNI 122

Query: 89  EKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSS 148
             K    L  ++ +L ++P+T + +  HTDS G+ + N+ +S++RA+ + +Y   +   S
Sbjct: 123 NAKSQETLDKLSNVLVEYPNTDVLVVGHTDSTGSAEYNMSLSRDRANSVTNYFTSK-GLS 181

Query: 149 NRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGNI 188
           +   + + F    P  TNDT  GR  N+R+++ I P   +
Sbjct: 182 SGRFTTKWFGETKPAYTNDTAEGRAKNRRVQLAILPNEQM 221


>gi|163732619|ref|ZP_02140064.1| OmpA family domain protein [Roseobacter litoralis Och 149]
 gi|161393979|gb|EDQ18303.1| OmpA family domain protein [Roseobacter litoralis Och 149]
          Length = 210

 Score =  119 bits (298), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 35/167 (20%), Positives = 72/167 (43%), Gaps = 2/167 (1%)

Query: 19  GLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPV 78
                 + K  +  +     +    G +LD+ E E +  L +  + ++  GD +   +P 
Sbjct: 43  SRGDGNRDKGAVIGAVVGGAIGAGIGYNLDQQEAELRRDLGNDDVQITNTGDRLIVSLPQ 102

Query: 79  HVSFVSEV-FLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVI 137
            + F ++   +       L  +A  L  +P++ I +  HTDS G    N  +S+ RA  +
Sbjct: 103 DLLFATDSFSVRPDLQNDLYTVAGSLQNYPASTIQVIGHTDSDGDAAYNQQLSERRAGSV 162

Query: 138 KSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
            + ++     ++  +   G     P+ +N  + G+  N+R+EI I P
Sbjct: 163 -AGILMNAGVTSSRLQTIGRGESQPVASNLNETGKAQNRRVEIVILP 208


>gi|146308665|ref|YP_001189130.1| OmpA/MotB domain-containing protein [Pseudomonas mendocina ymp]
 gi|145576866|gb|ABP86398.1| OmpA/MotB domain protein [Pseudomonas mendocina ymp]
          Length = 222

 Score =  119 bits (298), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 50/163 (30%), Positives = 80/163 (49%), Gaps = 2/163 (1%)

Query: 23  REKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF 82
             + K  L  +         +G   D+ E E + Q+Q TG+ V R GD+I   +P +++F
Sbjct: 56  DNRGKGALIGAAVGGAAGAGYGYYADRQEAELRRQMQGTGVEVQRQGDVIQLIMPGNITF 115

Query: 83  -VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYL 141
                 +   F   L  +A    ++    I +  HTDS G+   N+ +SQ RA  + SYL
Sbjct: 116 ATDSAEIASSFYAPLNNLANSFRQYNQNSIEVVGHTDSTGSHSYNMSLSQRRAQSVASYL 175

Query: 142 IQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           I +GV  +R +S RG     P+ +N T  GR  N+R+E+ + P
Sbjct: 176 IAQGVDGSR-VSTRGMGPDQPVASNATAEGRAQNRRVEVTLRP 217


>gi|145301089|ref|YP_001143930.1| outer membrane lipoprotein [Aeromonas salmonicida subsp.
           salmonicida A449]
 gi|142853861|gb|ABO92182.1| outer membrane lipoprotein [Aeromonas salmonicida subsp.
           salmonicida A449]
          Length = 218

 Score =  119 bits (298), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 54/214 (25%), Positives = 94/214 (43%), Gaps = 33/214 (15%)

Query: 3   KELGLSMFIMTTISGC-------------------------------GLASREKKKVFLH 31
           K L  ++ +   ++GC                                 +  ++KK  L 
Sbjct: 4   KILVPALALTIALTGCTTNPYTGEQQTGKAAWGALAGAATGAAVGAISSSKGDRKKGILT 63

Query: 32  KSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEV-FLEK 90
                  +    G  +D  E + + +LQ TG+ V+R GD +   +P +V+F S    L+ 
Sbjct: 64  GVAAGAALGGGIGYYMDVQEAKLREKLQGTGVSVTRNGDELILNMPNNVTFDSSSAQLKA 123

Query: 91  KFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNR 150
                L  +A ++ +F  T + +  HTDS G+   N+ +S +RAD + + LI  GV+ +R
Sbjct: 124 AGANTLSGVAMVVAEFDKTRLNVVGHTDSTGSRDLNMKLSAQRADAVAAQLIGHGVTGSR 183

Query: 151 FISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
            IS +G     P+ TN T  G+  N+R+ I + P
Sbjct: 184 -ISTQGVGPDQPVATNSTAAGKAQNRRVTITLIP 216


>gi|78189119|ref|YP_379457.1| OmpA family protein [Chlorobium chlorochromatii CaD3]
 gi|78171318|gb|ABB28414.1| OmpA family protein [Chlorobium chlorochromatii CaD3]
          Length = 233

 Score =  118 bits (297), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 40/166 (24%), Positives = 76/166 (45%), Gaps = 4/166 (2%)

Query: 26  KKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV-S 84
            K  L  +          G+ +DK        +   G  V R+G+ I       + F   
Sbjct: 62  AKGALIGAVVGGASGAVLGNYMDKQAAAIDQNV--EGAQVQRVGESIRVVFDSGLLFTTG 119

Query: 85  EVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQR 144
              +       ++ +A ILN +  T + I+ HTDSIG    N ++S++RA+ + + L++ 
Sbjct: 120 SSTISAASRSNIEQLARILNTYGDTNVVIEGHTDSIGNEATNQVLSEKRAESV-ATLLKV 178

Query: 145 GVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGNIKK 190
              +   +S  G+    P+ TN+T+ GR  N+R+E+ I+    +++
Sbjct: 179 YGVAPNRMSAVGYGETRPVATNETEAGRNLNRRVEVLIYATDALRQ 224


>gi|307825940|ref|ZP_07656155.1| OmpA/MotB domain protein [Methylobacter tundripaludum SV96]
 gi|307733059|gb|EFO03921.1| OmpA/MotB domain protein [Methylobacter tundripaludum SV96]
          Length = 288

 Score =  118 bits (297), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 46/218 (21%), Positives = 83/218 (38%), Gaps = 32/218 (14%)

Query: 1   MIKELGLSMFIMTTISGCGLAS-----------------------------REKKKVFLH 31
           M K+L         ++ C                                     K    
Sbjct: 1   MKKKLLTIAISSILLTACVTDPYTGQSSLGKAAMGGGLGAAVGAGAGTLFGGNDLKNAGL 60

Query: 32  KSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDM-ITCYIPVHVSF-VSEVFLE 89
            +    +V    G+ +D  ++E Q  LQ TGI V R  +  +   +P +V+F      L 
Sbjct: 61  GALAGGVVGAAVGAYMDHQQEEMQQSLQGTGIEVQRTAENTLNLTMPSNVTFAFDSATLT 120

Query: 90  KKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSN 149
            +    L  +A +LN++P + I +  HTD +G+   N ++S+ RA  + S  + +   + 
Sbjct: 121 PQAQGALDSVAKVLNQYPDSTINVTGHTDDVGSDSYNQVLSERRAASVSS-YLAQHGVTP 179

Query: 150 RFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGN 187
             ++ +G   K P   N  +  R  N+R+E+ I    N
Sbjct: 180 SRLTQQGMGEKMPKVPNVNEANRGQNRRVELAIVANKN 217


>gi|308270955|emb|CBX27565.1| hypothetical protein N47_H23870 [uncultured Desulfobacterium sp.]
          Length = 229

 Score =  118 bits (297), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 48/230 (20%), Positives = 90/230 (39%), Gaps = 45/230 (19%)

Query: 2   IKELGL-SMFIMTTISGCGLASREKK-KVFLHKSNDTDIVNKRFG--------------- 44
           +K+L + +  +  T  GC   ++          +     + +  G               
Sbjct: 1   MKKLVIWASIVAFTFIGCATKTQTGTLAGTGVGAAVGAGLGQAIGGNTTGTLVGAAIGAA 60

Query: 45  ----------SSLDKAEDEFQMQLQDTGIVVSRIGDMITCYI-----------------P 77
                     + +D+ E   +  L D+          +                      
Sbjct: 61  AGGLAGGAIGNYMDRQEAAMRQALADSEAASINREQQVLAQATADSSKKVRDVLTVTFKS 120

Query: 78  VHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVI 137
             +  V+   L       L  +A ++N++P T I +  HTDS G+ + N  +S++RA  +
Sbjct: 121 DFLYAVNSSTLFPGAYDELDRVAKVINQYPDTRIQVGGHTDSTGSAEYNQKLSEQRAQAV 180

Query: 138 KSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGN 187
           K+ L+ RGV+++R IS  G+     I +N+T+ GRQ N+R+EI+I P   
Sbjct: 181 KNALVSRGVNASR-ISAIGYGENKSIASNETEAGRQQNRRVEIRIIPNQE 229


>gi|254506333|ref|ZP_05118476.1| outer membrane protein [Vibrio parahaemolyticus 16]
 gi|219550813|gb|EED27795.1| outer membrane protein [Vibrio parahaemolyticus 16]
          Length = 225

 Score =  118 bits (297), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 55/222 (24%), Positives = 99/222 (44%), Gaps = 39/222 (17%)

Query: 1   MIKELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFG---------------- 44
           ++K++ L++ +   +SGC    R+       ++N                          
Sbjct: 3   IVKKITLALAVAIALSGCQATQRQNATTGESETNSATSGAIIGAIAGAAIGVATGDDAKD 62

Query: 45  --------------------SSLDKAEDEFQMQLQDTGIVVSRIG-DMITCYIPVHVSFV 83
                                  D+ E   + +L ++G+ V R+G + +   +   + F 
Sbjct: 63  RRKRALIGAAGGAAVGGGVGYYFDQQEAALRQELLNSGVQVERVGENQLLLRLENGIGFS 122

Query: 84  SEVFLEKKF-LPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLI 142
           S  +         L+ +A IL ++P T + I+ HTDS G+   N ++S+ RA+ ++SYL+
Sbjct: 123 SSSYQLDSSIHNTLRGVARILVEYPDTSLVIEGHTDSTGSDTTNQILSERRAESVRSYLV 182

Query: 143 QRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
            +GV++ R I  RG   +YP+ TN T  GR  N+R+EIQI P
Sbjct: 183 SQGVAAGRAI-ARGNGERYPLCTNSTAEGRACNRRVEIQILP 223


>gi|114764072|ref|ZP_01443311.1| OmpA domain protein [Pelagibaca bermudensis HTCC2601]
 gi|114543430|gb|EAU46445.1| OmpA domain protein [Roseovarius sp. HTCC2601]
          Length = 221

 Score =  118 bits (297), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 52/219 (23%), Positives = 84/219 (38%), Gaps = 36/219 (16%)

Query: 2   IKELGLSMFIMTTISGCGLAS---------------------------------REKKKV 28
              + LS+  +  +S C                                      +  K 
Sbjct: 5   KTSILLSLAAVMGLSACSDGQMFDENNPNRNTNQGVILGALGGAAAGRLIGGNNDDAVKN 64

Query: 29  FLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVF 87
            L  +    I     G+ LDK E E + QL    + +   GD +   +P  + F      
Sbjct: 65  TLAGAAAGAIAGGVIGNQLDKQEAELRQQL-GNDVGIRNTGDRLIVTMPQDILFGFDSDT 123

Query: 88  LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVS 147
           L       ++ + + L ++P+T + +  HTDS G    N  +SQ RA  + + L+  GV 
Sbjct: 124 LRNDLQADIRTVGSSLLQYPNTSVQVVGHTDSDGDAGYNQGLSQRRAQSVANVLVSSGVP 183

Query: 148 SNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRG 186
           S+R ISV G     P+ +N T  G+  N+R+EI I P  
Sbjct: 184 SSR-ISVIGRGEAAPVASNLTPEGKAQNRRVEIVILPNA 221


>gi|237745869|ref|ZP_04576349.1| OmpA/MotB domain-containing protein [Oxalobacter formigenes HOxBLS]
 gi|229377220|gb|EEO27311.1| OmpA/MotB domain-containing protein [Oxalobacter formigenes HOxBLS]
          Length = 218

 Score =  118 bits (297), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 52/219 (23%), Positives = 90/219 (41%), Gaps = 33/219 (15%)

Query: 1   MIKELGL-SMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKR----------------- 42
           M  +L   ++     ++GC   +  +KK                                
Sbjct: 1   MRTKLTACALIATLAVTGCANMNDTQKKTATGAGVGAAAGAVLGAVTGPGGWGRAAAGAA 60

Query: 43  ------------FGSSLDKAEDEFQMQLQDTGIVVSRI-GDMITCYIPVHVSF-VSEVFL 88
                       +G+ ++K + E Q   Q TG+ V +   + I   IP  VSF  +   +
Sbjct: 61  LGGLIGGGAGYLWGNHMEKQKQEMQTATQGTGVEVVQTSDNQIKVSIPSDVSFATNSATI 120

Query: 89  EKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSS 148
             +F  +L+ +AT L   PST I +  +TD+ G+   N  +S+ERA  +++YL+ +   +
Sbjct: 121 SPQFKTILRDLATTLKNNPSTSITVIGYTDNTGSDAINQPLSRERAMSVRNYLVSQ-GVA 179

Query: 149 NRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGN 187
               +V G     PI +N T  GR  N+R+EI +  R  
Sbjct: 180 ANRFTVEGRGSSDPIASNLTAAGRAENRRVEIYVGERAK 218


>gi|110678313|ref|YP_681320.1| OmpA family domain-containing protein [Roseobacter denitrificans
           OCh 114]
 gi|109454429|gb|ABG30634.1| OmpA family domain protein [Roseobacter denitrificans OCh 114]
          Length = 221

 Score =  118 bits (297), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 42/215 (19%), Positives = 85/215 (39%), Gaps = 34/215 (15%)

Query: 3   KELGLSMFIMTTISGC--------------------------------GLASREKKKVFL 30
           K + L+M  + +++ C                                      + +  +
Sbjct: 6   KPVALAMAGVVSLAACTDPAQLNQNPNLSKTQQGALIGAGAGALAGALSRGDGNRDRGAV 65

Query: 31  HKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEV-FLE 89
             +     +    G +LD+ E E +  L +  + ++  GD +   +P  + F ++   + 
Sbjct: 66  IGAVVGGAIGAGIGYNLDQQEAELRRDLGNDDVQITNTGDRLIVSLPQDLLFATDSFSVR 125

Query: 90  KKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSN 149
                 L  +A  L  +P++ I +  HTDS G    N  +S+ RA  +   L+  GV+ +
Sbjct: 126 PDLQNDLYTVAGSLQNYPASTIQVIGHTDSDGDAAYNQRLSERRAGSVAGILMDAGVTPS 185

Query: 150 RFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           R  ++ G     P+ +N  + G+  N+R+EI I P
Sbjct: 186 RLQTI-GRGESQPVASNLNEAGKAQNRRVEIIILP 219


>gi|255534904|ref|YP_003095275.1| OmpA/MotB domain protein [Flavobacteriaceae bacterium 3519-10]
 gi|255341100|gb|ACU07213.1| OmpA/MotB domain protein [Flavobacteriaceae bacterium 3519-10]
          Length = 230

 Score =  118 bits (296), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 52/192 (27%), Positives = 82/192 (42%), Gaps = 9/192 (4%)

Query: 3   KELGLSMFIMTTISGCGLASREKKKVFLHKSN----DTDIVNKRFGSSLDKAEDEFQMQL 58
           K   +       I G    +  K +     +        +     G ++DK   E +  L
Sbjct: 34  KGTAIGTAAGAVIGGVLGNNLGKGRNAPAGAVLGGIVGGVAGNVIGRNMDKQAKEIKETL 93

Query: 59  QDTGIVVSRIGDMITCYIPVHV--SFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSH 116
              G  V R+G+ I   +  ++         L       L  +A +L     T I I  H
Sbjct: 94  P--GAEVERVGEGIRVTMKENMVNFGFDSSELTSAAKTNLDKLAQVLKNNMDTNINIYGH 151

Query: 117 TDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQ 176
           TDS GT   NL +S+ RA  ++SYLI +GV+S+R ++  G   K P+ +NDT  GR  N+
Sbjct: 152 TDSKGTDAYNLSLSERRAAAVRSYLISQGVASSRMLT-MGVGEKEPVASNDTDAGRAENR 210

Query: 177 RIEIQIFPRGNI 188
           R+E  I    ++
Sbjct: 211 RVEFAITANEDM 222


>gi|34541639|ref|NP_906118.1| lipoprotein PG3 [Porphyromonas gingivalis W83]
 gi|5081699|gb|AAD39495.1|AF145799_1 immunogenic 23 kDa lipoprotein PG3 [Porphyromonas gingivalis]
 gi|34397957|gb|AAQ67017.1| lipoprotein PG3 [Porphyromonas gingivalis W83]
          Length = 223

 Score =  118 bits (296), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 49/214 (22%), Positives = 79/214 (36%), Gaps = 27/214 (12%)

Query: 1   MIKELGLS--MFIMTTISGCG-----------------------LASREKKKVFLHKSND 35
           M K   ++  + +    +GCG                         +       +  +  
Sbjct: 1   MKKSSVVASVLAVALVFAGCGLNNMAKGGLIGAGVGGAIGAGVGNVAGNTAVGAIVGTAV 60

Query: 36  TDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLP 94
                   G  +DK + E +  + D  I     G+ I       + F  +   L      
Sbjct: 61  GGAAGALIGKKMDKQKKELEAAVPDATIQTVNDGEAILVTFDSGILFATNSSTLSPNSRT 120

Query: 95  MLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISV 154
            L   A  +NK P T I I  HTD+ G+ K N  +S+ RA  + S+L  +GVS +R  + 
Sbjct: 121 ALTKFAANMNKNPDTDIRIVGHTDNTGSDKINDPLSERRAASVYSFLNSQGVSMSRM-AA 179

Query: 155 RGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGNI 188
            G     P+  N T  GR  N+R+E+ I P   +
Sbjct: 180 EGRGSHEPVADNSTVAGRSANRRVEVYILPNAKM 213


>gi|188995861|ref|YP_001930113.1| immunoreactive 23 kDa antigen [Porphyromonas gingivalis ATCC 33277]
 gi|188595541|dbj|BAG34516.1| immunoreactive 23 kDa antigen [Porphyromonas gingivalis ATCC 33277]
          Length = 223

 Score =  118 bits (296), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 49/214 (22%), Positives = 79/214 (36%), Gaps = 27/214 (12%)

Query: 1   MIKE--LGLSMFIMTTISGCG-----------------------LASREKKKVFLHKSND 35
           M K   +  ++ +    +GCG                         +       +  +  
Sbjct: 1   MKKSSVVASALAVALVFAGCGLNNMAKGGLIGAGVGGAIGAGVGNVAGNTAVGAIVGTAV 60

Query: 36  TDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLP 94
                   G  +DK + E +  + D  I     G+ I       + F  +   L      
Sbjct: 61  GGAAGALIGKKMDKQKKELEAAVPDATIQTVNDGEAILVTFDSGILFATNSSTLSPNSRT 120

Query: 95  MLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISV 154
            L   A  +NK P T I I  HTD+ G+ K N  +S+ RA  + S+L  +GVS +R  + 
Sbjct: 121 ALTKFAANMNKNPDTDIRIVGHTDNTGSDKINDPLSERRAASVYSFLNSQGVSMSRM-AA 179

Query: 155 RGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGNI 188
            G     P+  N T  GR  N+R+E+ I P   +
Sbjct: 180 EGRGSHEPVADNSTVAGRSANRRVEVYILPNAKM 213


>gi|221069812|ref|ZP_03545917.1| OmpA/MotB domain protein [Comamonas testosteroni KF-1]
 gi|220714835|gb|EED70203.1| OmpA/MotB domain protein [Comamonas testosteroni KF-1]
          Length = 219

 Score =  118 bits (296), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 52/218 (23%), Positives = 88/218 (40%), Gaps = 33/218 (15%)

Query: 1   MIKELGL--SMFIMTTISGCGLASREKKKV----------------------------FL 30
           M K+L +  ++     I+GC                                       L
Sbjct: 1   MRKQLAVTAALASALLITGCANTGGMSDTTRRTATGAGVGALGGAAIGAIAGGHAGKGAL 60

Query: 31  HKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDM-ITCYIPVHV-SFVSEVFL 88
             +    + +  +  +L+K + E +   Q TG+ V++  D  +   IP  +        +
Sbjct: 61  IGAGVGALGSYIWSQNLEKQKREMEAATQGTGVGVTQTADNQLKLDIPSDISFDTGRADI 120

Query: 89  EKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSS 148
           +  F P+L   A  L   P+  + I  HTDS G+   N  +S +RA+  ++YL  RGV+ 
Sbjct: 121 KSNFAPILDRFAEGLRNNPNAEVRIIGHTDSTGSDAINNPLSLQRAESTRNYLTSRGVNG 180

Query: 149 NRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRG 186
            R I V+G     P+ +N T  GR  N+R+EI +  R 
Sbjct: 181 AR-IQVQGMGSHQPVASNATNEGRARNRRVEIFVGERA 217


>gi|254492090|ref|ZP_05105265.1| hypothetical protein MDMS009_2433 [Methylophaga thiooxidans DMS010]
 gi|224462642|gb|EEF78916.1| hypothetical protein MDMS009_2433 [Methylophaga thiooxydans DMS010]
          Length = 224

 Score =  118 bits (296), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 48/212 (22%), Positives = 84/212 (39%), Gaps = 30/212 (14%)

Query: 2   IKELGLSMFIMTTISGCGLASREKKK-----------------------VFLHKSNDTDI 38
           +K+L L+  + T +SGC      +K                          +  +    +
Sbjct: 1   MKKLVLATIVATALSGCAANDPNQKTKAGAAIGAAAGALVGYAVDDGAGGVIAGAAVGAL 60

Query: 39  VNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMI------TCYIPVHVSFVSEVFLEKKF 92
                G  +D  + E +  L +           +                     L+  F
Sbjct: 61  AGGGVGRYMDNQQKEMEAALAEEQARHELEIQQLENETLKIDIANEVSFDFDSAALKSAF 120

Query: 93  LPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFI 152
            P L  +A +L ++P+T+I +  HTDS+G+   N  +S+ RA  +  Y   RGV++ R  
Sbjct: 121 TPTLSKVADVLQRYPNTIIHVVGHTDSVGSESYNQRLSERRAQSVVDYFSSRGVATGRLY 180

Query: 153 SVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           ++ G     P  TN+T+ GRQ N+R+EI + P
Sbjct: 181 AI-GRGETEPRATNETEAGRQLNRRVEIFVKP 211


>gi|113868899|ref|YP_727388.1| outer membrane protein peptidoglycan-associated(lipo)proteins
           [Ralstonia eutropha H16]
 gi|113527675|emb|CAJ94020.1| outer membrane protein peptidoglycan-associated(lipo)proteins
           [Ralstonia eutropha H16]
          Length = 212

 Score =  118 bits (295), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 41/211 (19%), Positives = 76/211 (36%), Gaps = 32/211 (15%)

Query: 2   IKELGLSMFIMTTIS-GCGLASREKKKVFLHKSNDTDIVNKRFGSSL------------- 47
           IK + +S+   T ++ GC     E++      +     V    G+ +             
Sbjct: 3   IKLVTVSLTAATLLAAGCAT---EQQTHTAVGTGVGAAVGAGLGNLIGGNTTGTLVGAAV 59

Query: 48  ------------DKAEDEFQMQLQDTGIVVSRIGDM-ITCYIPVHVSFV-SEVFLEKKFL 93
                       +    +       TG  ++   D  +   IP  V+F      ++  F 
Sbjct: 60  GGAIGGATGYNWNAIRGKLNKDTAGTGTQITEQPDGTLKVNIPSQVTFDTDSATIKPSFR 119

Query: 94  PMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFIS 153
            +L  +A  L +       +  HTDS G    N+ +SQ RA  + +  +     +   ++
Sbjct: 120 SVLDQVAQTLGQHQDVSANVVGHTDSTGNPNYNMQLSQRRAQSV-AGYLGDRGVARNRLT 178

Query: 154 VRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
             G     P+  N T+ GR  N+R+EI + P
Sbjct: 179 AEGRGQSQPVADNGTEAGRAQNRRVEIFLKP 209


>gi|134094293|ref|YP_001099368.1| putative outer membrane protein; putative peptidoglycan-associated
           (lipo)-protein [Herminiimonas arsenicoxydans]
 gi|133738196|emb|CAL61241.1| conserved hypothetical protein; putative OmpA domain [Herminiimonas
           arsenicoxydans]
          Length = 225

 Score =  118 bits (295), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 46/211 (21%), Positives = 82/211 (38%), Gaps = 31/211 (14%)

Query: 2   IKELGL-SMFIMTTISGCGLASREK---------------------------KKVFLHKS 33
           ++ L + S+  +  +SGC   S  +                                   
Sbjct: 1   MRTLMIGSLAAILALSGCANMSPTERGTAQGAGIGAGLGALIGGVGGGSKNIAGGAAVGG 60

Query: 34  NDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRI-GDMITCYIPVHVSF-VSEVFLEKK 91
               +    + S ++  +   +   Q TG+ V++   + +   IP  +SF      +   
Sbjct: 61  ILGAVAGNVWSSRMENQKRAMEQATQGTGVQVTQTSDNRLKLDIPSDISFATGRSDINSS 120

Query: 92  FLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRF 151
           F P+L   AT L   P+  + I  HTDS G+   N  +S +RA   + YL  R   + + 
Sbjct: 121 FRPILDRFATGLVDNPAATVTIIGHTDSTGSDAINNPLSFDRASRTRDYLAGR-GVAPQR 179

Query: 152 ISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           I V G   + P+ +N  + GR  N+R+EI +
Sbjct: 180 IHVDGRGSREPVASNANEAGRARNRRVEIYV 210


>gi|84503479|ref|ZP_01001534.1| OmpA family protein [Oceanicola batsensis HTCC2597]
 gi|84388157|gb|EAQ01110.1| OmpA family protein [Oceanicola batsensis HTCC2597]
          Length = 226

 Score =  118 bits (295), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 49/164 (29%), Positives = 74/164 (45%), Gaps = 3/164 (1%)

Query: 22  SREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVS 81
           SR+ KK  L       +    +G  LD+ E   + +L  + + +   GD +   +P  + 
Sbjct: 63  SRDSKKGALIGGVAGALAGAAYGDYLDRQEAALRSEL-GSNVQIVNTGDRLVVTMPQDIL 121

Query: 82  F-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSY 140
           F      L       L  +A  LN++P T + +  HTD+ G    N  +S  RA  + + 
Sbjct: 122 FATDSASLRPDLTTDLVTVARSLNEYPRTTVQVVGHTDNTGDAAYNQQLSARRASAVANV 181

Query: 141 LIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           LI  GVS+ R  S  G     P  TN T  GRQ N+R++I I P
Sbjct: 182 LINSGVSAGRIQS-FGRGEDQPRATNLTPEGRQLNRRVDIVILP 224


>gi|311747916|ref|ZP_07721701.1| OmpA family protein [Algoriphagus sp. PR1]
 gi|126575910|gb|EAZ80220.1| OmpA family protein [Algoriphagus sp. PR1]
          Length = 225

 Score =  118 bits (295), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 44/178 (24%), Positives = 77/178 (43%), Gaps = 8/178 (4%)

Query: 14  TISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMIT 73
            I+G            L  S          G+ +DKA +E Q  L   G  V R+G+ I 
Sbjct: 45  VIAG----KDNTATGVLIGSAIGGSAGAIIGNEMDKAAEELQRDL--EGATVERVGEGIK 98

Query: 74  CYIPVHVSFV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQE 132
                 + F   +  L       L  ++  L K+  T I ++ HTD+ G+   NL +S++
Sbjct: 99  ITFDSGLMFDVDKATLNSNSRDNLMELSETLKKYDETNILVEGHTDATGSDDYNLDLSRK 158

Query: 133 RADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGNIKK 190
           RA  ++   +         + +  +    PI TN+T+ GRQ N+R+E+ I+    +++
Sbjct: 159 RAYSVED-YLTNLGIQKSRLEITAYGENQPIATNETEAGRQQNRRVEVAIYANKKMQR 215


>gi|93006911|ref|YP_581348.1| OmpA/MotB [Psychrobacter cryohalolentis K5]
 gi|92394589|gb|ABE75864.1| OmpA/MotB [Psychrobacter cryohalolentis K5]
          Length = 217

 Score =  118 bits (295), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 40/218 (18%), Positives = 88/218 (40%), Gaps = 31/218 (14%)

Query: 2   IKELGLSMFIM--TTISGCGLASREKKK----------------VFLHKSNDTDIVNKRF 43
           ++   +   I     ++GC       ++                  + K+   D   +  
Sbjct: 1   MRNTLMVAAIASGLALTGCVTDPNTGQQRLNKSAIGALAGAAGGATISKATGGDKTGRDA 60

Query: 44  G----------SSLDKAEDEFQMQLQDTGIVVSRIGD-MITCYIPVHVSF-VSEVFLEKK 91
                        +++   + + Q+  TG+ V    +  I   +P  ++F   +  L   
Sbjct: 61  AIGAALGAGVGYYMERQARQLEQQMAGTGVTVKPNANGNIDLVMPGSITFSFDDATLNNS 120

Query: 92  FLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRF 151
           F P L  +A  +N++    I I  HTDS GT   N+ +S++RA  + +  +     ++  
Sbjct: 121 FKPTLDKLAATMNEYNQNTITIAGHTDSKGTDAYNMKLSRDRAYAVAN-YLSARGVASNR 179

Query: 152 ISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGNIK 189
           I+V  +    P+  N+++ GRQ N+R+E+ +    +++
Sbjct: 180 INVVAYGESRPVADNNSEFGRQQNRRVELTVNAPQSVR 217


>gi|330831642|ref|YP_004394594.1| outer membrane lipoprotein [Aeromonas veronii B565]
 gi|328806778|gb|AEB51977.1| Outer membrane lipoprotein [Aeromonas veronii B565]
          Length = 218

 Score =  118 bits (295), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 54/214 (25%), Positives = 95/214 (44%), Gaps = 33/214 (15%)

Query: 3   KELGLSMFIMTTISGC-------------------------------GLASREKKKVFLH 31
           K L  ++ +   +SGC                                 +  ++KK  L 
Sbjct: 4   KILVPALALTVALSGCTTNPYTGESQTSKGAWGALAGAAAGAAVGALSSSKGDRKKGILT 63

Query: 32  KSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEV-FLEK 90
                  +    G  +D  E + + +LQ TG+ V+R G+ +   +P +V+F S    L+ 
Sbjct: 64  GVAAGAALGGGIGYYMDVQEAKLREKLQGTGVSVTRNGNELILNMPNNVTFDSSSSQLKA 123

Query: 91  KFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNR 150
                L  +A ++ +F  T + +  HTDS G+   N+ +S++RAD + + LI +GV+ +R
Sbjct: 124 AGANTLSGVAMVVAEFDKTRLNVVGHTDSTGSRDLNMKLSRDRADAVAAQLIGQGVAGSR 183

Query: 151 FISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
            IS  G     P+ TN T  G+  N+R+ I + P
Sbjct: 184 -ISTTGVGPDQPVATNSTAAGKAQNRRVTITLTP 216


>gi|313497139|gb|ADR58505.1| OmpA/MotB domain-containing protein [Pseudomonas putida BIRD-1]
          Length = 239

 Score =  118 bits (295), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 52/221 (23%), Positives = 87/221 (39%), Gaps = 39/221 (17%)

Query: 2   IKELGLSMFIMTTISGCGLASREKKKVFLHKSND-------------------------- 35
           ++ L +       ++GC   +    +     S                            
Sbjct: 4   MRRLIIVATAAALMTGCAGQNPYDNQGQAQGSTGMSKTAKYGGLGALAGAIAGAAIDHNN 63

Query: 36  -----------TDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-V 83
                             +G   DK E E + Q+ +TG+ V R GD I   +P +++F  
Sbjct: 64  RGKGALIGAAAVGAAAAGYGYYADKQEAELRAQMANTGVEVQRQGDQIKLIMPGNITFAT 123

Query: 84  SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQ 143
               +   F   L  +A    +F    I +   TDS G+ ++N+ +SQ RA  + +YL  
Sbjct: 124 DSANIAPSFYSPLNNLAGSFKQFNQNTIEVVGFTDSTGSRQHNMDLSQRRAQAVSTYLTS 183

Query: 144 RGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           +GV ++R ISVRG     PI +N    GR  N+R+E+ + P
Sbjct: 184 QGVDASR-ISVRGMGPDQPIASNADANGRAQNRRVEVNLKP 223


>gi|325267796|ref|ZP_08134446.1| OmpA family protein [Kingella denitrificans ATCC 33394]
 gi|324980677|gb|EGC16339.1| OmpA family protein [Kingella denitrificans ATCC 33394]
          Length = 221

 Score =  117 bits (294), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 50/212 (23%), Positives = 90/212 (42%), Gaps = 29/212 (13%)

Query: 2   IKELGLSM-FIMTTISGCGLASREKKK--------------------------VFLHKSN 34
           +K L +++      +SGC   ++ +++                             + + 
Sbjct: 4   LKTLTIAVTASALALSGCVTNAQGQQQPSKTALFGIGGAITCGIVGALTHGRTGARNSAL 63

Query: 35  DTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFL 93
               V    G  +D  E + + QL +TG+ V R G+ I   +P +++F  +   L  +  
Sbjct: 64  ACGAVGAGVGGYMDYQERKLREQLANTGVEVERKGNQIKLTMPENITFATNSAALSAQAQ 123

Query: 94  PMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFIS 153
             L   A  L K+  T I +  HTDS G    N  +S  RA+ + S  + +   + + ++
Sbjct: 124 NALATAAETLAKYNETTITVVGHTDSTGNDAINNPLSYNRANAVSS-FLAQHGVATQRMT 182

Query: 154 VRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPR 185
           V G   + PI  N+T+ GR  N+R+EI I P 
Sbjct: 183 VLGQGSRQPIADNNTEAGRAQNRRVEILINPN 214


>gi|148546044|ref|YP_001266146.1| OmpA/MotB domain-containing protein [Pseudomonas putida F1]
 gi|148510102|gb|ABQ76962.1| OmpA/MotB domain protein [Pseudomonas putida F1]
          Length = 247

 Score =  117 bits (294), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 52/221 (23%), Positives = 87/221 (39%), Gaps = 39/221 (17%)

Query: 2   IKELGLSMFIMTTISGCGLASREKKKVFLHKSND-------------------------- 35
           ++ L +       ++GC   +    +     S                            
Sbjct: 12  MRRLIIVATAAALMTGCAGQNPYDNQGQAQGSTGMSKTAKYGGLGALAGAIAGAAIDHNN 71

Query: 36  -----------TDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-V 83
                             +G   DK E E + Q+ +TG+ V R GD I   +P +++F  
Sbjct: 72  RGKGALIGAAAVGAAAAGYGYYADKQEAELRAQMANTGVEVQRQGDQIKLIMPGNITFAT 131

Query: 84  SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQ 143
               +   F   L  +A    +F    I +   TDS G+ ++N+ +SQ RA  + +YL  
Sbjct: 132 DSANIAPSFYSPLNNLAGSFKQFNQNTIEVVGFTDSTGSRQHNMDLSQRRAQAVSTYLTS 191

Query: 144 RGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           +GV ++R ISVRG     PI +N    GR  N+R+E+ + P
Sbjct: 192 QGVDASR-ISVRGMGPDQPIASNADANGRAQNRRVEVNLKP 231


>gi|170723577|ref|YP_001751265.1| OmpA/MotB domain-containing protein [Pseudomonas putida W619]
 gi|169761580|gb|ACA74896.1| OmpA/MotB domain protein [Pseudomonas putida W619]
          Length = 240

 Score =  117 bits (294), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 51/222 (22%), Positives = 88/222 (39%), Gaps = 40/222 (18%)

Query: 2   IKELGLSMFIMTTISGCGLASREKKKVFLHKSNDT------------------------- 36
           ++ L +       ++GC   +    +      +                           
Sbjct: 4   MRRLIIVATAAALMTGCAGQNPYDSQGQAQGGSTGMSKTAKYGGLGALAGAIAGAAIDHD 63

Query: 37  -------------DIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF- 82
                              +G   DK E E + Q+ +TG+ V R GD I   +P +++F 
Sbjct: 64  NRGKGALIGAAAVGAAAAGYGYYADKQEAELRAQMANTGVEVQRQGDQIKLIMPGNITFA 123

Query: 83  VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLI 142
                +   F   L  +AT   +F    I +   TDS G+ ++N+ +SQ RA  + +YL 
Sbjct: 124 TDSANIAPSFYSPLNNLATSFKQFNQNTIEVVGFTDSTGSRQHNMDLSQRRAQAVSAYLT 183

Query: 143 QRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
            +GV ++R +SVRG     PI +N    GR  N+R+E+ + P
Sbjct: 184 SQGVDASR-VSVRGMGPDQPIASNADANGRAQNRRVEVNLKP 224


>gi|254419256|ref|ZP_05032980.1| Rickettsia 17 kDa surface antigen family [Brevundimonas sp. BAL3]
 gi|196185433|gb|EDX80409.1| Rickettsia 17 kDa surface antigen family [Brevundimonas sp. BAL3]
          Length = 224

 Score =  117 bits (294), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 47/166 (28%), Positives = 87/166 (52%), Gaps = 2/166 (1%)

Query: 20  LASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVH 79
               + +K  L  +    +     G  +D+ +   + +L  +G+ V+R GD +   +P  
Sbjct: 57  SNGEQGRKNALIGAGVGALGGAAVGQYMDRQQRAMEAELSGSGVGVARQGDNLVLRMPSD 116

Query: 80  VSFVSE-VFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIK 138
           V+F +    ++ +FLP+L  +A +L ++  + I +  HTDS G    N  +S+ RA  + 
Sbjct: 117 VTFATNQSSIDPRFLPVLDDVARVLQEYDRSTIDVIGHTDSTGGDAINQPLSERRAASVA 176

Query: 139 SYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           S L++RGV + R + V G + + P+ +N T  G+  N+R+EI I P
Sbjct: 177 SELVRRGVIAER-LYVAGNSSRNPVASNATPEGKAQNRRVEILIRP 221


>gi|26987509|ref|NP_742934.1| OmpA/MotB domain protein [Pseudomonas putida KT2440]
 gi|24982176|gb|AAN66398.1|AE016267_7 OmpA family protein [Pseudomonas putida KT2440]
          Length = 236

 Score =  117 bits (294), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 52/221 (23%), Positives = 87/221 (39%), Gaps = 39/221 (17%)

Query: 2   IKELGLSMFIMTTISGCGLASREKKKVFLHKSND-------------------------- 35
           ++ L +       ++GC   +    +     S                            
Sbjct: 1   MRRLIIVATAAALMTGCAGQNPYDNQGQAQGSTGMSKTAKYGGLGALAGAIAGAAIDHNN 60

Query: 36  -----------TDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-V 83
                             +G   DK E E + Q+ +TG+ V R GD I   +P +++F  
Sbjct: 61  RGKGALIGAAAVGAAAAGYGYYADKQEAELRAQMANTGVEVQRQGDQIKLIMPGNITFAT 120

Query: 84  SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQ 143
               +   F   L  +A    +F    I +   TDS G+ ++N+ +SQ RA  + +YL  
Sbjct: 121 DSANIAPSFYSPLNNLAGSFKQFNQNTIEVVGFTDSTGSRQHNMDLSQRRAQAVSTYLTS 180

Query: 144 RGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           +GV ++R ISVRG     PI +N    GR  N+R+E+ + P
Sbjct: 181 QGVDASR-ISVRGMGPDQPIASNADANGRAQNRRVEVNLKP 220


>gi|293609016|ref|ZP_06691319.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292829589|gb|EFF87951.1| conserved hypothetical protein [Acinetobacter sp. SH024]
          Length = 217

 Score =  117 bits (294), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 51/217 (23%), Positives = 92/217 (42%), Gaps = 34/217 (15%)

Query: 2   IKELGL--SMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGS-------------- 45
           ++ L +   +     +SGC         V   K+    ++    G               
Sbjct: 1   MRALVISTVVGAAVVLSGCQTTGNNLGGVEYDKAALGTLIGAAAGYGISKSNANSSRQNN 60

Query: 46  ---------------SLDKAEDEFQMQLQDTGIVVSRIGDM-ITCYIPVHVSFVS-EVFL 88
                           LD+ E + + Q+  TG+ V R  D  +   +P  ++F + +  +
Sbjct: 61  RAAAIGAVLGAGGGVYLDQKEKKLRQQMAGTGVDVGRNPDGSVQLIMPGSITFDTNKSNI 120

Query: 89  EKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSS 148
           +  F   L  +A  L +   + I +  +TD+ G    N+ +SQ RA  ++SYL  +GVS+
Sbjct: 121 KPNFYATLNKVAQTLAEDNKSAILVTGYTDNTGNDSINIPLSQARAQSVRSYLASQGVSA 180

Query: 149 NRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPR 185
           +R I  +G+    PI  N T  GR+ N+R+EI I+ +
Sbjct: 181 SR-IDAQGYGSSNPIADNSTASGREQNRRVEISIYAK 216


>gi|218259786|ref|ZP_03475375.1| hypothetical protein PRABACTJOHN_01034 [Parabacteroides johnsonii
           DSM 18315]
 gi|218224914|gb|EEC97564.1| hypothetical protein PRABACTJOHN_01034 [Parabacteroides johnsonii
           DSM 18315]
          Length = 227

 Score =  117 bits (293), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 39/148 (26%), Positives = 68/148 (45%), Gaps = 2/148 (1%)

Query: 43  FGSSLDKAEDEFQMQL-QDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIA 100
            G  +DK + E +  L ++T +     G+ +       + F  +   +       L+ +A
Sbjct: 70  IGKKMDKQKKELEATLPEETTVETINNGEALKVTFDSGILFATNSSTVSAASKSALRDLA 129

Query: 101 TILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYK 160
             LN  P T I I  HTD+ G +  N  +S++RA  +  YL++    S++ ++  G    
Sbjct: 130 ASLNANPDTDIKIIGHTDNTGKVDYNQTLSEKRAKSVFDYLMEDQGVSSKRMTYEGKGVH 189

Query: 161 YPIDTNDTKVGRQNNQRIEIQIFPRGNI 188
            P+  N T  GR  N+R+EI I P   +
Sbjct: 190 EPVADNSTPEGRALNRRVEILILPNSKM 217


>gi|269103827|ref|ZP_06156524.1| putative OmpA family protein [Photobacterium damselae subsp.
           damselae CIP 102761]
 gi|268163725|gb|EEZ42221.1| putative OmpA family protein [Photobacterium damselae subsp.
           damselae CIP 102761]
          Length = 229

 Score =  117 bits (293), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 49/180 (27%), Positives = 87/180 (48%), Gaps = 2/180 (1%)

Query: 6   GLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVV 65
            +       I     +  ++ K  L  +     +    G  +D    + + QL  +GI V
Sbjct: 49  IIGALAGAAIGVASSSKHDRGKGALIGAASGAALGGGIGYYMDVQAAKLRKQLASSGITV 108

Query: 66  SRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLK 124
           +R G+ I   +P  ++F V +  L ++ +  L  +A +  ++  T + +   TDS G   
Sbjct: 109 TRNGNNIVLNMPNEITFGVDQTTLNQRAMNALHNVALVAKEYNKTQLNVYGFTDSTGAAS 168

Query: 125 NNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
            N  +SQ RA  + +YLI++GV++NR +S +G     PI TN T  GR  N+R++I + P
Sbjct: 169 YNQRLSQVRAAEVGNYLIRQGVAANRVVS-QGMGEASPIATNSTAAGRAENRRVQIVMSP 227


>gi|58866398|gb|AAW82963.1| Omp52 [Leptospira santarosai serovar Shermani]
          Length = 456

 Score =  117 bits (293), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 35/142 (24%), Positives = 64/142 (45%), Gaps = 3/142 (2%)

Query: 45  SSLDKAEDEFQMQLQ---DTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIAT 101
           S  ++ E++ + +        + + R  + I   +   +   +   L+ +    L+ IA+
Sbjct: 313 SWPEEEENKTKPETAKSSGPPVEIRRTEEGIAISLNSVLFDHNSSQLKDEAKLELKKIAS 372

Query: 102 ILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKY 161
           +L K+    I I  HTD+ G  + N  +S+ERA  +   L        + +S  G+    
Sbjct: 373 VLKKYEDREIRISGHTDNSGGDEYNRKLSRERALSVLKELRDEQGLEEKRMSYEGYGKSK 432

Query: 162 PIDTNDTKVGRQNNQRIEIQIF 183
           PI  N T  GRQ N+R++I I 
Sbjct: 433 PIADNSTIQGRQKNRRVDITIV 454


>gi|37680143|ref|NP_934752.1| outer membrane protein [Vibrio vulnificus YJ016]
 gi|320156108|ref|YP_004188487.1| outer membrane protein [Vibrio vulnificus MO6-24/O]
 gi|326423995|ref|NP_761229.2| outer membrane protein [Vibrio vulnificus CMCP6]
 gi|37198889|dbj|BAC94723.1| outer membrane protein [Vibrio vulnificus YJ016]
 gi|319931420|gb|ADV86284.1| outer membrane protein [Vibrio vulnificus MO6-24/O]
 gi|319999372|gb|AAO10756.2| Outer membrane protein [Vibrio vulnificus CMCP6]
          Length = 223

 Score =  117 bits (293), Expect = 9e-25,   Method: Composition-based stats.
 Identities = 54/220 (24%), Positives = 97/220 (44%), Gaps = 38/220 (17%)

Query: 2   IKELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVN--------------------- 40
           +K++ +++ I+ T+SGC    R+       ++N                           
Sbjct: 3   LKKVSIALAILLTLSGCQATQRQNATTGESETNSATKGALIGAIAGAVAGAATGDKKDRG 62

Query: 41  --------------KRFGSSLDKAEDEFQMQLQDTGIVVSRIG-DMITCYIPVHVSFVSE 85
                            G   D+ E   +  L ++G+ V R+G + +   +   + F S 
Sbjct: 63  KRALIGAAGGAAIGGGVGYYFDQQEKALREALLNSGVQVERVGENQLLLRLENGIGFSSS 122

Query: 86  VFLEKKF-LPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQR 144
            +         L+ +A IL ++P T + I   TDS G   +N ++S+ RA+ ++S+LI +
Sbjct: 123 SYALDSSIHNTLKGVAQILVEYPDTSLVIDGFTDSTGNDASNQILSERRAESVRSFLISQ 182

Query: 145 GVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
            V++ R +  RG   +YP+ TN T  GR  N+R+EIQI P
Sbjct: 183 NVAAGRAV-ARGNGERYPLCTNSTAEGRACNRRVEIQILP 221


>gi|30249028|ref|NP_841098.1| outer membrane protein [Nitrosomonas europaea ATCC 19718]
 gi|30138645|emb|CAD84936.1| Bacterial outer membrane protein [Nitrosomonas europaea ATCC 19718]
          Length = 220

 Score =  117 bits (293), Expect = 9e-25,   Method: Composition-based stats.
 Identities = 50/213 (23%), Positives = 81/213 (38%), Gaps = 33/213 (15%)

Query: 1   MIK-ELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKR----------------- 42
           M K  +  ++     ISGC   S  + K     +                          
Sbjct: 1   MYKTRVITTLVAGFIISGCADMSGTQ-KGAGTGALIGAGTGAAIGALAGGGKGAAIGAGA 59

Query: 43  -----------FGSSLDKAEDEFQMQLQDTGIVVSRI-GDMITCYIPVHV-SFVSEVFLE 89
                      +   +++ + + +     TG+VVS+   + +   IP  +        ++
Sbjct: 60  GAALGAGAGYLWSKKMEEQKIQMENATAGTGVVVSQTPDNQLMLNIPSDISFDTGSAQIK 119

Query: 90  KKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSN 149
             F P+L   AT L   P T + I  HTDS G+   N  +S  RA   + YL  RGV   
Sbjct: 120 PDFRPILDSFATSLLNNPGTRVTIVGHTDSTGSDAVNNPLSVNRAASTREYLASRGVPFQ 179

Query: 150 RFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           R I + G     P+ +N+T  GR  N+R+EI +
Sbjct: 180 R-IQIDGRGSYQPVASNNTAAGRAKNRRVEIYV 211


>gi|85858897|ref|YP_461099.1| outer membrane OmpA family protein [Syntrophus aciditrophicus SB]
 gi|85721988|gb|ABC76931.1| outer membrane OmpA family protein [Syntrophus aciditrophicus SB]
          Length = 180

 Score =  117 bits (293), Expect = 9e-25,   Method: Composition-based stats.
 Identities = 43/173 (24%), Positives = 82/173 (47%), Gaps = 3/173 (1%)

Query: 19  GLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQL-QDTGIVVSRIGDMITCYIP 77
           G +++         +    +     G  +D  E + +  L       V+R G+++     
Sbjct: 7   GHSTKSTLIGTAIGAAVGGLGGAGVGRMMDNQEKDMRNALGASDAAAVTREGNLLAVTFK 66

Query: 78  VHVSFVS-EVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADV 136
             V+F +    +       +  +A +L ++P T I ++ +TDS G+   N+ +S+ RA+ 
Sbjct: 67  GDVTFDTNSAEIRPDLYFEIDRVAGVLKQYPDTFIRVEGYTDSKGSDTYNMDLSKRRANA 126

Query: 137 IKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGNIK 189
           +K+ L+ +   +   I V GF    P+ TNDT+ GRQ N+R+EI+I  +   K
Sbjct: 127 VKN-LLVQRGVAENRIEVVGFGETMPVATNDTEAGRQKNRRVEIKIAQQTQAK 178


>gi|189347037|ref|YP_001943566.1| OmpA/MotB domain protein [Chlorobium limicola DSM 245]
 gi|189341184|gb|ACD90587.1| OmpA/MotB domain protein [Chlorobium limicola DSM 245]
          Length = 229

 Score =  117 bits (292), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 45/212 (21%), Positives = 89/212 (41%), Gaps = 29/212 (13%)

Query: 5   LGLSMFIMTTIS-GCGLASREK------------------------KKVFLHKSNDTDIV 39
           + L +  MT++S GC   +                            K     +      
Sbjct: 12  VLLLIIAMTSLSWGCQSTTNAGRGAGYGAAAGGVLGGIIGSRSGSWAKGAFLGAVIGGAA 71

Query: 40  NKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQL 98
               G+ +DK   E    +   G  V R+G+ I       + F      +       ++ 
Sbjct: 72  GALIGNYMDKQAAEIDRDV--EGATVERMGEGIRVVFDSGILFSTGSATITATSRDNIER 129

Query: 99  IATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFA 158
           +A I+N++  T + I+ HTD++G  ++N L+S+ RA+ + + L++        +S  G+ 
Sbjct: 130 LARIINRYDDTNVVIEGHTDTVGNEESNQLLSEHRAEAVSN-LLKAYGVYGSRLSPVGYG 188

Query: 159 YKYPIDTNDTKVGRQNNQRIEIQIFPRGNIKK 190
              P+ +N+T+ GR+ N+R+EI I+    +K+
Sbjct: 189 ESRPVASNETESGRRLNRRVEILIYANDELKR 220


>gi|187923017|ref|YP_001894659.1| OmpA/MotB domain protein [Burkholderia phytofirmans PsJN]
 gi|187714211|gb|ACD15435.1| OmpA/MotB domain protein [Burkholderia phytofirmans PsJN]
          Length = 217

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 40/205 (19%), Positives = 77/205 (37%), Gaps = 24/205 (11%)

Query: 1   MIKELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRF----------------- 43
           ++  L +     + ++GC         V       T                        
Sbjct: 5   IMTRLAVFAVAGSLLAGCASQQGTNTAVGTGVGAGTGAALGAIFGGGKGAAIGAGVGAAV 64

Query: 44  ----GSSLDKAEDEFQMQLQDTGIVVSRIGDM-ITCYIPVHVSFVSEVF-LEKKFLPMLQ 97
               G +     ++     + TG  ++   D  +   IP  V+F +  + ++  F P+L 
Sbjct: 65  GGITGYNWQAIHNKLSGATKGTGTQITEQPDGSLKLNIPSSVTFDTNSYAVKPSFAPVLD 124

Query: 98  LIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGF 157
            +A  + + P  V  +  HTDS G    N  +S  RA+ +    + +   + + +S +G 
Sbjct: 125 QLAQTMQQNPELVAQVVGHTDSTGQPAYNQTLSVNRAESVT-GYLGQRGVAPQRLSAQGL 183

Query: 158 AYKYPIDTNDTKVGRQNNQRIEIQI 182
               PI  N+T+ GR  N+R+EI +
Sbjct: 184 GQTQPIADNNTEAGRAANRRVEIYL 208


>gi|91782349|ref|YP_557555.1| OmpA/MotB family outer membrane protein [Burkholderia xenovorans
           LB400]
 gi|296162308|ref|ZP_06845102.1| OmpA/MotB domain protein [Burkholderia sp. Ch1-1]
 gi|91686303|gb|ABE29503.1| outer membrane protein, OmpA/MotB family [Burkholderia xenovorans
           LB400]
 gi|295887462|gb|EFG67286.1| OmpA/MotB domain protein [Burkholderia sp. Ch1-1]
          Length = 217

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 39/205 (19%), Positives = 77/205 (37%), Gaps = 24/205 (11%)

Query: 1   MIKELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRF----------------- 43
           ++  L +     + ++GC         V       T                        
Sbjct: 5   IMTRLAVFAVAGSLLAGCATQQGTNTAVGTGVGAGTGAALGAIFGGGKGAAIGAGVGAAV 64

Query: 44  ----GSSLDKAEDEFQMQLQDTGIVVSRIGDM-ITCYIPVHVSFVSEVF-LEKKFLPMLQ 97
               G +     ++     + TG  ++   D  +   IP  V+F +  + ++  F P+L 
Sbjct: 65  GGITGYNWQAIHNKLSGATKGTGTQITEQPDGSLKLNIPSSVTFDTNSYAVKPSFAPVLD 124

Query: 98  LIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGF 157
            +A  + + P  +  +  HTDS G    N  +S  RA+ +    + +   + + +S +G 
Sbjct: 125 QLAQTMQQNPELIAQVVGHTDSTGQPAYNQTLSVNRAESVT-GYLGQRGVAPQRLSAQGM 183

Query: 158 AYKYPIDTNDTKVGRQNNQRIEIQI 182
               PI  N+T+ GR  N+R+EI +
Sbjct: 184 GQTQPIADNNTEAGRAANRRVEIYL 208


>gi|126732859|ref|ZP_01748650.1| OmpA family protein [Sagittula stellata E-37]
 gi|126706635|gb|EBA05709.1| OmpA family protein [Sagittula stellata E-37]
          Length = 227

 Score =  116 bits (290), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 50/173 (28%), Positives = 79/173 (45%), Gaps = 3/173 (1%)

Query: 15  ISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITC 74
           ++       E+ +  L  +          G+ LDK E E + QL  + + +   GD +  
Sbjct: 56  LAAGNGDVGERNRSVLAGALIGAAAGAAIGNQLDKQEAELRQQL-GSQVDIRNTGDRLIV 114

Query: 75  YIPVHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQER 133
            +P  + F      L    L  +Q +A  + ++P+T   I  HTDS G    NL +SQ R
Sbjct: 115 TMPQDILFATDSATLSGGLLGDIQDVAQSVLRYPNTTTQIIGHTDSDGDAAYNLSLSQRR 174

Query: 134 ADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRG 186
           A  + +  + + V S+R I V G     PI +N T  G+Q N+R+EI I P  
Sbjct: 175 AQAVANVFLAQNVPSSR-IQVIGRGEDQPIASNLTPQGKQQNRRVEIVILPNA 226


>gi|154490195|ref|ZP_02030456.1| hypothetical protein PARMER_00427 [Parabacteroides merdae ATCC
           43184]
 gi|154089087|gb|EDN88131.1| hypothetical protein PARMER_00427 [Parabacteroides merdae ATCC
           43184]
          Length = 214

 Score =  116 bits (290), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 39/148 (26%), Positives = 68/148 (45%), Gaps = 2/148 (1%)

Query: 43  FGSSLDKAEDEFQMQL-QDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIA 100
            G  +DK + E +  L ++T +     G+ +       + F  +   +       L+ +A
Sbjct: 57  IGKKMDKQKKELEATLPEETTVETINNGEALKVTFDSGILFATNSSTVSAASKSALRDLA 116

Query: 101 TILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYK 160
             LN  P T I I  HTD+ G +  N  +S++RA  +  YL++    S++ ++  G    
Sbjct: 117 ASLNANPDTDIKIIGHTDNTGKVDYNQTLSEKRAKSVFDYLMEDQGVSSKRMTYEGKGVH 176

Query: 161 YPIDTNDTKVGRQNNQRIEIQIFPRGNI 188
            P+  N T  GR  N+R+EI I P   +
Sbjct: 177 EPVADNSTPEGRALNRRVEILILPNSKM 204


>gi|159045565|ref|YP_001534359.1| OmpA/MotB domain-containing protein [Dinoroseobacter shibae DFL 12]
 gi|157913325|gb|ABV94758.1| OmpA/MotB domain protein [Dinoroseobacter shibae DFL 12]
          Length = 208

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 46/203 (22%), Positives = 81/203 (39%), Gaps = 23/203 (11%)

Query: 5   LGLSMFIMTTISGCGLASR---------------------EKKKVFLHKSNDTDIVNKRF 43
           L  +   +  +S C +                        E ++  L  +     V    
Sbjct: 7   LIAACASLLALSACTVTEDNRRMATGAAIGALAGGALGATEDREKALIGAVVGAGVGAAI 66

Query: 44  GSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV-SEVFLEKKFLPMLQLIATI 102
           G  LD+   + Q +L +  + +   G  +   +P  + F      ++      L  ++  
Sbjct: 67  GDMLDRQARDLQAELGNDAVQIVNTGSELVVTMPQDILFAVDSAVVQSTLQSDLAALSRN 126

Query: 103 LNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYP 162
           L  +P T + +  HTD+ G+   N  +SQ RA  + + L+Q GV S+R +   G     P
Sbjct: 127 LLDYPDTTVQVVGHTDNTGSAGYNQELSQRRASAVAAILLQNGVPSSRVV-AFGRGEDQP 185

Query: 163 IDTNDTKVGRQNNQRIEIQIFPR 185
           I +N  + GR  N+R+EI I PR
Sbjct: 186 IASNLDEAGRAQNRRVEIIITPR 208


>gi|197117412|ref|YP_002137839.1| OmpA family outer membrane lipoprotein [Geobacter bemidjiensis Bem]
 gi|197086772|gb|ACH38043.1| OmpA family outer membrane lipoprotein [Geobacter bemidjiensis Bem]
          Length = 228

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 42/220 (19%), Positives = 80/220 (36%), Gaps = 35/220 (15%)

Query: 1   MIKELGLSMFIMTTISGCGLAS------------------------------REKKKVFL 30
           ++K +     +    +GC                                    + +   
Sbjct: 6   IVKLIVGMSAVALLATGCATNPDGSYEFKRTGIGALGGAALGAGAGALLGGKSHRGRNAA 65

Query: 31  HKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV-SEVFLE 89
                  +V    G  +D+     +  + +    V R GD +   +P  + F   +  L+
Sbjct: 66  IGGLTGAVVGGAVGQYMDRQAVALKKSMPE--AEVVRDGDKVYVALPSGILFDLGKDALK 123

Query: 90  KKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSN 149
            +    L   A  L     T I I+ HTDS G+   N  +S+ RA+ ++ YL+ +GV   
Sbjct: 124 PEAKDALSRAAGTLKD-SQTTITIEGHTDSTGSNAVNQPLSERRANRVRDYLVSQGVPGA 182

Query: 150 RFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGNIK 189
           +  +  G+    P   ND+   R  N+R++I++ P   +K
Sbjct: 183 KM-AAIGYGSSRPAVPNDSDANRALNRRVQIELTPNEKLK 221


>gi|28868377|ref|NP_790996.1| ompA family protein [Pseudomonas syringae pv. tomato str. DC3000]
 gi|213967171|ref|ZP_03395320.1| ompA family protein [Pseudomonas syringae pv. tomato T1]
 gi|301381094|ref|ZP_07229512.1| ompA family protein [Pseudomonas syringae pv. tomato Max13]
 gi|302062421|ref|ZP_07253962.1| ompA family protein [Pseudomonas syringae pv. tomato K40]
 gi|302133214|ref|ZP_07259204.1| ompA family protein [Pseudomonas syringae pv. tomato NCPPB 1108]
 gi|28851615|gb|AAO54691.1| ompA family protein [Pseudomonas syringae pv. tomato str. DC3000]
 gi|213928013|gb|EEB61559.1| ompA family protein [Pseudomonas syringae pv. tomato T1]
 gi|330965011|gb|EGH65271.1| ompA family protein [Pseudomonas syringae pv. actinidiae str.
           M302091]
 gi|331018068|gb|EGH98124.1| ompA family protein [Pseudomonas syringae pv. lachrymans str.
           M302278PT]
          Length = 229

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 50/220 (22%), Positives = 87/220 (39%), Gaps = 39/220 (17%)

Query: 3   KELGLSMFIMTTISGCGLAS-------------------------------------REK 25
           + L +    +  +SGC  ++                                       +
Sbjct: 5   RRLIIVATAVALLSGCATSNPYDNQGQAQSSGGMSKTAKYGGLGALAGAVAGAAIDHNNR 64

Query: 26  KKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VS 84
            K  L  +      +  +G   DK E   +  + +TG+ V R GD I   +P +++F   
Sbjct: 65  GKGALIGAAVAGAASAGYGYYADKQEAALRASMANTGVEVQRQGDQIKLIMPGNITFATD 124

Query: 85  EVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQR 144
              +   F   L  +A  L +F    I I  +TDS G+ ++N+ +SQ+RA  + +YL  +
Sbjct: 125 SSAIASSFYSPLNNLANSLKQFNQNNIEIIGYTDSTGSRQHNMDLSQQRAQSVATYLTSQ 184

Query: 145 GVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
                  +SVRG     PI +N    GR  N+R+E+ + P
Sbjct: 185 -GVDQSHLSVRGAGPDQPIASNADANGRAQNRRVEVNLKP 223


>gi|308449675|ref|XP_003088039.1| hypothetical protein CRE_17774 [Caenorhabditis remanei]
 gi|308250191|gb|EFO94143.1| hypothetical protein CRE_17774 [Caenorhabditis remanei]
          Length = 216

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 51/214 (23%), Positives = 90/214 (42%), Gaps = 35/214 (16%)

Query: 2   IKELGLSMF--IMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGS-------------- 45
           ++ L ++        +SGC         +   KS    ++    G               
Sbjct: 1   MRALLITTLTAGALVLSGCQTTGNNIGGMEYDKSAIGGLIGAAAGYGLSRGNANSSAQNN 60

Query: 46  ---------------SLDKAEDEFQMQLQDTGIVVSRIGDM-ITCYIPVHVSFV-SEVFL 88
                           LD  E + + Q+Q TG+ V+R  D  +   +P  ++F  ++  +
Sbjct: 61  RAAAIGALLGAGTGLYLDNKEKKLRQQMQGTGVEVNRNPDGSVALIMPGSITFDTNKSTI 120

Query: 89  EKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSS 148
           +  F   L  +A  L +   +VI +  +TD+ G    N+ +SQ RA  + +YL  +GV+S
Sbjct: 121 KPNFYGTLNKVAQTLMEDNKSVILVTGYTDNTGNDSINIPLSQNRAYSVANYLKGKGVAS 180

Query: 149 NRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
              I  +G+  + PI  N T  GR+ N+R+EI I
Sbjct: 181 --RIDTQGYGSQNPIADNSTAAGREQNRRVEISI 212


>gi|34763974|ref|ZP_00144866.1| Outer membrane porin F [Fusobacterium nucleatum subsp. vincentii
           ATCC 49256]
 gi|27886249|gb|EAA23533.1| Outer membrane porin F [Fusobacterium nucleatum subsp. vincentii
           ATCC 49256]
          Length = 172

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 50/177 (28%), Positives = 79/177 (44%), Gaps = 6/177 (3%)

Query: 11  IMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGD 70
           +   ++ C      KK      S +   V     +   K   E  +   + G+ + R G+
Sbjct: 1   MALLVTACSSTKTTKKTNVGVDSTNKYAVEDTEAN---KKPLEDIIVFNEEGVTIRREGN 57

Query: 71  MITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLI 129
            +   +P  + F   +  ++ K  P L  +A  L +     I I  +TD IGT   NL +
Sbjct: 58  NLILSMPELILFDFDKYVVKDKIKPSLSTLAKALGENKDIHIKIDGYTDFIGTEAYNLDL 117

Query: 130 SQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRG 186
           S +RA  IK +LI +G   +  IS+ G+  + P DTN T  GR  N+R+E  I  RG
Sbjct: 118 SVKRARAIKDFLISKGAIGSN-ISIEGYGEQNPADTNQTAAGRSRNRRVEF-IISRG 172


>gi|21674175|ref|NP_662240.1| OmpA family protein [Chlorobium tepidum TLS]
 gi|21647337|gb|AAM72582.1| OmpA family protein [Chlorobium tepidum TLS]
          Length = 231

 Score =  115 bits (289), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 42/147 (28%), Positives = 79/147 (53%), Gaps = 4/147 (2%)

Query: 45  SSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATIL 103
             +DK  DE + ++Q  G  V R+G+ I       + F      L       ++ +A IL
Sbjct: 79  DYMDKQADEIRQEVQ--GAKVERVGEGIRVVFDTGLLFSTDSATLNANSRYNIEKLARIL 136

Query: 104 NKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPI 163
           N++  T + I+ HTD+ GT  +N ++S+ RA+ + + L++    S R ++  G+    P+
Sbjct: 137 NRYNDTNVVIEGHTDNTGTEASNQILSERRAESV-ATLLRTYGVSGRRLTAIGYGETRPV 195

Query: 164 DTNDTKVGRQNNQRIEIQIFPRGNIKK 190
            TN+T+ GR+ N+R+E+ I+    +K+
Sbjct: 196 ATNETEAGRRLNRRVEVLIYANDALKR 222


>gi|264680876|ref|YP_003280786.1| OmpA/MotB [Comamonas testosteroni CNB-2]
 gi|299531878|ref|ZP_07045278.1| OmpA/MotB [Comamonas testosteroni S44]
 gi|262211392|gb|ACY35490.1| OmpA/MotB [Comamonas testosteroni CNB-2]
 gi|298720053|gb|EFI61010.1| OmpA/MotB [Comamonas testosteroni S44]
          Length = 219

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 51/218 (23%), Positives = 88/218 (40%), Gaps = 33/218 (15%)

Query: 1   MIKELGL--SMFIMTTISGCGLASREKKKV----------------------------FL 30
           M K++ +  ++     I+GC                                       L
Sbjct: 1   MRKQMAVTAALASALLITGCANTGGMSDTTRRTATGAGVGALGGAAIGAIAGGHAGKGAL 60

Query: 31  HKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDM-ITCYIPVHV-SFVSEVFL 88
             +    + +  +  +L+K + E +   Q TG+ V++  D  +   IP  +        +
Sbjct: 61  IGAGVGALGSYIWSQNLEKQKREMEAATQGTGVGVTQTADNQLKLDIPSDISFDTGRADI 120

Query: 89  EKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSS 148
           +  F P+L   A  L   P+  + I  HTDS G+   N  +S +RA+  ++YL  RGV+ 
Sbjct: 121 KGNFAPILDRFAEGLRNNPNAEVRIIGHTDSTGSDAINNPLSLQRAESTRNYLTSRGVNG 180

Query: 149 NRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRG 186
            R I V+G     P+ +N T  GR  N+R+EI +  R 
Sbjct: 181 AR-IQVQGMGSHQPVASNATNEGRARNRRVEIFVGERA 217


>gi|78221563|ref|YP_383310.1| thrombospondin type 3 repeat-containing OmpA/MotB protein
           [Geobacter metallireducens GS-15]
 gi|78192818|gb|ABB30585.1| Thrombospondin type 3 repeat:OmpA/MotB [Geobacter metallireducens
           GS-15]
          Length = 447

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 34/142 (23%), Positives = 64/142 (45%), Gaps = 5/142 (3%)

Query: 37  DIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPML 96
           D         LDK         ++  +  +   + +   + V   F  +  ++ +F   +
Sbjct: 299 DTDGDGVPDYLDKCP----DTPKNAAVDKNGCPEKVCITLKVEFDF-DKANIKPEFRDEI 353

Query: 97  QLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRG 156
           + +A  L ++P     I+ HTDS GT+K N  +S+ RA  +   L+     S + +S +G
Sbjct: 354 KRVADFLKEYPDATAVIEGHTDSKGTVKYNQKLSERRAKAVMKNLVDEFGISAKRLSAKG 413

Query: 157 FAYKYPIDTNDTKVGRQNNQRI 178
           +    P+  N T+ GRQ N+R+
Sbjct: 414 YGETKPVADNATEEGRQKNRRV 435


>gi|119385600|ref|YP_916655.1| OmpA/MotB domain-containing protein [Paracoccus denitrificans
           PD1222]
 gi|119376195|gb|ABL70959.1| OmpA/MotB domain protein [Paracoccus denitrificans PD1222]
          Length = 215

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 43/176 (24%), Positives = 76/176 (43%), Gaps = 2/176 (1%)

Query: 10  FIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIG 69
            I   + G  + + E +   +  +          GS LD+ +   Q  L +  I +   G
Sbjct: 39  AIAGAVVGGLIGAGESRSNAVKGAIIGATAGAVGGSILDQQQRSLQQSLNNPNIQIVNHG 98

Query: 70  DMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLL 128
             ++  +P    F      +  +    L  IA  L ++P++ I I  HTDS G+   N  
Sbjct: 99  THLSVVMPESTLFATDSAAVGAQGQNDLYTIARNLTQYPNSRIQIVGHTDSTGSAAYNQD 158

Query: 129 ISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           +S+ RA  + + ++  G  +   ++  G     P+ +NDT  GR  N+R+EI I P
Sbjct: 159 LSERRARSV-AGILTAGGVAQSRVTTLGRGATQPVASNDTAAGRAQNRRVEILITP 213


>gi|302381881|ref|YP_003817704.1| OmpA/MotB domain protein [Brevundimonas subvibrioides ATCC 15264]
 gi|302192509|gb|ADL00081.1| OmpA/MotB domain protein [Brevundimonas subvibrioides ATCC 15264]
          Length = 224

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 48/166 (28%), Positives = 84/166 (50%), Gaps = 2/166 (1%)

Query: 20  LASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVH 79
               + ++  L  +    +     G+ +D+ +   + +L  TG+ V+R GD +   +P  
Sbjct: 57  SDGEQGRRNALIGAGVGALGGAAVGNYMDRQQRALEAELSGTGVGVARQGDNLVLRMPSD 116

Query: 80  VSFV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIK 138
           V+F  ++  +E +F  +L  +A +L ++  +V+ I  HTDS G    N  +S+ RA  + 
Sbjct: 117 VTFAVNQSNIEPRFDAVLSDVAGVLQEYDRSVVDIVGHTDSSGGDAINQPLSERRALSVA 176

Query: 139 SYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
             LI RGV   R   V G + + P+ +N T  GR  N+R+EI I P
Sbjct: 177 DALIARGVIRERLF-VAGQSSRVPVASNATPEGRAQNRRVEILIRP 221


>gi|19703678|ref|NP_603240.1| Outer membrane porin F [Fusobacterium nucleatum subsp. nucleatum
           ATCC 25586]
 gi|19713798|gb|AAL94539.1| Outer membrane porin F [Fusobacterium nucleatum subsp. nucleatum
           ATCC 25586]
          Length = 172

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 49/177 (27%), Positives = 78/177 (44%), Gaps = 6/177 (3%)

Query: 11  IMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGD 70
           +   ++ C      KK      S +   V     +   K   E  +   + G+ + R G+
Sbjct: 1   MALLVTACSSTKTTKKTNVGVDSTNKYAVEDTEAN---KKPLEDIIVFNEEGVTIRREGN 57

Query: 71  MITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLI 129
            +   +P  + F   +  ++    P L  +A  L +     I I  +TD IGT   NL +
Sbjct: 58  NLILSMPELILFDFDKYAVKDGIKPSLSTLAKALGENKDIHIKIDGYTDFIGTEAYNLDL 117

Query: 130 SQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRG 186
           S +RA  IK +LI +G   +  IS+ G+  + P DTN T  GR  N+R+E  I  RG
Sbjct: 118 SVKRARAIKDFLISKGAIGSN-ISIEGYGEQNPADTNQTAAGRSRNRRVEF-IISRG 172


>gi|262369124|ref|ZP_06062453.1| conserved hypothetical protein [Acinetobacter johnsonii SH046]
 gi|262316802|gb|EEY97840.1| conserved hypothetical protein [Acinetobacter johnsonii SH046]
          Length = 216

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 50/213 (23%), Positives = 90/213 (42%), Gaps = 33/213 (15%)

Query: 2   IKELGL-SMFIMTTISGCGLASRE-----------------------------KKKVFLH 31
           ++ L + ++     ++GC                                     +    
Sbjct: 1   MRALAISAVVGAMVLTGCQSTGNNIGGVEYDKAALGTLIGAAAGYGISKGNANTSRQNNR 60

Query: 32  KSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDM-ITCYIPVHVSFVS-EVFLE 89
            +    +V    G  LD  E + + Q+  TG+ V+R  D  +   +P +++F + +  ++
Sbjct: 61  AAAIGAVVGGATGVYLDNKEKKLRQQMAGTGVEVNRNPDGSVGLIMPGNITFDTNKSNIK 120

Query: 90  KKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSN 149
             F   L  +A  L +   + I +  +TDS G    N+ +SQ RA  + SYL  +GVS+ 
Sbjct: 121 PNFYSTLNKVAQTLTEDNKSGILVTGYTDSTGNDSINIPLSQARAQSVASYLASQGVSTT 180

Query: 150 RFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           R I+ +G     PI +N T  GR+ N+R+EI I
Sbjct: 181 R-INAQGQGSANPIASNATAEGREQNRRVEISI 212


>gi|330951040|gb|EGH51300.1| OmpA/MotB [Pseudomonas syringae Cit 7]
          Length = 229

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 49/220 (22%), Positives = 86/220 (39%), Gaps = 39/220 (17%)

Query: 3   KELGLSMFIMTTISGCGLASREKKKVFLHKSND--------------------------- 35
           + L +    +  +SGC  ++    +     S                             
Sbjct: 5   RRLIIVAPAVAMLSGCATSNPYDNQGQAQSSGGMSKTAKYGGLGALAGAVAGAAIDHNHR 64

Query: 36  ----------TDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VS 84
                         +  +G   DK E   +  + +TG+ V R GD I   +P +++F   
Sbjct: 65  GKGALIGAAVAGAASAGYGYYADKQEAALRESMANTGVEVQRQGDQIKLIMPGNITFATD 124

Query: 85  EVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQR 144
              +   F   L  +A+ L +F    I I  +TDS G+ ++N+ +SQ+RA  + +YL  +
Sbjct: 125 SSAIASSFYSPLNNLASSLKQFNQNNIEIVGYTDSTGSRQHNMDLSQQRAQSVATYLTSQ 184

Query: 145 GVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
                  +SVRG     PI +N    GR  N+R+E+ + P
Sbjct: 185 -GVDQSHLSVRGAGPDQPIASNADVNGRAQNRRVEVNLKP 223


>gi|330811620|ref|YP_004356082.1| lipoprotein [Pseudomonas brassicacearum subsp. brassicacearum
           NFM421]
 gi|327379728|gb|AEA71078.1| Conserved hypothetical protein, putative lipoprotein [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
          Length = 244

 Score =  115 bits (287), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 47/219 (21%), Positives = 84/219 (38%), Gaps = 40/219 (18%)

Query: 3   KELGLSMFIMTTISGCGLAS--------------------------------------RE 24
           + L +    +  +SGC   +                                        
Sbjct: 5   RRLIVVATAVALLSGCASPNPYDNQGQASTESSGMSKTVKYGGLGALAGALAGAAIGHDN 64

Query: 25  KKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-V 83
           + K  L  +         +G   D+ E + +  + +TG+ V R GD I   +P +++F  
Sbjct: 65  RGKGALIGAAVVGASAAGYGYYADQQEKKLRASMANTGVEVQRQGDQIKLIMPGNITFAT 124

Query: 84  SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQ 143
               +   F   L  +A  L +F    I I  +TDS G+ ++N+ +SQ RA  + +YL  
Sbjct: 125 DSANIASSFYQPLNNLANSLKEFNQNQIEIVGYTDSTGSRQHNMDLSQRRAQSVATYLTS 184

Query: 144 RGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           +   S   +S RG     P+ +N    GR  N+R+E+ +
Sbjct: 185 Q-GVSGANLSARGAGPDNPVASNADVNGRAQNRRVEVNL 222


>gi|228474126|ref|ZP_04058867.1| inner membrane lipoprotein YiaD [Capnocytophaga gingivalis ATCC
           33624]
 gi|228274640|gb|EEK13481.1| inner membrane lipoprotein YiaD [Capnocytophaga gingivalis ATCC
           33624]
          Length = 231

 Score =  115 bits (287), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 40/223 (17%), Positives = 82/223 (36%), Gaps = 36/223 (16%)

Query: 1   MIKELGLSMFIMTTISGCGLASREKKK------------------------------VFL 30
           + K + L +   + +  C   +   K                                 +
Sbjct: 4   VFKNITLFLVAASLLVSCEAYNNSNKTQRGAVIGAAGGAILGAILGNNVGSGGNSELGAV 63

Query: 31  HKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVH---VSFVSEVF 87
             +          G+ +D+   + + ++   G  V R+ D I              ++  
Sbjct: 64  IGTAVGGAAGAVIGNQMDRQAKKIEEEIP--GAEVKRVDDGIVVTFDEKSGVTFEFNKAD 121

Query: 88  LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVS 147
           L  +   +L  +A +L ++P T + +  HTDS G    N+ +S+ RA  + ++    G+ 
Sbjct: 122 LTSEAKTLLTKMAGVLKEYPDTNVIVAGHTDSKGKPAYNMGLSERRAKAVTNFFTASGLK 181

Query: 148 SNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGNIKK 190
           ++R  + + F    P   N T+ GR  N+R+ I I P   +K+
Sbjct: 182 ASR-FTTKWFGATQPAYDNSTEEGRAKNRRVNIAIVPNEKMKE 223


>gi|70732413|ref|YP_262169.1| OmpA family protein [Pseudomonas fluorescens Pf-5]
 gi|68346712|gb|AAY94318.1| OmpA family protein [Pseudomonas fluorescens Pf-5]
          Length = 252

 Score =  115 bits (287), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 48/219 (21%), Positives = 84/219 (38%), Gaps = 40/219 (18%)

Query: 3   KELGLSMFIMTTISGCGLAS--------------------------------------RE 24
           + L +    +  +SGC   +                                        
Sbjct: 5   RRLIVVATAVALLSGCASPNPYDNQGQADGGSSGMSKTAKYGGLGALAGALAGAAIDHNN 64

Query: 25  KKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-V 83
           + K  L  +         +G   D+ E + +  + +TG+ V R GD I   +P +++F  
Sbjct: 65  RGKGALIGAAVVGASAAGYGYYADQQEKKLRASMANTGVEVQRQGDQIKLIMPGNITFAT 124

Query: 84  SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQ 143
               +   F   L  +A  L +F    I I  +TDS G+ ++N+ +SQ RA  + +YL  
Sbjct: 125 DSANIAPSFYQPLNNLANSLREFNQNQIEIVGYTDSTGSRQHNMDLSQRRAQSVATYLTS 184

Query: 144 RGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           +   S   +S RG     PI +N    GR  N+R+E+ +
Sbjct: 185 Q-GVSGSNLSARGAGPDNPIASNADVNGRAQNRRVEVNL 222


>gi|312795362|ref|YP_004028284.1| OmpA family protein [Burkholderia rhizoxinica HKI 454]
 gi|312167137|emb|CBW74140.1| OmpA family protein [Burkholderia rhizoxinica HKI 454]
          Length = 224

 Score =  115 bits (287), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 48/220 (21%), Positives = 79/220 (35%), Gaps = 34/220 (15%)

Query: 1   MIKELGL--------SMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRF--------- 43
           M  +L L               ++GC         V       T                
Sbjct: 5   MNAKLTLRLPLQWSVLAVAGALLAGCQTPQGGNAAVGTGVGAATGAGLGAIFGGGKGAAI 64

Query: 44  ------------GSSLDKAEDEFQMQLQDTGIVVSRIGDM-ITCYIPVHVSFVSEVF-LE 89
                       G +    +++       TG  VS   D  +   IP  VSF +  + ++
Sbjct: 65  GAAAGAAVGGMTGYNWQAIKNKLSGATAGTGTQVSEQPDGSLKLNIPSSVSFDTNSYAIK 124

Query: 90  KKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSN 149
             F P+L  +A  L + P  V  +  HTDS G  + N ++SQERA  +    +     + 
Sbjct: 125 PSFTPVLDQVAQTLTQHPELVAHVVGHTDSTGQPRYNQMLSQERAQSVAQ-YLALHGVAA 183

Query: 150 RFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGNIK 189
           + ++  G     PI  N T+ GR  N+R+EI +  R  ++
Sbjct: 184 QRLAAEGRGQSQPIADNSTEAGRAQNRRVEIYL--RATLQ 221


>gi|294649621|ref|ZP_06727038.1| OmpA family protein [Acinetobacter haemolyticus ATCC 19194]
 gi|292824498|gb|EFF83284.1| OmpA family protein [Acinetobacter haemolyticus ATCC 19194]
          Length = 217

 Score =  115 bits (287), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 48/217 (22%), Positives = 89/217 (41%), Gaps = 34/217 (15%)

Query: 2   IKELGLSMFIM--TTISGCGLASRE-----------------------------KKKVFL 30
           ++ L +S  +     +SGC                                     K   
Sbjct: 1   MRALMISTLVGAGLVLSGCQTTDNNIGGVEYDKAALGALIGAAAGYGVSKGNANTSKQNN 60

Query: 31  HKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDM-ITCYIPVHVSFVS-EVFL 88
             +    ++    G  LD  E + + Q+Q TG+ V R  D  +   +P  ++F + +  +
Sbjct: 61  RAAAIGAVLGGAGGLYLDNKEKKLRQQMQGTGVDVGRNPDGSVQLIMPGSITFDTNKSNI 120

Query: 89  EKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSS 148
           +  F   L  +A +L +   + I +  +TD+ G    N+ +SQ RA  +K+YL  +   +
Sbjct: 121 KPNFYATLNKVAQVLGEDNQSAILVTGYTDNTGNDSINIPLSQARAQSVKNYLAGK-GIA 179

Query: 149 NRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPR 185
           +  I  +G+    PI  N T  GR+ N+R+EI I+ +
Sbjct: 180 SNRIDAQGYGSSNPIADNSTAAGREQNRRVEISIYAK 216


>gi|262165460|ref|ZP_06033197.1| outer membrane protein [Vibrio mimicus VM223]
 gi|262025176|gb|EEY43844.1| outer membrane protein [Vibrio mimicus VM223]
          Length = 193

 Score =  115 bits (287), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 53/168 (31%), Positives = 94/168 (55%), Gaps = 3/168 (1%)

Query: 19  GLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIG-DMITCYIP 77
           G  ++E++K  L  +     V    G   D+ E E +  L D+G+ V R+G + +   + 
Sbjct: 25  GDDAKERRKHALIGAAGGAAVGGGIGYYFDQQEAELRKALLDSGVQVVRVGENQLMLRME 84

Query: 78  VHVSFVSEVF-LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADV 136
             + F S  + L+      L+ +A IL  +P T + I+ HTDS G+   N ++S++RA+ 
Sbjct: 85  NGIGFTSSSYQLDSYIHKTLRGVARILVAYPDTSLVIEGHTDSTGSDTTNQVLSEKRAES 144

Query: 137 IKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           ++++L+ +GV++ R I  RG   ++P+ +N T  GR  N+R+EIQI P
Sbjct: 145 VRAFLLSQGVAAGRAI-ARGNGERFPLCSNSTAEGRACNRRVEIQILP 191


>gi|224437727|ref|ZP_03658674.1| OmpA family protein [Helicobacter cinaedi CCUG 18818]
          Length = 147

 Score =  115 bits (287), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 46/138 (33%), Positives = 76/138 (55%), Gaps = 4/138 (2%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV-SEVFLEKKFLPMLQLIATILNK 105
           +D  + + + +LQ TG+ VSR GD I   +P  ++F      L   F  +L     +LNK
Sbjct: 1   MDYQDKQLRKELQGTGVSVSREGDGIILNMPGDITFKSGSDDLSSDFYKVLNK--KVLNK 58

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +  T++ +   TD+ G+ K NL +S++RA+ + +YL  + V + RF+ V G     PI +
Sbjct: 59  YDKTIVTVVGFTDNTGSDKTNLALSKKRAESVAAYLQNQKVKTERFV-VDGLGESEPIAS 117

Query: 166 NDTKVGRQNNQRIEIQIF 183
           N T  GR  N+R+EI + 
Sbjct: 118 NKTAEGRAKNRRVEISLT 135


>gi|160896293|ref|YP_001561875.1| OmpA/MotB domain-containing protein [Delftia acidovorans SPH-1]
 gi|160361877|gb|ABX33490.1| OmpA/MotB domain protein [Delftia acidovorans SPH-1]
          Length = 244

 Score =  114 bits (286), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 54/211 (25%), Positives = 90/211 (42%), Gaps = 30/211 (14%)

Query: 1   MIKELGLSMFIM--TTISGCGLASREKK-------------------------KVFLHKS 33
           M K + L+        ISGC   S  ++                            +  +
Sbjct: 1   MRKHIVLAAATAAALFISGCANMSDTQRRTATGAGVGAAAGAVLGAVTGGRAGTGAVIGA 60

Query: 34  NDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDM-ITCYIPVHVSFVSE-VFLEKK 91
               +    +  +++K + E +   Q TG+ VS+  D  +   IP  +SF +    ++  
Sbjct: 61  GVGALGTYIWSQNMEKQKREMEQATQGTGVNVSQTADNQLKLDIPSDISFDTNRSDIKGN 120

Query: 92  FLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRF 151
           F P+L   A  L   P+  + I  HTDS G+   N  +S +RA+  ++YL  RGVS  R 
Sbjct: 121 FAPILDRFAEGLRNNPNAEVRIIGHTDSTGSDAINNPLSLDRANSTRNYLTMRGVSGAR- 179

Query: 152 ISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           I+  G     P+ +ND+  GR  N+R+EI +
Sbjct: 180 IATEGRGSHQPVASNDSASGRAMNRRVEIFV 210


>gi|262373228|ref|ZP_06066507.1| inner membrane lipoprotein yiaD [Acinetobacter junii SH205]
 gi|262313253|gb|EEY94338.1| inner membrane lipoprotein yiaD [Acinetobacter junii SH205]
          Length = 220

 Score =  114 bits (286), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 47/180 (26%), Positives = 84/180 (46%), Gaps = 3/180 (1%)

Query: 8   SMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSR 67
           ++       G    +          +    I+    G  LD  E + + Q+  TG+ V R
Sbjct: 41  TLIGAAAGYGISKGNANSSSQNNRAAAIGAILGGASGLYLDNKEKKLRAQMAGTGVEVGR 100

Query: 68  IGDM-ITCYIPVHVSFVS-EVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKN 125
             D  +   +P  ++F + +  ++  F   L  +A  L +   + I +  +TD+ G    
Sbjct: 101 NPDGSVQLIMPGSITFDTNKSNIKPNFYGTLNKVAQTLAEDNKSAILVTGYTDNTGNDSI 160

Query: 126 NLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPR 185
           N+ +SQ RA  +K+YL  +GVSS+R I  +G     PI +N T  G++ N+R+EI I+ +
Sbjct: 161 NIPLSQARAQSVKNYLASQGVSSSR-IDAQGLGSSNPIASNATAAGKEQNRRVEISIYAK 219


>gi|77460924|ref|YP_350431.1| OmpA/MotB [Pseudomonas fluorescens Pf0-1]
 gi|77384927|gb|ABA76440.1| putative OmpA family outer membrane protein [Pseudomonas
           fluorescens Pf0-1]
          Length = 237

 Score =  114 bits (286), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 48/219 (21%), Positives = 84/219 (38%), Gaps = 40/219 (18%)

Query: 3   KELGLSMFIMTTISGCGLAS--------------------------------------RE 24
           + L +    +  +SGC   +                                        
Sbjct: 5   RRLIIVATAVAVLSGCASPNPYDNQGQADSGSQGMSKTAKYGGLGALAGALAGAAIDHNN 64

Query: 25  KKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-V 83
           + K  L  +         +G   D+ E + +  + +TG+ V R GD I   +P +++F  
Sbjct: 65  RGKGALIGAAVVGASAAGYGYYADQQEKKLRASMANTGVEVQRQGDQIKLIMPGNITFAT 124

Query: 84  SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQ 143
               +   F   L  +A  L +F    I I  +TDS G+ ++N+ +SQ RA  + +YL  
Sbjct: 125 DSANIASSFYQPLNNLANSLKEFNQNQIEIVGYTDSTGSRQHNMDLSQRRAQSVATYLTS 184

Query: 144 RGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           +   S   +S RG     PI +N    GR  N+R+E+ +
Sbjct: 185 Q-GVSGANLSARGAGPDNPIASNGDVNGRAQNRRVEVNL 222


>gi|302189107|ref|ZP_07265780.1| OmpA/MotB [Pseudomonas syringae pv. syringae 642]
          Length = 229

 Score =  114 bits (286), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 51/220 (23%), Positives = 89/220 (40%), Gaps = 39/220 (17%)

Query: 3   KELGLSMFIMTTISGCGLASREKKKVFLHKSND--------------------------- 35
           + L +    +  +SGC  ++    +     S                             
Sbjct: 5   RRLIIVATAVAMLSGCATSNPYDNQGQAQSSGGMSKTAKYGGLGALAGAVAGAAIDHNHR 64

Query: 36  ----------TDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VS 84
                         +  +G   DK E   +  + +TG+ V R GD I   +P +++F   
Sbjct: 65  GKGALIGAAVAGAASAGYGYYADKQEAALRESMANTGVEVQRQGDQIKLIMPGNITFATD 124

Query: 85  EVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQR 144
              +   F   L  +A+ L +F    I I  +TDS G+ ++N+ +SQ+RA  + +YL  +
Sbjct: 125 SSAIASSFYSPLNNLASSLKQFNQNNIEIVGYTDSTGSRQHNMDLSQQRAQSVATYLTSQ 184

Query: 145 GVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           GV  +  +SVRG     PI +N    GR  N+R+E+ + P
Sbjct: 185 GVDQSH-LSVRGAGPDQPIASNADVNGRAQNRRVEVNLKP 223


>gi|237799776|ref|ZP_04588237.1| OmpA/MotB [Pseudomonas syringae pv. oryzae str. 1_6]
 gi|331022631|gb|EGI02688.1| OmpA/MotB [Pseudomonas syringae pv. oryzae str. 1_6]
          Length = 229

 Score =  114 bits (286), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 49/220 (22%), Positives = 86/220 (39%), Gaps = 39/220 (17%)

Query: 3   KELGLSMFIMTTISGCGLASREKKKVFLHKSND--------------------------- 35
           + L +    +  +SGC  ++    +     S                             
Sbjct: 5   RRLIIVATAVAMLSGCATSNPYDNQGQAQSSGGMRKTAKYGGLGALAGAVAGAAIDHNHR 64

Query: 36  ----------TDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VS 84
                         +  +G   DK E   +  + +TG+ V R GD I   +P +++F   
Sbjct: 65  GKGALIGAAVAGAASAGYGYYADKQEAALRESMANTGVEVQRQGDQIKLIMPGNITFATD 124

Query: 85  EVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQR 144
              +   F   L  +A+ L +F    I I  +TDS G+ ++N+ +SQ+RA  + +YL  +
Sbjct: 125 SSAIASSFYSPLNNLASSLKQFNQNNIEIVGYTDSTGSRQHNMDLSQQRAQSVATYLTSQ 184

Query: 145 GVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
                  +SVRG     PI +N    GR  N+R+E+ + P
Sbjct: 185 -GVDQTHLSVRGAGPDQPIASNADVNGRAQNRRVEVNLKP 223


>gi|119357472|ref|YP_912116.1| OmpA/MotB domain-containing protein [Chlorobium phaeobacteroides
           DSM 266]
 gi|119354821|gb|ABL65692.1| OmpA/MotB domain protein [Chlorobium phaeobacteroides DSM 266]
          Length = 229

 Score =  114 bits (286), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 48/211 (22%), Positives = 88/211 (41%), Gaps = 29/211 (13%)

Query: 6   GLSMFIMTTIS-GCGLASREKKKVFLHKSND---TDIVNKRFG----------------- 44
            L + +MTT + GC   +   +   +   +      I+    G                 
Sbjct: 13  FLLILVMTTFTWGCSTTTNAGRGAGIGAGSGALIGGIIGSVSGSWVKGALIGAAIGGGAG 72

Query: 45  ----SSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV-SEVFLEKKFLPMLQLI 99
               + +DK   E    +   G  V RIG+ I       + F      +       ++ +
Sbjct: 73  ALIGNYMDKQAAEIDRNV--EGAEVERIGEGIRVVFDSGILFNTGSSAITSTSRYNIEKL 130

Query: 100 ATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAY 159
           A IL K+  T + I+ HTDS+G+   N  +S+ RA  + + L++    S+  +S  G+  
Sbjct: 131 AGILAKYDDTNLIIEGHTDSVGSDSMNQTLSENRAQSVAN-LLKAYGVSSSRLSAIGYGE 189

Query: 160 KYPIDTNDTKVGRQNNQRIEIQIFPRGNIKK 190
             PI +N+T+ GR+ N+R+E+ I     +K+
Sbjct: 190 SRPIASNETESGRRLNRRVEVLITANNELKR 220


>gi|262039107|ref|ZP_06012440.1| inner membrane lipoprotein YiaD [Leptotrichia goodfellowii F0264]
 gi|261746896|gb|EEY34402.1| inner membrane lipoprotein YiaD [Leptotrichia goodfellowii F0264]
          Length = 164

 Score =  114 bits (286), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 54/165 (32%), Positives = 85/165 (51%), Gaps = 3/165 (1%)

Query: 23  REKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDM-ITCYIPVHVS 81
            +  K  L  +     V    G+  D+ E E + +L  +G+ V R G+  I    P +++
Sbjct: 1   GKDTKGTLIGTAGGAAVGAVIGNIFDRQEKELKNRLDGSGVKVERTGEGEIKLTAPENIT 60

Query: 82  FVS-EVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSY 140
           F +    ++ +F   L  +A +L K+P + I +  HTDS G    N  +S  RA  +KSY
Sbjct: 61  FDTNSSVIKSRFTGSLNSVADVLKKYPDSNIIVSGHTDSTGNDSINNPLSVNRAASVKSY 120

Query: 141 LIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPR 185
           L+  GV S+R  SV G+  K PI +N T  GR  N+R+EI+I  +
Sbjct: 121 LVGAGVPSSRITSV-GYGSKEPIASNSTANGRAQNRRVEIKIVAK 164


>gi|241764375|ref|ZP_04762401.1| OmpA/MotB domain protein [Acidovorax delafieldii 2AN]
 gi|241366218|gb|EER60782.1| OmpA/MotB domain protein [Acidovorax delafieldii 2AN]
          Length = 215

 Score =  114 bits (285), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 49/210 (23%), Positives = 81/210 (38%), Gaps = 29/210 (13%)

Query: 1   MIKELGLSMFIMTTIS-GCGLASREKKKVFLHKSNDTDIVNKR----------------- 42
           M K L   +  +  ++ GC   S  +++                                
Sbjct: 1   MRKYLIPGVAAVVLLASGCADMSDTQRRTATGAGVGALAGAVLGSATGGHAGTGAVVGAG 60

Query: 43  --------FGSSLDKAEDEFQMQLQDTGIVVSRIGDM-ITCYIPVHVSFV-SEVFLEKKF 92
                   +  ++++ + E +   + TGI VS+  D  +   IP  +SF      ++  F
Sbjct: 61  VGALGTYIWSQNMERQKREMEQATRGTGIAVSQTQDNQLKLDIPSDISFAVGRADIQPNF 120

Query: 93  LPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFI 152
            P+L   A  L   P T + I  HTD+ G+   N  +S  RA   ++  +       R I
Sbjct: 121 APVLDRFAEGLRAHPETDVRIVGHTDNTGSDAVNDPLSVNRASSTRN-YLMNRGVDGRRI 179

Query: 153 SVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           SV G   + PI TN T  GR  N+R+EI +
Sbjct: 180 SVEGMGERQPIATNATAEGRSRNRRVEIFV 209


>gi|312959042|ref|ZP_07773561.1| OmpA/MotB [Pseudomonas fluorescens WH6]
 gi|311286812|gb|EFQ65374.1| OmpA/MotB [Pseudomonas fluorescens WH6]
          Length = 256

 Score =  114 bits (285), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 48/222 (21%), Positives = 85/222 (38%), Gaps = 41/222 (18%)

Query: 3   KELGLSMFIMTTISGCGLAS---------------------------------------R 23
           + L +    +  +SGC   +                                        
Sbjct: 5   RRLLVVATAVALLSGCASPNPYDGSQGQANNEPSGMSKTAKYGGLGALAGALAGAAIDHN 64

Query: 24  EKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV 83
            + K  L  +         +G   D+ E + +  + +TG+ V R GD I   +P +++F 
Sbjct: 65  NRGKGALIGAVVAGAGAAGYGYYADQQEKKLRESMANTGVEVQRQGDQIKLIMPGNITFA 124

Query: 84  SEVF-LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLI 142
           +    +   F   L  +A  L +F    I I  +TDS G+ + N+ +SQ RA  + +YL 
Sbjct: 125 TNSDAISSSFYQPLNNLANSLKQFNQNTIQIVGYTDSTGSRQLNMDLSQRRAQSVANYLT 184

Query: 143 QRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
            +   +   +S RG     PI +N    GR  N+R+E+ + P
Sbjct: 185 SQ-GVNGANLSARGAGPDNPIASNADVNGRAQNRRVEVNLGP 225


>gi|294828058|ref|NP_712396.2| endoflagellar motor protein B [Leptospira interrogans serovar Lai
           str. 56601]
 gi|304570492|ref|YP_001665.2| motility protein B [Leptospira interrogans serovar Copenhageni str.
           Fiocruz L1-130]
 gi|293385905|gb|AAN49414.2| endoflagellar motor protein B [Leptospira interrogans serovar Lai
           str. 56601]
          Length = 336

 Score =  114 bits (285), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 40/150 (26%), Positives = 70/150 (46%), Gaps = 5/150 (3%)

Query: 41  KRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHV-SFVSEVFLEKKFLPMLQLI 99
            R     ++ E++   +++   I + R  D +   I   +        L+K+ LP L  I
Sbjct: 187 DRLSDQANELENKLTDEIKKGQIRLKRFHDRLVINIDDKISFDSGSADLKKQILPALDKI 246

Query: 100 ATILNKFPSTVIAIQSHTDSIGTL----KNNLLISQERADVIKSYLIQRGVSSNRFISVR 155
             IL  +P  +I I+ HTD++        +N  +S ERA  +  Y ++  +   R  S+ 
Sbjct: 247 KEILGNYPGNLIIIEGHTDNVPIRTKKFSDNWQLSGERALSVLHYFLESKILDPRNFSLA 306

Query: 156 GFAYKYPIDTNDTKVGRQNNQRIEIQIFPR 185
           G+    PI +NDT   R  N+R++I + PR
Sbjct: 307 GYGEFQPIVSNDTPENRALNRRVDIVVVPR 336


>gi|330873229|gb|EGH07378.1| ompA family protein [Pseudomonas syringae pv. morsprunorum str.
           M302280PT]
          Length = 229

 Score =  114 bits (285), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 50/220 (22%), Positives = 87/220 (39%), Gaps = 39/220 (17%)

Query: 3   KELGLSMFIMTTISGCGLAS-------------------------------------REK 25
           + L +    +  +SGC  ++                                       +
Sbjct: 5   RRLIIVATAVALLSGCATSNPYDNQGQAQSSGGMSKTAKYGGLGALAGAVAGAAIDHNNR 64

Query: 26  KKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VS 84
            K  L  +      +  +G   DK E   +  + +TG+ V R GD I   +P +++F   
Sbjct: 65  GKGALIGAAVAGAASAGYGYYADKQEAALRASMANTGVEVQRQGDQIKLIMPGNITFATD 124

Query: 85  EVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQR 144
              +   F   L  +A  L +F    I I  +TDS G+ ++N+ +SQ+RA  + +YL  +
Sbjct: 125 SSAIASSFYSPLNNLANSLKQFNQNNIEIIGYTDSTGSRQHNMDLSQQRAQSVATYLTSQ 184

Query: 145 GVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
                  +SVRG     PI +N    GR  N+R+E+ + P
Sbjct: 185 -GVDQSHLSVRGAGPDQPIASNADTNGRAQNRRVEVNLKP 223


>gi|71733414|ref|YP_273324.1| ompA family protein [Pseudomonas syringae pv. phaseolicola 1448A]
 gi|289627857|ref|ZP_06460811.1| ompA family protein [Pseudomonas syringae pv. aesculi str.
           NCPPB3681]
 gi|289648335|ref|ZP_06479678.1| ompA family protein [Pseudomonas syringae pv. aesculi str. 2250]
 gi|71553967|gb|AAZ33178.1| ompA family protein [Pseudomonas syringae pv. phaseolicola 1448A]
 gi|330868443|gb|EGH03152.1| ompA family protein [Pseudomonas syringae pv. aesculi str. 0893_23]
 gi|330988549|gb|EGH86652.1| ompA family protein [Pseudomonas syringae pv. lachrymans str.
           M301315]
 gi|331008919|gb|EGH88975.1| ompA family protein [Pseudomonas syringae pv. tabaci ATCC 11528]
          Length = 229

 Score =  114 bits (285), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 51/220 (23%), Positives = 88/220 (40%), Gaps = 39/220 (17%)

Query: 3   KELGLSMFIMTTISGCGLASREKKKVFLHKSND--------------------------- 35
           + L +    +  +SGC  ++    +     S                             
Sbjct: 5   RRLIIVATAVAMLSGCATSNPYDNQGQAQSSGGMSKTAKYGGLGALAGAVAGAAIDHNHR 64

Query: 36  ----------TDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VS 84
                         +  +G   DK E   +  + +TG+ V R GD I   +P +++F   
Sbjct: 65  GKGALIGAAVAGAASAGYGYYADKQEAALRASMANTGVEVQRQGDQIKLIMPGNITFATD 124

Query: 85  EVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQR 144
              +   F   L  +A  L +F    I I  +TDS G+ ++N+ +SQ+RA  + +YL  +
Sbjct: 125 SSAIASSFYSPLNNLANSLKQFNQNNIEIVGYTDSTGSRQHNMDLSQQRAQSVATYLTSQ 184

Query: 145 GVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           GV  +  +SVRG     PI +N    GR  N+R+E+ + P
Sbjct: 185 GVDQSH-LSVRGAGPDQPIASNADVNGRAQNRRVEVNLKP 223


>gi|298485733|ref|ZP_07003812.1| Outer membrane protein [Pseudomonas savastanoi pv. savastanoi NCPPB
           3335]
 gi|298159759|gb|EFI00801.1| Outer membrane protein [Pseudomonas savastanoi pv. savastanoi NCPPB
           3335]
          Length = 229

 Score =  113 bits (284), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 50/220 (22%), Positives = 87/220 (39%), Gaps = 39/220 (17%)

Query: 3   KELGLSMFIMTTISGCGLASREKKKVFLHKSND--------------------------- 35
           + L +    +  +SGC  ++    +     S                             
Sbjct: 5   RRLIIVATAVAMLSGCATSNPYDNQGQAQSSGGMSKTAKYGGLGALAGAVAGAAIDHNHR 64

Query: 36  ----------TDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VS 84
                         +  +G   DK E   +  + +TG+ V R GD I   +P +++F   
Sbjct: 65  GKGALIGAAVAGAASAGYGYYADKQEAALRASMANTGVEVQRQGDQIKLIMPGNITFATD 124

Query: 85  EVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQR 144
              +   F   L  +A  L +F    I I  +TDS G+ ++N+ +SQ+RA  + +YL  +
Sbjct: 125 SSAIASSFYSPLNNLANSLKQFNQNNIEIVGYTDSTGSRQHNMDLSQQRAQSVATYLTSQ 184

Query: 145 GVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
            V  +  +SVRG     PI +N    GR  N+R+E+ + P
Sbjct: 185 VVDQSH-LSVRGAGPDQPIASNADVNGRAQNRRVEVNLKP 223


>gi|292490769|ref|YP_003526208.1| OmpA/MotB domain protein [Nitrosococcus halophilus Nc4]
 gi|291579364|gb|ADE13821.1| OmpA/MotB domain protein [Nitrosococcus halophilus Nc4]
          Length = 301

 Score =  113 bits (284), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 43/173 (24%), Positives = 66/173 (38%), Gaps = 10/173 (5%)

Query: 17  GC---GLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQD-----TGIVVSRI 68
           GC            +         +     G  LD   D     +        G+ V  +
Sbjct: 126 GCPLDSDGDGVPDYLDQCPDTPPGVAVNSEGCPLDSDGDGVTDDVDQCPDTPAGVEVDEV 185

Query: 69  GDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNL 127
           G      +   V F      L  +   +L   A  L   P   + I+ HTDS+G    N 
Sbjct: 186 GCPEPVVLEGGVHFAFDSAKLTPEARDILDETADSLRTHPDLEVTIEGHTDSVGNADYNK 245

Query: 128 LISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEI 180
            +SQ RA+   +YL+ +GV  +R +   G+    PI +N TK GR  N+R+E+
Sbjct: 246 RLSQLRAEAAMNYLVSQGVDQSR-LEAVGYGEAQPIASNKTKEGRAQNRRVEL 297


>gi|295675817|ref|YP_003604341.1| OmpA/MotB domain protein [Burkholderia sp. CCGE1002]
 gi|295435660|gb|ADG14830.1| OmpA/MotB domain protein [Burkholderia sp. CCGE1002]
          Length = 217

 Score =  113 bits (284), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 40/205 (19%), Positives = 78/205 (38%), Gaps = 24/205 (11%)

Query: 1   MIKELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKR------------------ 42
           ++  + +     + ++GC         V                                
Sbjct: 5   IMTRVAVLAVAGSLVAGCATQQGTNTAVGTGVGAGAGAALGAIFGGGKGAAIGAATGAAV 64

Query: 43  ---FGSSLDKAEDEFQMQLQDTGIVVSRIGDM-ITCYIPVHVSFVSEVF-LEKKFLPMLQ 97
               G + D   +      + TG  ++   D  +   IP  V+F +  + ++  F P+L 
Sbjct: 65  GGITGYNWDNIRNRMSGATKGTGTQITEQPDGSLKLNIPSSVTFDTSSYAIKPTFAPVLD 124

Query: 98  LIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGF 157
            +A  L + P  V ++  HTD+ G+L+ N  +S  RA  +    + +   + + +S  G 
Sbjct: 125 QLAQTLQQNPEVVASVVGHTDNTGSLQYNQTLSVNRAQSVT-GYLTQRGIAPQRLSATGM 183

Query: 158 AYKYPIDTNDTKVGRQNNQRIEIQI 182
               PI  N+T+ GR  N+R+EI +
Sbjct: 184 GPNQPIADNNTEAGRAANRRVEIYL 208


>gi|66044258|ref|YP_234099.1| OmpA/MotB [Pseudomonas syringae pv. syringae B728a]
 gi|63254965|gb|AAY36061.1| OmpA/MotB [Pseudomonas syringae pv. syringae B728a]
 gi|330945118|gb|EGH46848.1| OmpA/MotB [Pseudomonas syringae pv. pisi str. 1704B]
 gi|330969323|gb|EGH69389.1| OmpA/MotB [Pseudomonas syringae pv. aceris str. M302273PT]
          Length = 229

 Score =  113 bits (284), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 49/220 (22%), Positives = 86/220 (39%), Gaps = 39/220 (17%)

Query: 3   KELGLSMFIMTTISGCGLASREKKKVFLHKSND--------------------------- 35
           + L +    +  +SGC  ++    +     S                             
Sbjct: 5   RRLIIVATAVAMLSGCATSNPYDNQGQAQSSGGMSKTAKYGGLGALAGAVAGAAIDHNHR 64

Query: 36  ----------TDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VS 84
                         +  +G   DK E   +  + +TG+ V R GD I   +P +++F   
Sbjct: 65  GKGALIGAAVAGAASAGYGYYADKQEAALRESMANTGVEVQRQGDQIKLIMPGNITFATD 124

Query: 85  EVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQR 144
              +   F   L  +A+ L +F    I I  +TDS G+ ++N+ +SQ+RA  + +YL  +
Sbjct: 125 SSAIASSFYSPLNNLASSLKQFNQNNIEIVGYTDSTGSRQHNMDLSQQRAQSVATYLTSQ 184

Query: 145 GVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
                  +SVRG     PI +N    GR  N+R+E+ + P
Sbjct: 185 -GVDQAHLSVRGAGPDQPIASNADVNGRAQNRRVEVNLKP 223


>gi|258405399|ref|YP_003198141.1| OmpA/MotB domain-containing protein [Desulfohalobium retbaense DSM
           5692]
 gi|257797626|gb|ACV68563.1| OmpA/MotB domain protein [Desulfohalobium retbaense DSM 5692]
          Length = 227

 Score =  113 bits (284), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 39/212 (18%), Positives = 83/212 (39%), Gaps = 37/212 (17%)

Query: 4   ELGLSMFIMTTISGCGLASREKKK-----------------------------VFLHKSN 34
            +   + +   ++GC  A  ++++                                  + 
Sbjct: 7   SIVCVLALALVLAGCATAPNQQQRGTAIGTAAGAGVGAILGQAIGKDTKGTLIGAGIGAV 66

Query: 35  DTDIVNKRFGSSLDKAEDEFQMQLQDT-GIVVSRIGDMITCYIPVHVSF-VSEVFLEKKF 92
              I   R G+ +D+ E E +  L       V R  D++      +V F      ++   
Sbjct: 67  LGGIAGNRVGAYMDRQEQELRNALAQERAASVRREQDILRATFDSNVLFDFDSARVKPGG 126

Query: 93  LPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFI 152
           +  L   A++ N++P T I ++ HTD+ G+ + N+ +S+ RA  +K  ++ +     R +
Sbjct: 127 VSELNRAASVFNRYPQTRIRVEGHTDASGSEEYNMDLSRRRAQAVKD-VLVQQGVDPRRV 185

Query: 153 SVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           S  G+    P+ ++        N+R+E+ I P
Sbjct: 186 STVGYGETQPVSSDP-----AANRRVEVVIEP 212


>gi|320325748|gb|EFW81809.1| ompA family protein [Pseudomonas syringae pv. glycinea str. B076]
 gi|320327336|gb|EFW83350.1| ompA family protein [Pseudomonas syringae pv. glycinea str. race 4]
 gi|330881603|gb|EGH15752.1| ompA family protein [Pseudomonas syringae pv. glycinea str. race 4]
          Length = 229

 Score =  113 bits (284), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 51/220 (23%), Positives = 89/220 (40%), Gaps = 39/220 (17%)

Query: 3   KELGLSMFIMTTISGCGLASREKKKVFLHKSND--------------------------- 35
           + L +    +  +SGC  ++    +     S                             
Sbjct: 5   RRLIIVATAVAMLSGCATSNPYDNQGQAQSSGGMSKTAKYGGLGALAGAVAGAAIDHNHR 64

Query: 36  ----------TDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VS 84
                         +  +G   DK E   +  + +TG+ V R GD I   +P +++F   
Sbjct: 65  GKGALIGAAVAGAASAGYGYYADKQEAALRASMANTGVEVQRQGDQIKLIMPGNITFATD 124

Query: 85  EVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQR 144
              +   F   L  +A+ L +F    I I  +TDS G+ ++N+ +SQ+RA  + +YL  +
Sbjct: 125 SSAIASSFYSPLNNLASSLKQFNQNNIEIVGYTDSTGSRQHNMDLSQQRAQSVATYLTSQ 184

Query: 145 GVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           GV  +  +SVRG     PI +N    GR  N+R+E+ + P
Sbjct: 185 GVDQSH-LSVRGAGPDQPIASNADVNGRAQNRRVEVNLKP 223


>gi|170691988|ref|ZP_02883152.1| OmpA/MotB domain protein [Burkholderia graminis C4D1M]
 gi|170143272|gb|EDT11436.1| OmpA/MotB domain protein [Burkholderia graminis C4D1M]
          Length = 217

 Score =  113 bits (284), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 39/205 (19%), Positives = 74/205 (36%), Gaps = 24/205 (11%)

Query: 1   MIKELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRF----------------- 43
           ++  L +     + ++GC         V       T                        
Sbjct: 5   IMTRLAVFAVAGSLLAGCASQQGTNTAVGTGVGAGTGAALGAIFGGGKGAAIGAGVGAAV 64

Query: 44  ----GSSLDKAEDEFQMQLQDTGIVVSRIGDM-ITCYIPVHVSFVSEVF-LEKKFLPMLQ 97
               G +     ++     + TG  ++   D  +   IP  V+F +  + ++  F P+L 
Sbjct: 65  GGITGYNWQSIHNKLSGATKGTGTQITEQPDGSLKLNIPSSVTFDTNSYAIKPSFAPVLD 124

Query: 98  LIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGF 157
            +   L + P  +  +  HTDS G    N  +S  RA  +    + +   + + +S  G 
Sbjct: 125 QLTQTLQQNPEVIAQVVGHTDSTGQPAYNQTLSVNRAQSVT-GYLAQRGVAPQRLSAEGM 183

Query: 158 AYKYPIDTNDTKVGRQNNQRIEIQI 182
               PI  N+T+ GR  N+R+EI +
Sbjct: 184 GQNQPIADNNTEAGRAANRRVEIYL 208


>gi|59713771|ref|YP_206546.1| OmpA family domain-containing protein [Vibrio fischeri ES114]
 gi|197337822|ref|YP_002158145.1| OmpA family protein [Vibrio fischeri MJ11]
 gi|59482019|gb|AAW87658.1| OmpA family domain protein [Vibrio fischeri ES114]
 gi|197315074|gb|ACH64523.1| OmpA family protein [Vibrio fischeri MJ11]
          Length = 184

 Score =  113 bits (284), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 48/185 (25%), Positives = 83/185 (44%), Gaps = 10/185 (5%)

Query: 1   MIKELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQD 60
           M K+L   +   + + GC   S ++                   S +D   ++ Q  + +
Sbjct: 1   MKKQLLGIIISASLLMGCQSTSDDEMADI--------AETPTVASFVDYHNEQLQQFVTE 52

Query: 61  TGIVVSRIGDMITCYIPVHVSFVSEV-FLEKKFLPMLQLIATILNKFPSTVIAIQSHTDS 119
               V++  + I   +    SF S    ++ +   +L  +A +LN  P + + I  HTDS
Sbjct: 53  DIGSVAQTNEEIIILLNGDKSFDSGSIEIKNESKLVLSQLAKLLNDKPESEVFIAGHTDS 112

Query: 120 IGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIE 179
            G+ K N+ +S +RAD + + L++        I+  GF    PI TN    GR+ N+RIE
Sbjct: 113 RGSKKFNMSLSNQRADSVLA-LLEENGVDGNRINTYGFGESEPIATNINAEGRKKNRRIE 171

Query: 180 IQIFP 184
           I+I P
Sbjct: 172 IRITP 176


>gi|319955316|ref|YP_004166583.1| ompa/motb domain protein [Cellulophaga algicola DSM 14237]
 gi|319423976|gb|ADV51085.1| OmpA/MotB domain protein [Cellulophaga algicola DSM 14237]
          Length = 238

 Score =  113 bits (284), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 38/225 (16%), Positives = 79/225 (35%), Gaps = 36/225 (16%)

Query: 1   MIKELGL----SMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKR-------------- 42
           M+K +GL     +  +T    C        K                             
Sbjct: 8   MMKNIGLKLSTVILAVTLTVSCSAVKNANNKQKGAVIGAGSGAAIGGILGNNIGNGNNTA 67

Query: 43  ----------------FGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVS-E 85
                            G+ +DK  +  + ++    +     G  +       V F + +
Sbjct: 68  LGAIIGAVVGGAAGGYIGNRMDKQAERIEEEIPGAEVTRVGEGINVVFNEDAGVYFDTNK 127

Query: 86  VFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRG 145
             ++     +L  +  IL ++P + I ++ HTDS G    N+ +S++RA+ + S  +   
Sbjct: 128 SVVKGTSATILDRLVGILKEYPDSNILVEGHTDSAGPADYNMNLSKQRAESVTS-YLNTH 186

Query: 146 VSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGNIKK 190
             S+  ++ + +    P   N T  G+  N+R+E+ I     +K+
Sbjct: 187 GISSNRLTTKWYGETQPKSDNSTTEGKAKNRRVEMVIVASDELKQ 231


>gi|253701833|ref|YP_003023022.1| OmpA/MotB domain protein [Geobacter sp. M21]
 gi|251776683|gb|ACT19264.1| OmpA/MotB domain protein [Geobacter sp. M21]
          Length = 228

 Score =  113 bits (284), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 39/169 (23%), Positives = 71/169 (42%), Gaps = 5/169 (2%)

Query: 22  SREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVS 81
              + +          +V    G  +D+     +  + +    V R GD +   +P  + 
Sbjct: 57  KSHRGRNAAIGGLTGAVVGGAVGQYMDRQAVALKKSMPE--AEVVRDGDKVYVALPSGIL 114

Query: 82  FV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSY 140
           F   +  L+      L   A  L     T I I+ HTDS G+   N  +S+ RA+ ++ Y
Sbjct: 115 FDVGKDVLKPDAKDSLSRAAATLKD-SQTTITIEGHTDSTGSNAINQPLSERRANRVRDY 173

Query: 141 LIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGNIK 189
           L+ +GV   +  +  G+    P   ND+   R  N+R++I++ P   +K
Sbjct: 174 LVSQGVPGAKM-AAIGYGSSRPAVPNDSDANRALNRRVQIELTPNEKLK 221


>gi|319943060|ref|ZP_08017343.1| lipoprotein [Lautropia mirabilis ATCC 51599]
 gi|319743602|gb|EFV96006.1| lipoprotein [Lautropia mirabilis ATCC 51599]
          Length = 319

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 44/159 (27%), Positives = 72/159 (45%), Gaps = 3/159 (1%)

Query: 26  KKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMIT-CYIPVHVSFV- 83
           +   L       I    +   +++ +   +     TG+ V++  + +    IP  +SF  
Sbjct: 80  RNGALIGGAIAGIGTYIWSRQMEEQKRAMEEATAGTGVQVTQTRENLLQLDIPSDISFRV 139

Query: 84  SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQ 143
           +   +   F P+L   A  L   P+T + I  HTDS GT   N  +S  RA   + YL+ 
Sbjct: 140 NSAAILPNFQPILDRFAQTLVANPATTVQIIGHTDSTGTDAINNPLSVNRAASARDYLVA 199

Query: 144 RGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           RGV  +R + + G   + PI  N T  GR  N+R+EI +
Sbjct: 200 RGVQVSRIM-IDGRGSRDPIADNSTPAGRAQNRRVEIYV 237


>gi|322418405|ref|YP_004197628.1| OmpA/MotB domain-containing protein [Geobacter sp. M18]
 gi|320124792|gb|ADW12352.1| OmpA/MotB domain protein [Geobacter sp. M18]
          Length = 228

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 39/169 (23%), Positives = 72/169 (42%), Gaps = 5/169 (2%)

Query: 22  SREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVS 81
              + +          +V    G+ +D+     +  +      V R GD +   +P  + 
Sbjct: 57  KSHRGRNAAIGGLTGAVVGGAVGNYMDRQAAALKKSMPQ--AEVIRDGDKVYVALPSGIL 114

Query: 82  FV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSY 140
           F   +  L+ +    L      L     T I I+ HTDS G+   N  +S+ RA  ++ +
Sbjct: 115 FDVGKDTLKPEAKDALSKAVPTLRD-SQTTIVIEGHTDSTGSNAVNQPLSERRAGRVRDF 173

Query: 141 LIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGNIK 189
           LI +GV  ++  +  G+    P   NDT+  R  N+R++I++ P   +K
Sbjct: 174 LISQGVPGSKM-AAVGYGSTRPAVANDTEANRALNRRVQIELSPNEKLK 221


>gi|289208562|ref|YP_003460628.1| OmpA/MotB domain protein [Thioalkalivibrio sp. K90mix]
 gi|288944193|gb|ADC71892.1| OmpA/MotB domain protein [Thioalkalivibrio sp. K90mix]
          Length = 238

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 38/149 (25%), Positives = 69/149 (46%), Gaps = 2/149 (1%)

Query: 37  DIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPV-HVSFVSEVFLEKKFLPM 95
            +   R G  +D      + +L    + + R G +IT   P       +   +    +  
Sbjct: 87  SVALDRVGFYMDVLTARLRQKLAGHDVEMEREGRIITLIFPGAKAFETNSAEIHPDMVST 146

Query: 96  LQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVR 155
           L  +  +L ++ ++++ I  HTDS G    N  +S++RA  +  +L   GV   R I++ 
Sbjct: 147 LDALGQVLEEYDASLVTIAGHTDSAGARGYNQHLSEQRALSVGRHLHDNGVGEARIIAI- 205

Query: 156 GFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           G+    PI  NDT  GR  N+R+E+++ P
Sbjct: 206 GYGPDRPIADNDTPHGRALNRRVELRVEP 234


>gi|222869877|gb|EEF07008.1| predicted protein [Populus trichocarpa]
          Length = 219

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 46/164 (28%), Positives = 78/164 (47%), Gaps = 3/164 (1%)

Query: 21  ASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDM-ITCYIPVH 79
                    +  +    +    +  +++K + E +   Q TG+ VS+  D  +   IP  
Sbjct: 26  TGGRAGTGAVIGAGVGALGTYIWSQNMEKQKREMEQATQGTGVNVSQTADNQLKLDIPSD 85

Query: 80  VSFVSE-VFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIK 138
           +SF +    ++  F P+L   A  L   P+  + I  HTDS G+   N  +S +RA+  +
Sbjct: 86  ISFDTNRSDIKGNFAPILDRFAEGLRNNPNAEVRIIGHTDSTGSDAINNPLSLDRANSTR 145

Query: 139 SYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           +YL  RGVS  R I+  G     P+ +ND+  GR  N+R+EI +
Sbjct: 146 NYLTMRGVSGAR-IATEGRGSHQPVASNDSASGRAMNRRVEIFV 188


>gi|222529065|ref|YP_002572947.1| OmpA/MotB domain-containing protein [Caldicellulosiruptor bescii
           DSM 6725]
 gi|312622679|ref|YP_004024292.1| OmpA/MotB domain-containing protein [Caldicellulosiruptor
           kronotskyensis 2002]
 gi|222455912|gb|ACM60174.1| OmpA/MotB domain protein [Caldicellulosiruptor bescii DSM 6725]
 gi|312203146|gb|ADQ46473.1| OmpA/MotB domain protein [Caldicellulosiruptor kronotskyensis 2002]
          Length = 257

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 31/171 (18%), Positives = 58/171 (33%), Gaps = 7/171 (4%)

Query: 20  LASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEF---QMQLQDTGIVVSRIGDMITCYI 76
                K           +          D  +      +    +  ++V +    ++  +
Sbjct: 76  SGKNVKGTNTDVGGATKNKQMTEEELINDIQKQVLGLIKEHGIEGKVLVIQEERGLSILL 135

Query: 77  PVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNN----LLISQE 132
              +       L  +   ++  IA IL K P+  I I+ HTD++            +S  
Sbjct: 136 KDVLFDTGSAKLTPQAKEVVHEIAKILEKVPNNNIRIEGHTDNVPIHNKYFYSNWELSTA 195

Query: 133 RADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
           RA  +   +++         SV G+    PI +N T  GR  N+R+ I I 
Sbjct: 196 RATSVLQEILRVSKVRPERFSVVGYGEYRPIASNKTPEGRALNRRVTIVIL 246


>gi|156974345|ref|YP_001445252.1| hypothetical protein VIBHAR_02060 [Vibrio harveyi ATCC BAA-1116]
 gi|156525939|gb|ABU71025.1| hypothetical protein VIBHAR_02060 [Vibrio harveyi ATCC BAA-1116]
          Length = 219

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 50/216 (23%), Positives = 92/216 (42%), Gaps = 39/216 (18%)

Query: 7   LSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFG---------------------- 44
           +++ ++  ++GC    R+      +++N T                              
Sbjct: 3   IALALVLALTGCQATQRQNATTGEYETNSTTQGALIGAIAGAAIGLAVGDNAKERRKGAL 62

Query: 45  --------------SSLDKAEDEFQMQLQDTGIVVSRIG-DMITCYIPVHVSFVSEVFLE 89
                            D+ E E +  L ++G+ V R+G + +   +   + F S  +  
Sbjct: 63  IGAAAGGATGAGVGYYFDQQEAELRRALLNSGVQVERVGENQLLLRMENGIGFSSSSYQL 122

Query: 90  KKF-LPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSS 148
                  L+ +A IL ++P T + I  +TDS G+   N  +S+ RA+ ++ YL+ + V+ 
Sbjct: 123 DSSIHNTLRGVARILVEYPDTSLVIDGYTDSTGSDSYNQTLSERRAESVRQYLVSQKVAP 182

Query: 149 NRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
            R I  RG+  + PI +N T  GR  N+R+EIQI P
Sbjct: 183 GRAI-ARGYGERNPICSNQTSDGRACNRRVEIQILP 217


>gi|312877226|ref|ZP_07737195.1| OmpA/MotB domain protein [Caldicellulosiruptor lactoaceticus 6A]
 gi|311796035|gb|EFR12395.1| OmpA/MotB domain protein [Caldicellulosiruptor lactoaceticus 6A]
          Length = 257

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 31/171 (18%), Positives = 58/171 (33%), Gaps = 7/171 (4%)

Query: 20  LASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEF---QMQLQDTGIVVSRIGDMITCYI 76
                K           +          D  +      +    +  ++V +    ++  +
Sbjct: 76  SGKNVKGTNTDVGGATKNKQMTEEELINDIQKQILGLIKEHGIEGKVLVIQEERGLSILL 135

Query: 77  PVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNN----LLISQE 132
              +       L  +   ++  IA IL K P+  I I+ HTD++            +S  
Sbjct: 136 KDVLFDTGSAKLTPQAKEVVHEIAKILEKVPNNNIRIEGHTDNVPIHNKYFYSNWELSTA 195

Query: 133 RADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
           RA  +   +++         SV G+    PI +N T  GR  N+R+ I I 
Sbjct: 196 RATSVLQEILRVSKVRPERFSVVGYGEYRPIASNKTPEGRALNRRVTIVIL 246


>gi|312793260|ref|YP_004026183.1| OmpA/MotB domain-containing protein [Caldicellulosiruptor
           kristjanssonii 177R1B]
 gi|312180400|gb|ADQ40570.1| OmpA/MotB domain protein [Caldicellulosiruptor kristjanssonii
           177R1B]
          Length = 257

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 31/171 (18%), Positives = 58/171 (33%), Gaps = 7/171 (4%)

Query: 20  LASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEF---QMQLQDTGIVVSRIGDMITCYI 76
                K           +          D  +      +    +  ++V +    ++  +
Sbjct: 76  SGKNVKGTNTDVGGATKNKQMTEEELINDIQKQVLGLIKEHGIEGKVLVIQEERGLSILL 135

Query: 77  PVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNN----LLISQE 132
              +       L  +   ++  IA IL K P+  I I+ HTD++            +S  
Sbjct: 136 KDVLFDTGSAKLTPQAKEVVHEIAKILEKVPNNNIRIEGHTDNVPIHNKYFYSNWELSTA 195

Query: 133 RADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
           RA  +   +++         SV G+    PI +N T  GR  N+R+ I I 
Sbjct: 196 RATSVLQEILRVSKVRPERFSVVGYGEYRPIASNKTPEGRALNRRVTIVIL 246


>gi|330961787|gb|EGH62047.1| ompA family protein [Pseudomonas syringae pv. maculicola str.
           ES4326]
          Length = 229

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 53/220 (24%), Positives = 89/220 (40%), Gaps = 39/220 (17%)

Query: 3   KELGLSMFIMTTISGCGLAS-------------------------------------REK 25
           + L L    +  +SGC   +                                       +
Sbjct: 5   RRLILVATAVAMLSGCATPNPYDNQGQAQSSGGMSKTAKYGGLGALAGAVAGAAIDHNNR 64

Query: 26  KKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VS 84
            K  L  +      +  +G   DK E   +  + +TG+ V R GD I   +P +++F   
Sbjct: 65  GKGALIGAAVAGAASAGYGYYADKQEAALRASMANTGVEVQRQGDQIKLIMPGNITFATD 124

Query: 85  EVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQR 144
              +   F   L  +A  L +F    I I  +TDS G+ ++N+ +SQ+RA  + +YL  +
Sbjct: 125 SSAIASSFYSPLNNLANSLKQFNQNNIEIVGYTDSTGSRQHNMDLSQQRAQSVATYLTSQ 184

Query: 145 GVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           GV  +  +SVRG     PI +N    GR  N+R+E+ + P
Sbjct: 185 GVDQSH-LSVRGAGPDQPIASNADVNGRAQNRRVEVNLKP 223


>gi|89899024|ref|YP_521495.1| OmpA/MotB [Rhodoferax ferrireducens T118]
 gi|89343761|gb|ABD67964.1| OmpA/MotB [Rhodoferax ferrireducens T118]
          Length = 217

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 45/200 (22%), Positives = 80/200 (40%), Gaps = 23/200 (11%)

Query: 8   SMFIMTTISGCGLASR--------------------EKKKVFLHKSNDTDIVNKRFGSSL 47
              +   +SGC   +                     + ++  +  +    +    + + +
Sbjct: 15  VSAVALLVSGCANMTETQRSSAIGAGVGALAGAAIGDSREATVIGAGVGALGGYIWSTQM 74

Query: 48  DKAEDEFQMQLQDTGIVVSRIGDM-ITCYIPVHV-SFVSEVFLEKKFLPMLQLIATILNK 105
            K + + +     TG+ V +  D  +   IP  +   ++   ++    P+L   A  L+ 
Sbjct: 75  AKKKADMERATAGTGVDVMQTADNQLKLNIPSDISFDINRFDIKPNMRPILDQFAQGLSS 134

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
            P+T I I  HTDS G+   N  +S  RA   + YL+ R     R I + G     PI  
Sbjct: 135 QPNTEIRIIGHTDSTGSDSINDPLSVNRAASARDYLVAR-GVDGRRIQINGRGSHEPIAD 193

Query: 166 NDTKVGRQNNQRIEIQIFPR 185
           N+T+ GR  N+RIEI +  R
Sbjct: 194 NNTERGRAQNRRIEIFLAER 213


>gi|226951234|ref|ZP_03821698.1| OmpA/MotB domain-containing protein [Acinetobacter sp. ATCC 27244]
 gi|226838028|gb|EEH70411.1| OmpA/MotB domain-containing protein [Acinetobacter sp. ATCC 27244]
          Length = 213

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 41/142 (28%), Positives = 74/142 (52%), Gaps = 3/142 (2%)

Query: 46  SLDKAEDEFQMQLQDTGIVVSRIGDM-ITCYIPVHVSFV-SEVFLEKKFLPMLQLIATIL 103
            LD  E + + Q+Q TG+ V R  D  +   +P  ++F  ++  ++  F   L  +A +L
Sbjct: 72  YLDNKEKKLRQQMQGTGVDVGRNPDGSVQLIMPGSITFDTNKSNIKPNFYATLNKVAQVL 131

Query: 104 NKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPI 163
            +   + I +  +TD+ G    N+ +SQ RA  +K+YL  +   ++  I  +G+    PI
Sbjct: 132 GEDNQSAILVTGYTDNTGNDSINIPLSQARAQSVKNYLAGK-GIASNRIDAQGYGSSNPI 190

Query: 164 DTNDTKVGRQNNQRIEIQIFPR 185
             N T  GR+ N+R+EI I+ +
Sbjct: 191 ADNSTAAGREQNRRVEISIYAK 212


>gi|257457774|ref|ZP_05622935.1| OmpA family protein [Treponema vincentii ATCC 35580]
 gi|257444824|gb|EEV19906.1| OmpA family protein [Treponema vincentii ATCC 35580]
          Length = 434

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 40/164 (24%), Positives = 68/164 (41%), Gaps = 5/164 (3%)

Query: 27  KVFLHKSNDTDIVNKRFGSSLDKAE--DEFQMQLQDTGI---VVSRIGDMITCYIPVHVS 81
              + +   T          +DK +  +     ++D GI    V R  + IT  +     
Sbjct: 271 TGAVIEYRGTAKAELTLLQRMDKEKIVEILDKNIRDMGIPNTTVERTDEGITISLENIQF 330

Query: 82  FVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYL 141
                 L       L+ I  IL  +P   + I  HT   G  ++  ++S++RA  + +YL
Sbjct: 331 EPDSARLLPAEKEKLKKIGDILASYPDYELLISGHTALAGRAEDRQVLSEQRASAVANYL 390

Query: 142 IQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPR 185
           I+ GV     I  RGF  + PI  N T+  +  N+R+EI +  +
Sbjct: 391 IELGVREKHHIFTRGFGAEKPIAPNTTEANKARNRRVEITVLEK 434


>gi|254436394|ref|ZP_05049900.1| Thrombospondin type 3 repeat family [Nitrosococcus oceani AFC27]
 gi|207088084|gb|EDZ65357.1| Thrombospondin type 3 repeat family [Nitrosococcus oceani AFC27]
          Length = 344

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 40/165 (24%), Positives = 64/165 (38%), Gaps = 8/165 (4%)

Query: 18  CGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIP 77
           C       +          D         +D+  D         G+ V  +G      + 
Sbjct: 182 CPDTPMGVEVNSQGCPLSVDSDGDGVPDDIDECPD------TAYGVDVDEVGCPKPVVLE 235

Query: 78  VHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADV 136
             V F      L      +L  +   +  +P   I I  HTDS G    N  +SQ RA+ 
Sbjct: 236 DGVHFGFDSAKLSPNAHTILDKVVENMRTYPDLEITIAGHTDSTGNADYNQRLSQLRAEA 295

Query: 137 IKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQ 181
             +YL  +G+  +R  ++ G+  + PI +N TK GR  N+R+E+Q
Sbjct: 296 AMNYLASKGIDPSRMEAI-GYGEERPIASNSTKEGRAKNRRVELQ 339


>gi|77165990|ref|YP_344515.1| OmpA/MotB [Nitrosococcus oceani ATCC 19707]
 gi|76884304|gb|ABA58985.1| OmpA/MotB [Nitrosococcus oceani ATCC 19707]
          Length = 319

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 40/165 (24%), Positives = 64/165 (38%), Gaps = 8/165 (4%)

Query: 18  CGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIP 77
           C       +          D         +D+  D         G+ V  +G      + 
Sbjct: 157 CPDTPMGVEVNSQGCPLSVDSDGDGVPDDIDECPD------TAYGVDVDEVGCPKPVVLE 210

Query: 78  VHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADV 136
             V F      L      +L  +   +  +P   I I  HTDS G    N  +SQ RA+ 
Sbjct: 211 DGVHFGFDSAKLSPNAHTILDKVVENMRTYPDLEITIAGHTDSTGNADYNQRLSQLRAEA 270

Query: 137 IKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQ 181
             +YL  +G+  +R  ++ G+  + PI +N TK GR  N+R+E+Q
Sbjct: 271 AMNYLASKGIDPSRMEAI-GYGEERPIASNSTKEGRAKNRRVELQ 314


>gi|294506240|ref|YP_003570298.1| Outer membrane protein A [Precursor] [Salinibacter ruber M8]
 gi|294342568|emb|CBH23346.1| Outer membrane protein A [Precursor] [Salinibacter ruber M8]
          Length = 285

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 41/147 (27%), Positives = 69/147 (46%), Gaps = 4/147 (2%)

Query: 45  SSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATIL 103
           S +D   +E   +L +    V R+G+ I       + F      L  +    L   A  +
Sbjct: 130 SRMDTKAEELDEELDN--ADVERVGEGIKVTFDSGILFDFDSSTLRAEARQNLTEFAESM 187

Query: 104 NKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPI 163
             F  T I +  HTD+ G+ + N  +S  RA+    +L+ RGV  +R  SV G     P+
Sbjct: 188 QGFEDTKILVVGHTDAQGSEEYNQKLSDRRAESATRHLVDRGVDPSRLTSV-GRGETEPV 246

Query: 164 DTNDTKVGRQNNQRIEIQIFPRGNIKK 190
            +N+T+ GRQ N+R+E+ I+     ++
Sbjct: 247 ASNETEEGRQQNRRVEVAIYANEEYRE 273


>gi|319957287|ref|YP_004168550.1| ompa/motb domain protein [Nitratifractor salsuginis DSM 16511]
 gi|319419691|gb|ADV46801.1| OmpA/MotB domain protein [Nitratifractor salsuginis DSM 16511]
          Length = 351

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 36/134 (26%), Positives = 65/134 (48%), Gaps = 1/134 (0%)

Query: 51  EDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKFPST 109
           + E +   +  GI+V +  +     +P  V F  ++  L+ +    L ++A  +   P+ 
Sbjct: 217 KAEAKPTPEQVGIIVRKTSEGSMLTVPEKVLFDFNKFILKPEAKKALDVVADYIRSHPAR 276

Query: 110 VIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTK 169
            I +  +TD+IGT   NL +S +RA  +  YL+  G    +   + G     PI  N T+
Sbjct: 277 QIVVTGYTDNIGTDAYNLRLSLQRAQSVADYLMDCGKVDPKLFKIVGKGKANPIADNATE 336

Query: 170 VGRQNNQRIEIQIF 183
            GR  N+R+EI++ 
Sbjct: 337 EGRAKNRRVEIRLI 350


>gi|114332359|ref|YP_748581.1| OmpA/MotB domain-containing protein [Nitrosomonas eutropha C91]
 gi|114309373|gb|ABI60616.1| OmpA/MotB domain protein [Nitrosomonas eutropha C91]
          Length = 220

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 45/212 (21%), Positives = 81/212 (38%), Gaps = 31/212 (14%)

Query: 1   MIKELGL-SMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKR----------------- 42
           M K + + +  +   +SGC   +  ++                                 
Sbjct: 1   MYKAIVITASLVGFIVSGCADMTATQRGSGTGALLGAGTGAAIGALAGGGKGAAIGAGAG 60

Query: 43  ----------FGSSLDKAEDEFQMQLQDTGIVVSRI-GDMITCYIPVHV-SFVSEVFLEK 90
                     +   +++ + + +     TG++VS+   + +   IP  +        ++ 
Sbjct: 61  AALGAGAGYLWSKRMEEQKIQMENATAGTGVMVSQTADNRLMLNIPSDISFDTGSAQIKP 120

Query: 91  KFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNR 150
            F P+L   AT L   P T + I  HTD+ G+   N  +S  RA   + YL  RGV   R
Sbjct: 121 GFRPILDSFATSLLNNPGTHVTIVGHTDNTGSDAVNNPLSVNRAASTREYLAGRGVPFQR 180

Query: 151 FISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
            I + G     P+ +N+T  GR  N+R+EI +
Sbjct: 181 -IQIDGRGSYQPVASNNTAAGRARNRRVEIYV 211


>gi|163744900|ref|ZP_02152260.1| OmpA family domain protein [Oceanibulbus indolifex HEL-45]
 gi|161381718|gb|EDQ06127.1| OmpA family domain protein [Oceanibulbus indolifex HEL-45]
          Length = 221

 Score =  113 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 36/169 (21%), Positives = 73/169 (43%), Gaps = 3/169 (1%)

Query: 19  GLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPV 78
                 + +  +  +     +    G SLDK E E +  + D+ +V++  GD +   +P 
Sbjct: 54  SKGDGNRTEAAVKGALVGGAIGAGVGYSLDKQEAELRAAM-DSRVVITNTGDRLIVTLPQ 112

Query: 79  HVSFVSEVF-LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVI 137
            + F ++   +       L  +A  +N + ++ + +  HTDS G    N  +S+ RA  +
Sbjct: 113 DILFATDSTSVAPGLRDDLAALAQNVNIYQNSTLQVVGHTDSDGEAAYNQQLSERRAQAV 172

Query: 138 KSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRG 186
            + L+       + +   G     P+ +N +  G+  N+R+EI I P  
Sbjct: 173 GNILLSN-GVPQQRLQTFGRGESQPVASNLSAAGKSQNRRVEIVILPNA 220


>gi|209809406|ref|YP_002264944.1| putative outer membrane protein, OmpA family [Aliivibrio
           salmonicida LFI1238]
 gi|208010968|emb|CAQ81375.1| putative outer membrane protein, OmpA family [Aliivibrio
           salmonicida LFI1238]
          Length = 185

 Score =  113 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 46/189 (24%), Positives = 83/189 (43%), Gaps = 10/189 (5%)

Query: 1   MIKELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQD 60
           M K L   + + + +SGC   S ++          T  +        D+        +  
Sbjct: 1   MKKHLLEVIIVGSLLSGCQSTSEDETTAI----KSTPTIESFITYHHDELNAIITDDIG- 55

Query: 61  TGIVVSRIGDMITCYIPVHVSFVSEV-FLEKKFLPMLQLIATILNKFPSTVIAIQSHTDS 119
               V+++ D I   +    SF S    ++ +    L  +A +LN  P + + I  HTDS
Sbjct: 56  ---SVAQVNDEIIVLLNGDTSFDSGSIVIKSESKDALTQLAQLLNNKPRSEVFIAGHTDS 112

Query: 120 IGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIE 179
            G+ + N  +S +RA+ + + L+++       I+  GF    PI +N    GR+ N+RIE
Sbjct: 113 SGSKQFNTSLSNKRANSVLA-LLEQKGVDANRINTYGFGEAEPIASNMNANGRKKNRRIE 171

Query: 180 IQIFPRGNI 188
           I+I P  ++
Sbjct: 172 IRITPVADL 180


>gi|229588474|ref|YP_002870593.1| hypothetical protein PFLU0931 [Pseudomonas fluorescens SBW25]
 gi|229360340|emb|CAY47197.1| conserved hypothetical protein [Pseudomonas fluorescens SBW25]
          Length = 257

 Score =  113 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 48/223 (21%), Positives = 86/223 (38%), Gaps = 42/223 (18%)

Query: 3   KELGLSMFIMTTISGCGLAS---------------------------------------- 22
           + L +   ++  +SGC   +                                        
Sbjct: 5   RRLLVVATVVALLSGCASPNPYDGSSQGQASNESGGMSKTAKYGGLGALAGALAGAAIDH 64

Query: 23  REKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF 82
             + K  L  +         +G   D+ E + +  + +TG+ V R GD I   +P +++F
Sbjct: 65  NNRGKGALIGAVVAGAGAAGYGYYADQQEKKLRESMANTGVEVQRQGDQIKLIMPGNITF 124

Query: 83  VSEVF-LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYL 141
            +    +   F   L  +A  L +F    I I  +TDS G+ + N+ +SQ RA  + +YL
Sbjct: 125 ATNSDAISSSFYQPLNNLANSLKQFNQNTIQIVGYTDSTGSRQLNMDLSQRRAQSVANYL 184

Query: 142 IQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
             +   +   +S RG     PI +N    GR  N+R+E+ + P
Sbjct: 185 TSQ-GVNGANLSARGAGPDNPIASNADVNGRAQNRRVEVNLGP 226


>gi|89054158|ref|YP_509609.1| OmpA/MotB [Jannaschia sp. CCS1]
 gi|88863707|gb|ABD54584.1| OmpA/MotB [Jannaschia sp. CCS1]
          Length = 219

 Score =  113 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 42/167 (25%), Positives = 77/167 (46%), Gaps = 2/167 (1%)

Query: 20  LASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVH 79
                + +  +  +          G++LD+   + +  L +  I++   G+ +   +P  
Sbjct: 54  SGDDNRGRNAVLGAAVGAAAGGAIGNALDRQAQDLRGSLSNERILIENTGEALILTLPEG 113

Query: 80  VSFV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIK 138
           + F      +       L+ +A  LN++P T + ++ HTD+ G+   N  +S  RA  + 
Sbjct: 114 ILFDVDSAAIRAGLQGDLRALAFNLNQYPDTRVVVEGHTDNTGSASYNQDLSTRRAQAVS 173

Query: 139 SYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPR 185
             L++ GV+  R  SV G     PI TN T  GRQ N+R+E+ I P+
Sbjct: 174 GVLLEGGVAPFRVQSV-GRGESAPIATNLTPEGRQQNRRVEVIIRPQ 219


>gi|307718975|ref|YP_003874507.1| hypothetical protein STHERM_c12930 [Spirochaeta thermophila DSM
           6192]
 gi|306532700|gb|ADN02234.1| hypothetical protein STHERM_c12930 [Spirochaeta thermophila DSM
           6192]
          Length = 395

 Score =  113 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 42/165 (25%), Positives = 71/165 (43%), Gaps = 5/165 (3%)

Query: 26  KKVFLHKSNDTDIVNKRFGSSLDKAE-----DEFQMQLQDTGIVVSRIGDMITCYIPVHV 80
           K   +++   T      + S LD+ +     +     LQ     V    + +T  +    
Sbjct: 231 KTGDVYEFTGTADAEVVWASPLDREKVREEVEAAIEDLQIPDAEVETSEEGVTIRLENIQ 290

Query: 81  SFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSY 140
                  L  +    L+ IA IL+++P   + ++ HT   GT +  L +S ERA  +  +
Sbjct: 291 FPPDSALLLPEEQEKLRKIAQILSRYPERDLLVEGHTALAGTPEGRLALSIERAKAVADF 350

Query: 141 LIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPR 185
           L++ GV     I +RG+    PI  N T+ GR  N+R+EI I   
Sbjct: 351 LMKLGVRRPEQIVIRGYGATRPIADNTTEEGRSRNRRVEITILEN 395


>gi|302872092|ref|YP_003840728.1| OmpA/MotB domain protein [Caldicellulosiruptor obsidiansis OB47]
 gi|302574951|gb|ADL42742.1| OmpA/MotB domain protein [Caldicellulosiruptor obsidiansis OB47]
          Length = 257

 Score =  113 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 31/171 (18%), Positives = 58/171 (33%), Gaps = 7/171 (4%)

Query: 20  LASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEF---QMQLQDTGIVVSRIGDMITCYI 76
                K           +          D  +      +    +  ++V +    ++  +
Sbjct: 76  SGKNVKGTNTDVGGATKNRQMTEEELINDIQKQVLGLIKEHGIEGKVLVIQEERGLSILL 135

Query: 77  PVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNN----LLISQE 132
              +       L  +   ++  IA IL K P+  I I+ HTD++            +S  
Sbjct: 136 KDVLFDTGSAKLTPQAKEVVHEIAKILEKVPNNNIRIEGHTDNVPIHNKYFYSNWELSTA 195

Query: 133 RADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
           RA  +   +++         SV G+    PI +N T  GR  N+R+ I I 
Sbjct: 196 RATSVLQEILRVSKVKPERFSVVGYGEYRPIASNKTPEGRALNRRVTIVIL 246


>gi|116748592|ref|YP_845279.1| OmpA/MotB domain-containing protein [Syntrophobacter fumaroxidans
           MPOB]
 gi|116697656|gb|ABK16844.1| OmpA/MotB domain protein [Syntrophobacter fumaroxidans MPOB]
          Length = 182

 Score =  113 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 48/183 (26%), Positives = 77/183 (42%), Gaps = 10/183 (5%)

Query: 5   LGLSMFIMTTISGCGL-ASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQ-DTG 62
             L   I   +SGC      E  K        T       G  +++ E E   ++    G
Sbjct: 6   FVLLACIAFMMSGCASLMPGESSKDANKSLAPTA------GGYIERQEAELVQRMTRADG 59

Query: 63  IVVSRIGDMITCYIPVHVSFVSEV-FLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIG 121
             + R  D +       V F  +   L+      +  +A +L K+P+T I +   TD  G
Sbjct: 60  TSIQREQDKLCITFNCGVLFPDDSTELKPDAPARIAPVAEVLAKYPATSIKVDGFTDRTG 119

Query: 122 TLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQ 181
           + K +  I++ RA  ++  L+ +G+   R I  RGF    P+ TN T  GR+ N+R+ I 
Sbjct: 120 SEKYDHEITESRATAVRDVLVGKGIDPAR-IRARGFGDSKPLTTNATDEGRRTNRRVTIT 178

Query: 182 IFP 184
           I P
Sbjct: 179 IAP 181


>gi|150007860|ref|YP_001302603.1| OmpA family outer membrane protein [Parabacteroides distasonis ATCC
           8503]
 gi|262381639|ref|ZP_06074777.1| outer membrane protein [Bacteroides sp. 2_1_33B]
 gi|298376779|ref|ZP_06986734.1| lipoprotein PG3 [Bacteroides sp. 3_1_19]
 gi|301310112|ref|ZP_07216051.1| lipoprotein PG3 [Bacteroides sp. 20_3]
 gi|149936284|gb|ABR42981.1| outer membrane protein, OmpA family [Parabacteroides distasonis
           ATCC 8503]
 gi|262296816|gb|EEY84746.1| outer membrane protein [Bacteroides sp. 2_1_33B]
 gi|298266657|gb|EFI08315.1| lipoprotein PG3 [Bacteroides sp. 3_1_19]
 gi|300831686|gb|EFK62317.1| lipoprotein PG3 [Bacteroides sp. 20_3]
          Length = 227

 Score =  113 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 48/218 (22%), Positives = 82/218 (37%), Gaps = 31/218 (14%)

Query: 1   MIKEL----GLSMFIMTTISGCGL------------------------ASREKKKVFLHK 32
           M++ +     L + +    + CG                          +       +  
Sbjct: 1   MMRNIKLLSVLLLCMAVVFTSCGTWNNTAKGTAIGVGGGAAVGAGVGALAGNTALGAVIG 60

Query: 33  SNDTDIVNKRFGSSLDKAEDEFQMQL-QDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEK 90
           +          G  +DK + E +  L +DT I     G+ +       + F  +   L  
Sbjct: 61  AAVGGTAGALIGKKMDKQKKELEATLPEDTKIESVNNGEALKVTFDSGILFATNSSTLSD 120

Query: 91  KFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNR 150
                L+  AT L   P T I I   TD+ G +  N  +S++RA  +  YL+ +GVS++R
Sbjct: 121 ASKSALRNFATSLKANPDTDIRIIGFTDNTGKVDYNQTLSEKRAKSVYDYLMMQGVSTDR 180

Query: 151 FISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGNI 188
            +   G     P+ +NDT  GR  N+R+EI I     +
Sbjct: 181 MVY-EGKGIHDPVASNDTPEGRSLNRRVEIVILANQKM 217


>gi|224373377|ref|YP_002607749.1| major outer membrane protein [Nautilia profundicola AmH]
 gi|223589055|gb|ACM92791.1| major outer membrane protein [Nautilia profundicola AmH]
          Length = 209

 Score =  113 bits (282), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 51/215 (23%), Positives = 85/215 (39%), Gaps = 37/215 (17%)

Query: 1   MIKELGLSMFIMTTISGCGLASREKKKVFLHK---------------------------- 32
           M K +  +      I GC         V L                              
Sbjct: 1   MKKIIIATAITGLFIVGCAEKPMATSVVDLAGNKKVIGWQDNNNTTDVKKVEVKEVKVVK 60

Query: 33  -SNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKK 91
                D  N     ++DK  +  +  L      V   G  I   + ++  F ++  ++K 
Sbjct: 61  CEPIKDSDNDGVPDNIDKCPNTPENML------VDHNGCPIITTLRLNFDF-NKAVVKKI 113

Query: 92  FLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRF 151
           + P LQ +A IL   P+  I +  HTD+IG+ + NL +SQ+RA+ +K+ L+ +       
Sbjct: 114 YYPELQKVAEILKNNPNLKIEVAGHTDNIGSDEYNLKLSQKRAEAVKNILVNKFGIDPSR 173

Query: 152 ISVRGFAYKYPIDTNDTKVGRQNNQRIEIQ-IFPR 185
           I  +G+  KYP+  N T+  R  N+R+EI  I  +
Sbjct: 174 IVAKGYGEKYPLVPNTTETNRALNRRVEIVNITNK 208


>gi|103488577|ref|YP_618138.1| OmpA/MotB [Sphingopyxis alaskensis RB2256]
 gi|98978654|gb|ABF54805.1| OmpA/MotB [Sphingopyxis alaskensis RB2256]
          Length = 230

 Score =  113 bits (282), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 49/221 (22%), Positives = 84/221 (38%), Gaps = 38/221 (17%)

Query: 1   MIKE-----LGLSMFIMTTISGCGLASREKKKVFLHKS---------------------- 33
           M+K        L+      ++GC       ++     +                      
Sbjct: 1   MMKSRTTRLAFLTGLGAIALTGCVTDPVTGERKISKAAIGGVGGALGGYLLGDLIGGRSD 60

Query: 34  --------NDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV-S 84
                       +     G  +D+ E + + +   TGI V R GD +   +P  V+F  +
Sbjct: 61  RTEKIVGAGIGAVAGAGVGYYMDQQEKKLRERTAGTGIDVERQGDQLVLNMPGDVTFDLN 120

Query: 85  EVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQR 144
              ++ +F   L  +A  L ++PST I +  HTDS G+   N  +S+ RA  +  YL  R
Sbjct: 121 SAMVKSQFRSALDNVAATLAEYPSTYIDVYGHTDSTGSETYNQGLSERRAASVADYLAGR 180

Query: 145 GVSSNRFISVRGFAYKYPI-DTNDTKVGRQNNQRIEIQIFP 184
           G+   R  +  G+           T+   Q N+R+EI+I P
Sbjct: 181 GIQRARM-ATLGYGESQLKCAPERTEADYQCNRRVEIRIAP 220


>gi|255530097|ref|YP_003090469.1| OmpA/MotB domain-containing protein [Pedobacter heparinus DSM 2366]
 gi|255343081|gb|ACU02407.1| OmpA/MotB domain protein [Pedobacter heparinus DSM 2366]
          Length = 263

 Score =  113 bits (282), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 47/173 (27%), Positives = 81/173 (46%), Gaps = 4/173 (2%)

Query: 19  GLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPV 78
           G  +       +  +          G  +DK   E Q  + +    V R G+ I      
Sbjct: 87  GKKAGNTAVGAIIGAAVGGTAGGFIGKRMDKQAAEIQNAIPN--AEVIREGEGIIVKFDS 144

Query: 79  HVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVI 137
            + F   +  L  +    ++ +A  LN++P T I +  HTD+ GT   N+ +S+ RA  +
Sbjct: 145 GILFGFDKSDLTAQAKTNIKSLAGSLNQYPGTDIKVIGHTDNKGTEAYNMGLSERRAAAV 204

Query: 138 KSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGNIKK 190
           K+Y + +GV S+R I++ G  +  PI+ N T+ GR  N+R+E+ I     +KK
Sbjct: 205 KAYAVSQGVPSSRLITI-GKGFSEPIEDNSTEAGRAANRRVEVVIVANDQLKK 256


>gi|183222506|ref|YP_001840502.1| hypothetical protein LEPBI_I3161 [Leptospira biflexa serovar Patoc
           strain 'Patoc 1 (Paris)']
 gi|189912543|ref|YP_001964098.1| OmpA-family protein [Leptospira biflexa serovar Patoc strain 'Patoc
           1 (Ames)']
 gi|167777219|gb|ABZ95520.1| OmpA-family protein [Leptospira biflexa serovar Patoc strain 'Patoc
           1 (Ames)']
 gi|167780928|gb|ABZ99226.1| Conserved hypothetical protein [Leptospira biflexa serovar Patoc
           strain 'Patoc 1 (Paris)']
          Length = 475

 Score =  113 bits (282), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 36/132 (27%), Positives = 63/132 (47%)

Query: 52  DEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVI 111
           D+     +   + V    D I   +   +   ++  L+      +  IA IL K+P   I
Sbjct: 342 DDPNQIAEQLPVKVRTTEDGIVFSLDSILFDFNDSKLKVDAESAVAKIAEILKKYPDREI 401

Query: 112 AIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVG 171
            +  HTD+IG  + N  +S+ERA  +   L+       + IS RG+A ++P+  ND++  
Sbjct: 402 RVSGHTDNIGKKEYNQKLSEERAKSVLHSLVDNHKMDEKHISFRGYADEFPVAPNDSEEN 461

Query: 172 RQNNQRIEIQIF 183
           R  N+R+EI + 
Sbjct: 462 RHKNRRVEITLV 473


>gi|83944251|ref|ZP_00956706.1| OmpA family protein [Sulfitobacter sp. EE-36]
 gi|83953292|ref|ZP_00962014.1| OmpA family protein [Sulfitobacter sp. NAS-14.1]
 gi|83842260|gb|EAP81428.1| OmpA family protein [Sulfitobacter sp. NAS-14.1]
 gi|83844795|gb|EAP82677.1| OmpA family protein [Sulfitobacter sp. EE-36]
          Length = 222

 Score =  113 bits (282), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 43/219 (19%), Positives = 84/219 (38%), Gaps = 36/219 (16%)

Query: 2   IKELGLSMFIMTTISGC-----GLASREKKKVFLHKSNDTDIVNKRFGS----------- 45
              + +++  +  ++ C     G    +      + +          G+           
Sbjct: 5   KTSIAVALTSVLALAACEPGPIGGNPNDPNANTRNGALIGAGTGAVIGALSKGDGNRAQG 64

Query: 46  -----------------SLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVF- 87
                            SLDK E + + QL    ++++  GD +   +P  + F ++   
Sbjct: 65  ALAGAVAGGALGAGYGYSLDKQEADLRRQLDSD-VIITNTGDRLIVTLPQDILFATDSTQ 123

Query: 88  LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVS 147
           ++      L  +A  +N + ++ + I  HTDS G    N  +S+ RA  + + L+  GV 
Sbjct: 124 VQAGMQNDLAALARNVNVYSNSTLQIVGHTDSDGEASYNQQLSEGRARAVANVLVSNGVP 183

Query: 148 SNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRG 186
            +R  SV G     P+ +N    G+  N+R+EI I P  
Sbjct: 184 GSRIQSV-GRGESQPVASNLNAAGKAQNRRVEIVILPNA 221


>gi|323525137|ref|YP_004227290.1| OmpA/MotB domain-containing protein [Burkholderia sp. CCGE1001]
 gi|323382139|gb|ADX54230.1| OmpA/MotB domain protein [Burkholderia sp. CCGE1001]
          Length = 217

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 39/205 (19%), Positives = 75/205 (36%), Gaps = 24/205 (11%)

Query: 1   MIKELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRF----------------- 43
           ++  L +     + ++GC         V       T                        
Sbjct: 5   IMTRLAVFAVAGSVLAGCASQQGTNTAVGTGVGAGTGAALGAIFGGGKGAAIGAGVGAAV 64

Query: 44  ----GSSLDKAEDEFQMQLQDTGIVVSRIGDM-ITCYIPVHVSFVSEVF-LEKKFLPMLQ 97
               G +     ++     + TG  ++   D  +   IP  V+F +  + ++  F P+L 
Sbjct: 65  GGITGYNWQAIHNKLSGATKGTGTQITEQPDGSLKLNIPSSVTFDTNSYAIKPSFAPVLD 124

Query: 98  LIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGF 157
            +   L + P  +  +  HTDS G    N  +S  RA  +    +++   + + +S +G 
Sbjct: 125 QLTQTLQQNPEVIAQVVGHTDSTGQPAYNQTLSVNRAQSVV-GFLEQRGVAPQRLSAQGM 183

Query: 158 AYKYPIDTNDTKVGRQNNQRIEIQI 182
               PI  N T+ GR  N+R+EI +
Sbjct: 184 GQNQPIADNSTEAGRAANRRVEIYL 208


>gi|226939690|ref|YP_002794763.1| OmpA/MotB [Laribacter hongkongensis HLHK9]
 gi|226714616|gb|ACO73754.1| OmpA/MotB [Laribacter hongkongensis HLHK9]
          Length = 225

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 42/220 (19%), Positives = 84/220 (38%), Gaps = 36/220 (16%)

Query: 5   LGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFG-------------------- 44
           L  S+ +   ++GC     ++    L  +    I+    G                    
Sbjct: 7   LVASVALAMIVTGCASQPGQQNPGGLSNTGMGAIIGTLGGAAAGALIGNSGKGALIGAAA 66

Query: 45  ---------SSLDKAEDEF----QMQLQDTGIVVSRIGDM-ITCYIPVHVSFV-SEVFLE 89
                      +D+ + E     + ++    + + +  D  +   +    +F  +   ++
Sbjct: 67  GAALGTGVGYYMDRQKAELESKLRSEISSGQMQLQQNADQSLVVTMNEDATFNLNSAVVK 126

Query: 90  KKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSN 149
             F P +  +A  L ++  T + I+ +TDS G    N  +S +RA+ +KSYL+ +   + 
Sbjct: 127 PAFYPTMNKVAETLKQYNQTTLVIRGYTDSTGAAAYNQQLSLKRANAVKSYLVGQ-GVAA 185

Query: 150 RFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGNIK 189
             I   G     P  +NDT  GR  N+R+ I I P+   +
Sbjct: 186 NRIQTIGMGESDPRASNDTAQGRAMNRRVSITIVPQQGAQ 225


>gi|315186462|gb|EFU20222.1| OmpA/MotB domain protein [Spirochaeta thermophila DSM 6578]
          Length = 395

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 41/165 (24%), Positives = 71/165 (43%), Gaps = 5/165 (3%)

Query: 26  KKVFLHKSNDTDIVNKRFGSSLDKAE-----DEFQMQLQDTGIVVSRIGDMITCYIPVHV 80
           K   +++   T      + S LD+ +     +     LQ     V    + +T  +    
Sbjct: 231 KTGDVYEFTGTADAEVVWASPLDREKVREEVEAAIEDLQIPDAEVETSEEGVTIRLENIQ 290

Query: 81  SFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSY 140
                  L  +    L+ IA IL+++P   + ++ HT   GT +  L +S ERA  +  +
Sbjct: 291 FPPDSAVLLPEEQEKLRKIAQILSRYPERDLLVEGHTALAGTPEGRLALSIERAKAVADF 350

Query: 141 LIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPR 185
           L++ GV     I ++G+    PI  N T+ GR  N+R+EI I   
Sbjct: 351 LMKLGVRRPEQIVIQGYGATRPIADNATEAGRSRNRRVEITILEN 395


>gi|78187197|ref|YP_375240.1| OmpA family protein [Chlorobium luteolum DSM 273]
 gi|78167099|gb|ABB24197.1| OmpA family protein [Chlorobium luteolum DSM 273]
          Length = 229

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 50/210 (23%), Positives = 91/210 (43%), Gaps = 28/210 (13%)

Query: 5   LGLSMFIMTTISGCGLASREKKKVFLHKSND---TDIVNKRFG----------------- 44
             L +   T   GC   SR  +   +  +       I+  R G                 
Sbjct: 13  FILILATATMTWGCESTSRTGRGAGIGATAGGVLGGIIGSRSGSWVKGALIGAAVGGAAG 72

Query: 45  ----SSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV-SEVFLEKKFLPMLQLI 99
               + +DK   E    +   G  V R+G+ I       + F      +       ++ +
Sbjct: 73  ALIGNYMDKQAAEIDRDV--DGARVERVGESIRVVFDSGILFTTGSATITSTSRYNIEKL 130

Query: 100 ATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAY 159
           A ILN++P T + I+ HTDSIG+   N L+S+ RA+ + + L++    S+  +S  G+  
Sbjct: 131 ARILNRYPDTNMVIEGHTDSIGSETQNQLLSERRAESV-ATLLKTYGVSSSRLSPVGYGE 189

Query: 160 KYPIDTNDTKVGRQNNQRIEIQIFPRGNIK 189
             P+ +N+T+ GR+ N+R+E+ I+   ++K
Sbjct: 190 TRPVASNETETGRRQNRRVEVLIYANDDLK 219


>gi|118578992|ref|YP_900242.1| OmpA/MotB domain-containing protein [Pelobacter propionicus DSM
           2379]
 gi|118501702|gb|ABK98184.1| OmpA/MotB domain protein [Pelobacter propionicus DSM 2379]
          Length = 224

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 45/156 (28%), Positives = 73/156 (46%), Gaps = 5/156 (3%)

Query: 35  DTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV-SEVFLEKKFL 93
              +V    G+ +D+     +  + +    V R G+ +   +P  + F   +  L+    
Sbjct: 66  SGAVVGGGIGNYMDRQAAALKKNMPE--AEVVRDGENVYVALPSGILFDTGKDELKTSAK 123

Query: 94  PMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFIS 153
             L   A  L     T I IQ HTDS G+ K N  +SQ RA+ ++ +L   GV S+R  +
Sbjct: 124 ESLAKAAATLKS-SETNIIIQGHTDSTGSDKINQPLSQRRANQVRDFLAANGVPSSRM-T 181

Query: 154 VRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGNIK 189
             G+    P   NDT+V R  N+R++++I P   IK
Sbjct: 182 AIGYGSSRPAVPNDTEVNRALNRRVQLEISPNEKIK 217


>gi|149372847|ref|ZP_01891868.1| OmpA family protein [unidentified eubacterium SCB49]
 gi|149354544|gb|EDM43109.1| OmpA family protein [unidentified eubacterium SCB49]
          Length = 235

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 43/225 (19%), Positives = 80/225 (35%), Gaps = 38/225 (16%)

Query: 1   MIKELGLSMFIMTT---ISGCGLASREKKKV----------------------------- 28
           +IK +G+    M     ++ C        K                              
Sbjct: 4   IIKNIGVIAMAMVLTVNLTSCEATQNANNKQKGAVIGAGAGAVLGAILGNNVGKGGNGEL 63

Query: 29  -FLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVH---VSFVS 84
             +             G+ +DK   E + ++   G  V R+ D I      +       +
Sbjct: 64  GAVLGGVVGGTAGVLIGNKMDKQAQEIESEIP--GAEVERVDDGIVITFDENSGVYFDTA 121

Query: 85  EVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQR 144
           +  +       L  +A +L ++  T + +  HTDS+G+  +N+L+SQ RA  + +Y    
Sbjct: 122 KYNINTASQQNLDKLAGVLQEYVDTNVLVVGHTDSVGSEDSNMLLSQRRAQAVTNYFTST 181

Query: 145 GVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGNIK 189
              S+   +   +  + P+  N T  GR  N+R+ I I P   +K
Sbjct: 182 KGLSSSRFTTNWYGEQTPVGDNATPEGRAQNRRVNIVIVPNEKMK 226


>gi|149277257|ref|ZP_01883399.1| lipoprotein PG3 [Pedobacter sp. BAL39]
 gi|149232134|gb|EDM37511.1| lipoprotein PG3 [Pedobacter sp. BAL39]
          Length = 226

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 49/173 (28%), Positives = 81/173 (46%), Gaps = 4/173 (2%)

Query: 19  GLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPV 78
           G  +       +  +          G  +DK   E Q  + +    V R G+ I      
Sbjct: 50  GKKAGNTAVGAIIGAAVGGTAGGFIGKRMDKQAAEIQNAIPN--AEVIREGEGIIVKFDS 107

Query: 79  HVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVI 137
            + F   +  L  +    ++ +A  LN++P T I +  HTD+ GT   N+ +S+ RA  +
Sbjct: 108 GILFGFDKADLTAQAKTNVKSLAGSLNQYPGTDIKVIGHTDNKGTETYNMGLSERRAAAV 167

Query: 138 KSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGNIKK 190
           K+Y + +GV S+R I+V G  +  PID N T+ GR  N+R+E+ I     +KK
Sbjct: 168 KAYAVSQGVPSSRLITV-GKGFSEPIDDNSTEAGRAANRRVEVVIVANDQLKK 219


>gi|330502404|ref|YP_004379273.1| OmpA/MotB domain-containing protein [Pseudomonas mendocina NK-01]
 gi|328916690|gb|AEB57521.1| OmpA/MotB domain-containing protein [Pseudomonas mendocina NK-01]
          Length = 217

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 45/191 (23%), Positives = 79/191 (41%), Gaps = 8/191 (4%)

Query: 1   MIKELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQD 60
           M     ++      I+GC     EKK+V    +     V + +   LD+ E + +  ++ 
Sbjct: 1   MRANKIIAFTCCLLIAGCA--GSEKKEVAKPAAMPAPQVTRAW---LDEYEPKLREAVKG 55

Query: 61  TGIVVSRIGDMITCYIPVHVSFVSE--VFLEKKFLPMLQLIATILNKFPSTVIAIQSHTD 118
           +     R  +++    PV  SF  +    L    L  +  +A +L       + +  H D
Sbjct: 56  SQFEFERRENLLVVTAPVQGSFNPDRPHMLLPASLGPITRVAKLLETDEDIAVVVLGHAD 115

Query: 119 SIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRI 178
           S G    N  +SQ+RA  + S     G+  +R + V G     P   ND+  GR  N+R+
Sbjct: 116 SSGDAALNRDLSQQRARAVTSIFRLSGLKQSR-LQVMGLGSDMPRAANDSAAGRALNRRV 174

Query: 179 EIQIFPRGNIK 189
           EI +  R  ++
Sbjct: 175 EILLTSRDTMQ 185


>gi|237806321|ref|ZP_04593025.1| OmpA/MotB [Pseudomonas syringae pv. oryzae str. 1_6]
 gi|331027434|gb|EGI07489.1| OmpA/MotB [Pseudomonas syringae pv. oryzae str. 1_6]
          Length = 194

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 46/163 (28%), Positives = 78/163 (47%), Gaps = 2/163 (1%)

Query: 23  REKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF 82
             + K  L  +      +  +G   DK E   +  + +TG+ V R GD I   +P +++F
Sbjct: 27  NHRGKGALIGAAVAGAASAGYGYYADKQEAALRESMANTGVEVQRQGDQIKLIMPGNITF 86

Query: 83  -VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYL 141
                 +   F   L  +A+ L +F    I I  +TDS G+ ++N+ +SQ+RA  + +YL
Sbjct: 87  ATDSSAIASSFYSPLNNLASSLKQFNQNNIEIVGYTDSTGSRQHNMDLSQQRAQSVATYL 146

Query: 142 IQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
             +       +SVRG     PI +N    GR  N+R+E+ + P
Sbjct: 147 TSQ-GVDQTHLSVRGAGPDQPIASNADVNGRAQNRRVEVNLKP 188


>gi|284040434|ref|YP_003390364.1| OmpA/MotB domain protein [Spirosoma linguale DSM 74]
 gi|283819727|gb|ADB41565.1| OmpA/MotB domain protein [Spirosoma linguale DSM 74]
          Length = 537

 Score =  112 bits (280), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 38/144 (26%), Positives = 68/144 (47%), Gaps = 1/144 (0%)

Query: 42  RFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIAT 101
             G+++D  + +   Q+ D  + +  I       +        +  L  +  P L  + T
Sbjct: 395 AEGANIDLTQPKGYQQITDQQLKLIPIEVGSVVRLNNIFFDTGKSELRPESGPELDRLVT 454

Query: 102 ILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKY 161
            LN  P   I ++ HTD+ G+ + N  +SQ+RAD ++ Y I +       I+ +GF    
Sbjct: 455 TLNDAPKMTIEVRGHTDNTGSNEINAKLSQDRADAVREYFISK-GIEPDRIASKGFGEAK 513

Query: 162 PIDTNDTKVGRQNNQRIEIQIFPR 185
           P  +N+T+ GRQ N+R+E  I  +
Sbjct: 514 PTASNNTEEGRQQNRRVEFVIVKK 537


>gi|224370810|ref|YP_002604974.1| OmpF [Desulfobacterium autotrophicum HRM2]
 gi|223693527|gb|ACN16810.1| OmpF [Desulfobacterium autotrophicum HRM2]
          Length = 213

 Score =  112 bits (280), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 48/216 (22%), Positives = 86/216 (39%), Gaps = 38/216 (17%)

Query: 1   MIKELGLSMFIM--TTISGCGLASREK---KKVFLHKSNDTDIVNKR------------- 42
           M K   +++       ++ C   + ++   K+  +  +    I+ +              
Sbjct: 1   MKKFTAIAVIAAVPLVMASCAGMTNQESRTKEGVIVGAGLGAILGQAIGGDTEGTLIGAG 60

Query: 43  ------------FGSSLDKAEDEFQMQLQ-DTGIVVSRIGDMITCYIPVHVSF-VSEVFL 88
                        G+ +D+ E   +  +       + R  +++T     +  F      L
Sbjct: 61  LGAAIGGVAGNQIGAYMDRQEQALRSAVATSEAASIQRSQNVLTATFKANTFFDFDSSTL 120

Query: 89  EKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSS 148
           +      L  +A +L  FP T I ++ HTDS GT + N+L+SQ RA  +   L+QRGV  
Sbjct: 121 KPGAYSELDRVAKVLRDFPQTRIRVEGHTDSKGTDQYNMLLSQRRAQAVTDALVQRGVDP 180

Query: 149 NRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
            R  S+ GF    P+ +ND       N+R+ I I P
Sbjct: 181 MRMESI-GFGESQPVSSNDGD-----NRRVNIVIIP 210


>gi|313201307|ref|YP_004039965.1| ompa/motb domain-containing protein [Methylovorus sp. MP688]
 gi|312440623|gb|ADQ84729.1| OmpA/MotB domain protein [Methylovorus sp. MP688]
          Length = 222

 Score =  112 bits (280), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 42/212 (19%), Positives = 82/212 (38%), Gaps = 32/212 (15%)

Query: 2   IKE--LGLSMFIMTTISGCGLASREKK---------------------------KVFLHK 32
           +K   +  S+ +  T+SGC   +  +K                                 
Sbjct: 1   MKSPLITSSLLLALTMSGCANMTETQKGTAKGAGIGAGVGAVVGALAGGSKGAAIGAAVG 60

Query: 33  SNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRI-GDMITCYIPVHV-SFVSEVFLEK 90
           +    I    +   +++ + + +     TG+ VS+   + +   IP  +     +  ++ 
Sbjct: 61  AGAGAIGGNVWSRRMEEQKQQMEQATAGTGVQVSQTADNRLKLDIPSDISFDSGKSDIKP 120

Query: 91  KFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNR 150
            F P+L   A  L   P+T + I  HTD+ GT   N  +S  RA+  + YL+ R   ++ 
Sbjct: 121 NFRPVLDSFAQSLVANPATKVTIVGHTDNTGTDAVNNPLSLNRANHARDYLVTR-GVASS 179

Query: 151 FISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
             +  G     P+  N++   R  N+R+EI +
Sbjct: 180 RFTTEGRGSHEPLVENNSDANRAKNRRVEIFV 211


>gi|288927544|ref|ZP_06421391.1| lipoprotein PG3 [Prevotella sp. oral taxon 317 str. F0108]
 gi|288330378|gb|EFC68962.1| lipoprotein PG3 [Prevotella sp. oral taxon 317 str. F0108]
          Length = 225

 Score =  112 bits (280), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 37/209 (17%), Positives = 72/209 (34%), Gaps = 27/209 (12%)

Query: 1   MIK-ELGLSMFIMTTISGCGLAS----------------------REKKKVFLHKSNDTD 37
           M K ++   +  +  + GC                                 +  +    
Sbjct: 1   MKKMKVLTLLMCLVLVFGCKTKQGTGTLIGTGGGALLGAVIGKVAGNTAVGAVVGATVGA 60

Query: 38  IVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMIT---CYIPVHVSF-VSEVFLEKKFL 93
                 G  +DK       Q+++  +      + +          + F  ++  L +   
Sbjct: 61  ATGSMIGKHMDKVAKRTAEQVKNAKVEEVTDANGLKAVKVTFDSGILFATNKATLNQSSK 120

Query: 94  PMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFIS 153
             L   + +L +     + I  HTD+ G    N+ +S  RA  + +YL   GV  ++F  
Sbjct: 121 NELAKFSQVLKENRDCHVDIYGHTDNTGNDGINIPLSNSRAQSVVNYLANCGVPRSQFQK 180

Query: 154 VRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           V G     P+ +N T  GRQ N+R+E+ +
Sbjct: 181 VEGKGSSDPVASNSTASGRQQNRRVEVYL 209


>gi|255319913|ref|ZP_05361114.1| inner membrane lipoprotein YiaD [Acinetobacter radioresistens SK82]
 gi|262379192|ref|ZP_06072348.1| type VI secretion system OmpA/MotB [Acinetobacter radioresistens
           SH164]
 gi|255303046|gb|EET82262.1| inner membrane lipoprotein YiaD [Acinetobacter radioresistens SK82]
 gi|262298649|gb|EEY86562.1| type VI secretion system OmpA/MotB [Acinetobacter radioresistens
           SH164]
          Length = 209

 Score =  112 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 50/209 (23%), Positives = 88/209 (42%), Gaps = 32/209 (15%)

Query: 2   IKELGLS-MFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRF----------------- 43
           ++ L +S +     +SGC     +K       +    +                      
Sbjct: 1   MRALMISTVVGAMALSGCQNMEYDK---AAIGTGLGALAGYGISKSNANSSAQNNRAAAI 57

Query: 44  --------GSSLDKAEDEFQMQLQDTGIVVSRIGDM-ITCYIPVHVSFV-SEVFLEKKFL 93
                   G  LD  E + + Q+  TG+ V+R  D  +   +P +++F  ++  ++  F 
Sbjct: 58  GAVVGAATGVYLDNKEKKLRQQMAGTGVEVNRNPDGSVGLIMPGNITFDTNKSTIKPNFY 117

Query: 94  PMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFIS 153
             L  +A  L +   + I +  +TDS G    N+ +SQ RA  + +YL  +GV   R I+
Sbjct: 118 TTLNKVAQTLTEDNKSAILVTGYTDSTGNDSINIPLSQARAQAVANYLAGQGVPRTR-IN 176

Query: 154 VRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
            +G     PI +N T  GR+ N+R+EI I
Sbjct: 177 AQGLGASNPIASNATAEGREQNRRVEISI 205


>gi|45600818|gb|AAS70302.1| motility protein B [Leptospira interrogans serovar Copenhageni str.
           Fiocruz L1-130]
          Length = 266

 Score =  112 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 40/150 (26%), Positives = 70/150 (46%), Gaps = 5/150 (3%)

Query: 41  KRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHV-SFVSEVFLEKKFLPMLQLI 99
            R     ++ E++   +++   I + R  D +   I   +        L+K+ LP L  I
Sbjct: 117 DRLSDQANELENKLTDEIKKGQIRLKRFHDRLVINIDDKISFDSGSADLKKQILPALDKI 176

Query: 100 ATILNKFPSTVIAIQSHTDSIGTL----KNNLLISQERADVIKSYLIQRGVSSNRFISVR 155
             IL  +P  +I I+ HTD++        +N  +S ERA  +  Y ++  +   R  S+ 
Sbjct: 177 KEILGNYPGNLIIIEGHTDNVPIRTKKFSDNWQLSGERALSVLHYFLESKILDPRNFSLA 236

Query: 156 GFAYKYPIDTNDTKVGRQNNQRIEIQIFPR 185
           G+    PI +NDT   R  N+R++I + PR
Sbjct: 237 GYGEFQPIVSNDTPENRALNRRVDIVVVPR 266


>gi|116328262|ref|YP_797982.1| endoflagellar motor protein [Leptospira borgpetersenii serovar
           Hardjo-bovis L550]
 gi|116121006|gb|ABJ79049.1| Endoflagellar motor protein [Leptospira borgpetersenii serovar
           Hardjo-bovis L550]
          Length = 340

 Score =  112 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 39/150 (26%), Positives = 70/150 (46%), Gaps = 5/150 (3%)

Query: 41  KRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHV-SFVSEVFLEKKFLPMLQLI 99
            R     ++ E++   +++   I + R  + +   I   +        L+K+ LP L  I
Sbjct: 191 DRLADQANELENKLGDEIKKGQIRLKRFHNRLVINIDDRISFDSGSAELKKQILPALDKI 250

Query: 100 ATILNKFPSTVIAIQSHTDSIGTL----KNNLLISQERADVIKSYLIQRGVSSNRFISVR 155
             IL  +P  +I I+ HTD++        +N  +S ERA  +  Y ++  +   R  S+ 
Sbjct: 251 KEILGNYPGNLIIIEGHTDNVPIRTRKFSDNWQLSGERALSVLHYFLESKILDPRNFSLA 310

Query: 156 GFAYKYPIDTNDTKVGRQNNQRIEIQIFPR 185
           G+    PI +NDT   R  N+R++I + PR
Sbjct: 311 GYGEFQPIVSNDTPENRALNRRVDIVVVPR 340


>gi|116330986|ref|YP_800704.1| endoflagellar motor protein [Leptospira borgpetersenii serovar
           Hardjo-bovis JB197]
 gi|116124675|gb|ABJ75946.1| Endoflagellar motor protein [Leptospira borgpetersenii serovar
           Hardjo-bovis JB197]
          Length = 340

 Score =  112 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 39/150 (26%), Positives = 70/150 (46%), Gaps = 5/150 (3%)

Query: 41  KRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHV-SFVSEVFLEKKFLPMLQLI 99
            R     ++ E++   +++   I + R  + +   I   +        L+K+ LP L  I
Sbjct: 191 DRLADQANELENKLGDEIKKGQIRLKRFHNRLVINIDDRISFDSGSAELKKQILPALDKI 250

Query: 100 ATILNKFPSTVIAIQSHTDSIGTL----KNNLLISQERADVIKSYLIQRGVSSNRFISVR 155
             IL  +P  +I I+ HTD++        +N  +S ERA  +  Y ++  +   R  S+ 
Sbjct: 251 KEILGNYPGNLIIIEGHTDNVPIRTRKFSDNWQLSGERALSVLHYFLESKILDPRNFSLA 310

Query: 156 GFAYKYPIDTNDTKVGRQNNQRIEIQIFPR 185
           G+    PI +NDT   R  N+R++I + PR
Sbjct: 311 GYGEFQPIVSNDTPENRALNRRVDIVVVPR 340


>gi|237740757|ref|ZP_04571238.1| outer membrane porin F [Fusobacterium sp. 2_1_31]
 gi|229422774|gb|EEO37821.1| outer membrane porin F [Fusobacterium sp. 2_1_31]
          Length = 173

 Score =  112 bits (279), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 48/178 (26%), Positives = 77/178 (43%), Gaps = 6/178 (3%)

Query: 10  FIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIG 69
            +    + C      K       S +   + +   +S    ED         G+ + R G
Sbjct: 1   MLALLATACSSKKVIKNTGVGVDSANKYAI-EDTEASKKPLEDII--VFDQEGVTIRREG 57

Query: 70  DMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLL 128
           + +   +P  + F   +  ++    P L  +A  L +     I I  +TD IGT   NL 
Sbjct: 58  NNLILSMPELILFDFDKYAVKDGIKPSLATLAKALGENKDIHIKIDGYTDFIGTEAYNLE 117

Query: 129 ISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRG 186
           +S +RA  IK +LI +G   +  IS+ G+  + P DTN T+ GR  N+R+E  I  RG
Sbjct: 118 LSVKRARAIKDFLISKGAIGSN-ISIEGYGEQNPADTNKTEAGRSRNRRVEF-IISRG 173


>gi|91776019|ref|YP_545775.1| OmpA/MotB [Methylobacillus flagellatus KT]
 gi|91710006|gb|ABE49934.1| OmpA/MotB [Methylobacillus flagellatus KT]
          Length = 214

 Score =  112 bits (279), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 49/208 (23%), Positives = 91/208 (43%), Gaps = 27/208 (12%)

Query: 1   MIKELGLSMFIM-TTISGCGLASREKKKVFLHKSNDTDIVN------------------- 40
           M   + ++  I    +SGC   S  +K   +       +                     
Sbjct: 1   MKTNITITTLIATLAMSGCANMSGTQKGAAIGAGAGAVVGAIAGKGKGAAIGAAVGAGAG 60

Query: 41  ----KRFGSSLDKAEDEFQMQLQDTGIVVSR-IGDMITCYIPVHVSF-VSEVFLEKKFLP 94
                 +   +++ + + +   +DTG+ VS+   + +   IP  +SF   +  +E  F  
Sbjct: 61  ALAGNVWSKRMEEQKRQMEEATKDTGVEVSQTEDNQLKLSIPSDISFASGKADIEPNFRV 120

Query: 95  MLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISV 154
           +L   AT L   P+T++ I  HTD+ G+   N  +S  RA   + YLI RG++++R  ++
Sbjct: 121 VLDNFATTLKNNPNTLVTIIGHTDNTGSDAINNPLSVNRAANTRDYLIARGIAASR-FTI 179

Query: 155 RGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
            G   + P+ +NDT   R  N+R+EI +
Sbjct: 180 DGRGSREPLVSNDTPANRAKNRRVEIFV 207


>gi|302389670|ref|YP_003825491.1| OmpA/MotB domain protein [Thermosediminibacter oceani DSM 16646]
 gi|302200298|gb|ADL07868.1| OmpA/MotB domain protein [Thermosediminibacter oceani DSM 16646]
          Length = 248

 Score =  111 bits (278), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 38/163 (23%), Positives = 67/163 (41%), Gaps = 9/163 (5%)

Query: 30  LHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDT---GIVVSRIGDMITCY-IPVHVSFVSE 85
              +   ++         +  E+ FQ  + +    GI V R    +    I   +    +
Sbjct: 78  EGDALGGNLSGAGERREFENLENTFQEIINENNLKGIRVEREERGLAIRFIEGALFDSGK 137

Query: 86  VFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKN----NLLISQERADVIKSYL 141
            +L +    +L  IA IL K     I ++ HTD++    +    N  +S  RA  +  Y 
Sbjct: 138 AYLREDARQVLDKIAPILKKI-QRPIRVEGHTDNVPIHNSEFPSNWELSTTRAVNVVRYF 196

Query: 142 IQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           I++   S   IS  G+   +PI  ND++  R  N+R++I I  
Sbjct: 197 IEKHNISPHMISAAGYGEYHPIAPNDSEKNRALNRRVDIIILN 239


>gi|325983492|ref|YP_004295894.1| OmpA/MotB domain-containing protein [Nitrosomonas sp. AL212]
 gi|325533011|gb|ADZ27732.1| OmpA/MotB domain protein [Nitrosomonas sp. AL212]
          Length = 227

 Score =  111 bits (278), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 46/213 (21%), Positives = 83/213 (38%), Gaps = 32/213 (15%)

Query: 2   IKELGLSM--FIMTTISGCGLASREKKKVFLHKSND------------------------ 35
           +K L + +   ++ T++GC   +  ++      +                          
Sbjct: 1   MKTLSILIVQALILTLTGCTTMTDTQRGTAQGTAIGAGTGAAIGALIGGKKGAAIGAGSG 60

Query: 36  ---TDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSR-IGDMITCYIPVHV-SFVSEVFLEK 90
                     +   +++ + E +     TG+ V++   + +   IP  +        ++ 
Sbjct: 61  ALLGAGAGYMWSQRMEEQKREMETATAGTGVQVTQTEDNRLKLNIPSDISFDTGRADIKP 120

Query: 91  KFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNR 150
            F P+L   AT L     T + I  HTDS G+   N  +S  RA   + YL+ RGVS  R
Sbjct: 121 GFRPILDNFATTLISNEGTAVKIIGHTDSTGSDAINNPLSVNRAASTRDYLVSRGVSIKR 180

Query: 151 FISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
            I + G   + P+  NDT   R  N+R+EI + 
Sbjct: 181 -IQIDGRGSREPMAENDTPENRAENRRVEIFVT 212


>gi|284035694|ref|YP_003385624.1| OmpA/MotB domain protein [Spirosoma linguale DSM 74]
 gi|283814987|gb|ADB36825.1| OmpA/MotB domain protein [Spirosoma linguale DSM 74]
          Length = 236

 Score =  111 bits (278), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 44/221 (19%), Positives = 95/221 (42%), Gaps = 35/221 (15%)

Query: 2   IKELGLSMFIMTT----ISGCGLAS--REKKKVFLHKSNDTDIVNKRFGS---------- 45
            K L + M         ++ C  +    + ++  +  ++   ++    G+          
Sbjct: 10  KKSLAVLMAAGILSGNVLTSCKSSKRLNQTQQGGVIGASSGAVIGGIIGNKTGNTALGAI 69

Query: 46  ---------------SLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV-SEVFLE 89
                           +DK  +E + Q+ +    V R+G+ I   +   + F      L+
Sbjct: 70  LGATVGGAAGAVIGRRMDKQAEEIKRQMPN--AQVERVGEGIKVSLGSDILFDVDSYALK 127

Query: 90  KKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSN 149
            +    L   A  LNK+  T + I+ H D+ G+  +NL +S++RA  + S+L  +GV ++
Sbjct: 128 PETKQQLIEFAKSLNKYEDTDVRIEGHADATGSDSHNLELSKQRAKAVGSFLESQGVKTS 187

Query: 150 RFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGNIKK 190
           R   + G+    P+  N T+ GR+ N+R+++ +F    +++
Sbjct: 188 RVDEI-GYGEAQPVADNSTEAGRRKNRRVDVAVFANKQLQR 227


>gi|83746716|ref|ZP_00943765.1| Hypothetical Protein RRSL_03628 [Ralstonia solanacearum UW551]
 gi|207721381|ref|YP_002251822.1| bacterial outer membrane protein [Ralstonia solanacearum MolK2]
 gi|207742640|ref|YP_002259032.1| bacterial outer membrane protein [Ralstonia solanacearum IPO1609]
 gi|83726669|gb|EAP73798.1| Hypothetical Protein RRSL_03628 [Ralstonia solanacearum UW551]
 gi|206586540|emb|CAQ17127.1| bacterial outer membrane protein [Ralstonia solanacearum MolK2]
 gi|206594034|emb|CAQ60961.1| bacterial outer membrane protein [Ralstonia solanacearum IPO1609]
          Length = 209

 Score =  111 bits (278), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 48/207 (23%), Positives = 75/207 (36%), Gaps = 24/207 (11%)

Query: 1   MIKELGLSMFIMTTISGCGLASREKK---------------------KVFLHKSNDTDIV 39
           M  +L     I    +GC    + +                      K            
Sbjct: 1   MKAKLISVSLIALLAAGCATQQQNQTLAGTGVGAAVGAGIGALVGNSKGAAIGGALGAAG 60

Query: 40  NKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDM-ITCYIPVHV-SFVSEVFLEKKFLPMLQ 97
               G + +  + +       TG  +S   D  +   IP  V        ++  F   L 
Sbjct: 61  GAAVGYNWNAIKSKLTGDTAGTGTQISEQPDGSLKLNIPSQVSFDTDSAMIKPSFRGPLD 120

Query: 98  LIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGF 157
            +A  L + P    ++  HTDS G    N+ +SQ RA  + SYL  RGV+ NR ++  G 
Sbjct: 121 SVAETLTQHPELAASVVGHTDSTGNPNYNMSLSQRRAQSVTSYLTDRGVARNR-LTAEGR 179

Query: 158 AYKYPIDTNDTKVGRQNNQRIEIQIFP 184
               P+  N T+ GR  N+R+EI + P
Sbjct: 180 GQTQPVGDNATEAGRAQNRRVEIYLKP 206


>gi|255037862|ref|YP_003088483.1| OmpA/MotB domain-containing protein [Dyadobacter fermentans DSM
           18053]
 gi|254950618|gb|ACT95318.1| OmpA/MotB domain protein [Dyadobacter fermentans DSM 18053]
          Length = 525

 Score =  111 bits (278), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 34/148 (22%), Positives = 70/148 (47%), Gaps = 1/148 (0%)

Query: 38  IVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQ 97
              +    +    +++   ++ +  + +  I +     +        +  L ++  P L 
Sbjct: 379 AEGENIDLTDSTGKEKSFKEIANKSLKLIPIEEGQIVRLNNIFFATGKATLREESFPELN 438

Query: 98  LIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGF 157
            IA  + +  +  I +  HTD+ G+ + N+ +SQERAD ++ YLI +       I+ +G+
Sbjct: 439 RIAISMTENKTLAIELGGHTDNTGSAEFNVNLSQERADTVREYLIGK-GIEPDRIASKGY 497

Query: 158 AYKYPIDTNDTKVGRQNNQRIEIQIFPR 185
               P+ TNDT  G+Q N+R+E +I  +
Sbjct: 498 GETKPVATNDTPEGQQQNRRVEFKILKK 525


>gi|226946149|ref|YP_002801222.1| OmpA family protein [Azotobacter vinelandii DJ]
 gi|226721076|gb|ACO80247.1| OmpA family protein [Azotobacter vinelandii DJ]
          Length = 222

 Score =  111 bits (278), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 46/163 (28%), Positives = 80/163 (49%), Gaps = 2/163 (1%)

Query: 23  REKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF 82
             + K  L  +         +G   DK E + + Q+  TG+ V R G+ I   +P +++F
Sbjct: 51  DNRGKGALIGAAVGGAAGAGYGYYADKQEAQLRQQMAGTGVEVQRQGNDIKLIMPGNITF 110

Query: 83  -VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYL 141
                 +   F   L  +A    ++    I +  HTDS G+ + N+ +SQ RA  + +YL
Sbjct: 111 ATGSAEIASNFYTPLNDLANSFKQYDQNSIEVIGHTDSTGSYQTNMSLSQRRAQSVANYL 170

Query: 142 IQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           + +GV+  R ++ RG     P+ +N T+ GR  N+R+EI + P
Sbjct: 171 VAQGVNGAR-VTTRGAGPDSPVASNATESGRSQNRRVEINLRP 212


>gi|253999219|ref|YP_003051282.1| OmpA/MotB domain-containing protein [Methylovorus sp. SIP3-4]
 gi|253985898|gb|ACT50755.1| OmpA/MotB domain protein [Methylovorus sp. SIP3-4]
          Length = 222

 Score =  111 bits (278), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 42/212 (19%), Positives = 82/212 (38%), Gaps = 32/212 (15%)

Query: 2   IKE--LGLSMFIMTTISGCGLASREKK---------------------------KVFLHK 32
           +K   +  S+ +  T+SGC   +  +K                                 
Sbjct: 1   MKSPLITSSLLLALTMSGCANMTETQKGTAKGAGIGAGVGAVVGALAGGSKGAAIGAAVG 60

Query: 33  SNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRI-GDMITCYIPVHV-SFVSEVFLEK 90
           +    I    +   +++ + + +     TG+ VS+   + +   IP  +     +  ++ 
Sbjct: 61  AGAGAIGGNVWSRRMEEQKQQMEQATAGTGVQVSQTADNRLKLDIPSDISFDSGKSDIKP 120

Query: 91  KFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNR 150
            F P+L   A  L   P+T + I  HTD+ GT   N  +S  RA+  + YL+ R   ++ 
Sbjct: 121 NFRPVLDSFAQSLVANPATRVTIVGHTDNTGTDAVNNPLSLNRANHARDYLVTR-GVASS 179

Query: 151 FISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
             +  G     P+  N++   R  N+R+EI +
Sbjct: 180 RFTTEGRGSHEPLVENNSDANRAKNRRVEIFV 211


>gi|312127873|ref|YP_003992747.1| OmpA/MotB domain-containing protein [Caldicellulosiruptor
           hydrothermalis 108]
 gi|311777892|gb|ADQ07378.1| OmpA/MotB domain protein [Caldicellulosiruptor hydrothermalis 108]
          Length = 257

 Score =  111 bits (278), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 31/171 (18%), Positives = 58/171 (33%), Gaps = 7/171 (4%)

Query: 20  LASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEF---QMQLQDTGIVVSRIGDMITCYI 76
                K           +          D  +      +    +  ++V +    ++  +
Sbjct: 76  SGKNVKGTNTDVGGTTKNKQMTEEELINDIQKQVLGLIKEHGIEGKVLVIQEERGLSILL 135

Query: 77  PVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNN----LLISQE 132
              +       L  +   ++  IA IL K P+  I I+ HTD++            +S  
Sbjct: 136 KDVLFDTGSAKLTPQAKGVVHEIAKILEKVPNNNIRIEGHTDNVPIHNKYFYSNWELSTA 195

Query: 133 RADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
           RA  +   +++         SV G+    PI +N T  GR  N+R+ I I 
Sbjct: 196 RATSVLQEILRVSKVRPERFSVVGYGEYRPIASNKTPEGRALNRRVTIVIL 246


>gi|86131069|ref|ZP_01049668.1| OmpA family protein [Dokdonia donghaensis MED134]
 gi|85818480|gb|EAQ39640.1| OmpA family protein [Dokdonia donghaensis MED134]
          Length = 470

 Score =  111 bits (278), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 41/191 (21%), Positives = 78/191 (40%), Gaps = 14/191 (7%)

Query: 8   SMFIMTTISGCGLASREKKKVFLH------------KSNDTDIVNKRFGSSLDKAEDEFQ 55
           ++  +  + GC  A  +  K                     D          D+  D   
Sbjct: 281 TVAGIAALGGCPDADGDGIKDADDNCPNEAGPRANNGCPYQDKDGDGVLDKDDECPDVAG 340

Query: 56  MQLQDTGIVVSRIG-DMITCYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQ 114
               +    VS    + +       +   ++  +  +    L  +A+++ ++P+T   I+
Sbjct: 341 TVANNGCPEVSVEVLNDLNVETKKVLFDYNKASIRTESYATLDKVASVMMEYPTTRFLIE 400

Query: 115 SHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQN 174
            HTD  G    NL +S +RA  ++SYL  +G+ ++R  S +GF    P+ +N T  GRQ 
Sbjct: 401 GHTDDRGRDAYNLDLSDQRAASVRSYLTGKGIPASRLES-KGFGEARPVASNKTAAGRQE 459

Query: 175 NQRIEIQIFPR 185
           N+R+E+ I  +
Sbjct: 460 NRRVELSILEQ 470


>gi|332664439|ref|YP_004447227.1| OmpA/MotB domain-containing protein [Haliscomenobacter hydrossis
           DSM 1100]
 gi|332333253|gb|AEE50354.1| OmpA/MotB domain protein [Haliscomenobacter hydrossis DSM 1100]
          Length = 228

 Score =  111 bits (277), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 39/165 (23%), Positives = 71/165 (43%), Gaps = 3/165 (1%)

Query: 20  LASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVH 79
               +  K  L  +    I     GS +DK   + +  L      V R+G+ I       
Sbjct: 52  AKGSDNAKGILIGATVGGIAGAIIGSYMDKHARKLKEDL-GKSAEVERVGESILVTFDSG 110

Query: 80  VSFV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIK 138
           + F      L+      L   A  + ++  T I +  HTD+ G+ + N  +S+ RA  + 
Sbjct: 111 IMFDVDSYALKAATRANLDKAAETMKEYDKTEIIVMGHTDATGSDEYNQKLSENRAAAVS 170

Query: 139 SYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
           S  +Q+   +   ++ +GF  + P+ +N +  GR+ N+R+EI I 
Sbjct: 171 S-FLQQNGVTASRLTKKGFGEQKPVASNTSVSGREQNRRVEIAIV 214


>gi|332291754|ref|YP_004430363.1| OmpA/MotB domain protein [Krokinobacter diaphorus 4H-3-7-5]
 gi|332169840|gb|AEE19095.1| OmpA/MotB domain protein [Krokinobacter diaphorus 4H-3-7-5]
          Length = 471

 Score =  111 bits (277), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 42/194 (21%), Positives = 80/194 (41%), Gaps = 20/194 (10%)

Query: 8   SMFIMTTISGCGLASREKKKVFLH----------------KSNDTDIVNKRFGSSLDKAE 51
           ++  +  + GC  A  +  K                    +  D D V  +     D A 
Sbjct: 282 TVAGVAALGGCPDADGDGIKDADDACPNEAGPRSNNGCPFEDKDGDGVLDKDDECPDVAG 341

Query: 52  DEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVI 111
                   +  + V    + +       +   ++  +  +    L  +A+++ ++P+T  
Sbjct: 342 TVANNGCPEVSVEVL---NELNLETKKVLFDYNKASIRTESYATLDKVASVMMEYPTTRF 398

Query: 112 AIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVG 171
            I+ HTD  G    NL +S +RA  ++SYL  +G+ + R  S +GF    P+ +N T  G
Sbjct: 399 LIEGHTDDRGRDAYNLDLSDQRAASVRSYLTGKGIPAARLES-KGFGEARPVASNKTAAG 457

Query: 172 RQNNQRIEIQIFPR 185
           RQ N+R+E+ I  +
Sbjct: 458 RQENRRVELSILEQ 471


>gi|260062849|ref|YP_003195929.1| OmpA family protein [Robiginitalea biformata HTCC2501]
 gi|88784417|gb|EAR15587.1| OmpA family protein [Robiginitalea biformata HTCC2501]
          Length = 231

 Score =  111 bits (277), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 43/212 (20%), Positives = 85/212 (40%), Gaps = 31/212 (14%)

Query: 9   MFIMTTISGCGLA--SREKKKVFLHKSNDTDIVNKRFGS--------------------- 45
           M I+  + GC     +  K+K  +  ++   ++    G+                     
Sbjct: 12  MLILGLVFGCNTVKNANNKQKGAVIGASSGAVIGGVVGNNVGKGNTVLGAIIGGVVGGVA 71

Query: 46  ------SLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSE-VFLEKKFLPMLQL 98
                  +D+  ++ + +L    +     G  +T      V F +    +E   +  L  
Sbjct: 72  GGYIGDRMDRQAEKIEEELPGAEVKRVGEGINVTFTQDQGVHFATNQSAIEGASVTTLNK 131

Query: 99  IATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFA 158
           +A I  ++P +VI ++ HTDS G    N+ +SQ RA+ + +YL+ +        +VR + 
Sbjct: 132 LAGIFKEYPKSVILVEGHTDSAGPEDYNMSLSQRRAESVVNYLVAQ-GIDKDRFTVRWYG 190

Query: 159 YKYPIDTNDTKVGRQNNQRIEIQIFPRGNIKK 190
              P   N T  G+  N+R+E+ I     +K+
Sbjct: 191 ETQPRADNSTAEGKAQNRRVEMGIIASEALKE 222


>gi|312134920|ref|YP_004002258.1| OmpA/MotB domain-containing protein [Caldicellulosiruptor
           owensensis OL]
 gi|311774971|gb|ADQ04458.1| OmpA/MotB domain protein [Caldicellulosiruptor owensensis OL]
          Length = 257

 Score =  111 bits (277), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 33/173 (19%), Positives = 59/173 (34%), Gaps = 5/173 (2%)

Query: 15  ISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITC 74
           +SG          V     N      +       +     +    +   +V +    ++ 
Sbjct: 75  LSG-KNVKGTNTDVGGTTKNRQMTEEELINDIQKQVLGLIKEHGIEGKALVIQEERGLSI 133

Query: 75  YIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNN----LLIS 130
            +   +       L  +   ++  IA IL K P   I I+ HTD++            +S
Sbjct: 134 LLKDVLFNTGSAKLTPQAKEVVHEIAKILEKVPDNNIRIEGHTDNVPIHNKYFYSNWELS 193

Query: 131 QERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
             RA  +   +++         SV G+    PI +N T  GR  N+R+ I I 
Sbjct: 194 TARATSVLQEILRVSKVRPERFSVVGYGEYRPIASNKTPEGRALNRRVTIVIL 246


>gi|300703368|ref|YP_003744970.1| outer membrane lipoprotein [Ralstonia solanacearum CFBP2957]
 gi|299071031|emb|CBJ42340.1| putative outer membrane lipoprotein [Ralstonia solanacearum
           CFBP2957]
          Length = 209

 Score =  111 bits (277), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 47/207 (22%), Positives = 74/207 (35%), Gaps = 24/207 (11%)

Query: 1   MIKELGLSMFIMTTISGCGLASREKK---------------------KVFLHKSNDTDIV 39
           M  +L     I    +GC    + +                      K            
Sbjct: 1   MKAKLISVSLIALLAAGCATQQQNQTLAGTGVGAAVGAGIGALVGNSKGAAIGGALGAAG 60

Query: 40  NKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDM-ITCYIPVHV-SFVSEVFLEKKFLPMLQ 97
               G + +  + +       TG  +S   D  +   IP  V        ++  F   L 
Sbjct: 61  GAAVGYNWNAIKSKLTGDTAGTGTQISEQPDGSLKLNIPSQVSFDTDSAMIKPSFRGPLD 120

Query: 98  LIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGF 157
            +A  L + P    ++  HTDS G    N+ +SQ RA  + SYL  RGV+  R ++  G 
Sbjct: 121 SVAETLTQHPELAASVVGHTDSTGNPNYNMSLSQRRAQSVTSYLTDRGVARTR-LTAEGR 179

Query: 158 AYKYPIDTNDTKVGRQNNQRIEIQIFP 184
               P+  N T+ GR  N+R+EI + P
Sbjct: 180 GQTQPVGDNATEAGRAQNRRVEIYLKP 206


>gi|86130189|ref|ZP_01048789.1| OmpA family protein [Dokdonia donghaensis MED134]
 gi|85818864|gb|EAQ40023.1| OmpA family protein [Dokdonia donghaensis MED134]
          Length = 236

 Score =  111 bits (277), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 44/226 (19%), Positives = 93/226 (41%), Gaps = 39/226 (17%)

Query: 1   MIKELGLSMFIMTTISG---CGLA--SREKKKVFLHKSNDTDIVNKRFG----------- 44
           +++ + +       ++G   C     +  K+K  +  +    I+    G           
Sbjct: 4   ILRNITVVALGAAMLTGFTSCEATKNANNKQKGAVIGATGGAILGAIIGNNAGSGGNGEL 63

Query: 45  -----------------SSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVH---VSFVS 84
                            + +DK   + + ++   G  V R+ D I      +       +
Sbjct: 64  GAVIGGVVGGGAGVLIGNKMDKQAQQIEQEIP--GASVERVDDGIVVTFDENSGVYFDTA 121

Query: 85  EVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQR 144
           +  +      ML  ++ I+ ++  T + +  HTDS+G+  +NL +SQ RA+ + +Y+I  
Sbjct: 122 KYNINANSQTMLNKLSNIMKEYNQTNVIVAGHTDSVGSDASNLTLSQNRANAVTNYMIGT 181

Query: 145 GVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGNIKK 190
           G+S+ R  +   +    P  +NDT  GR  N+R+++ I P   +K+
Sbjct: 182 GLSAGR-FTTVWYGEAQPAASNDTAEGRAQNRRVQLAIVPNEQMKE 226


>gi|300113303|ref|YP_003759878.1| OmpA/MotB domain-containing protein [Nitrosococcus watsonii C-113]
 gi|299539240|gb|ADJ27557.1| OmpA/MotB domain protein [Nitrosococcus watsonii C-113]
          Length = 283

 Score =  111 bits (277), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 40/165 (24%), Positives = 65/165 (39%), Gaps = 10/165 (6%)

Query: 18  CGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIP 77
           C            ++    D         LD+  D         G+ V  +G      + 
Sbjct: 125 CPDTP--PGVAVNNEGCPVDSDGDGVPDDLDECPD------TAHGVSVDEVGCPKPVVLQ 176

Query: 78  VHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADV 136
             V F      L      +L  +A  +   P+  + I  +TDSIG    N+ +S+ RA+ 
Sbjct: 177 SGVHFGFDSAKLSPNAHTILDKVAEKMRAHPNLKVTITGYTDSIGNADYNMRLSKLRAEA 236

Query: 137 IKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQ 181
              YL   G+  +R  +V G   + P+ +N TK GR  N+R+E+Q
Sbjct: 237 AMDYLSSEGIDPSRMEAV-GRGEERPVASNSTKEGRAKNRRVELQ 280


>gi|319796493|ref|YP_004158133.1| ompa/motb domain protein [Variovorax paradoxus EPS]
 gi|315598956|gb|ADU40022.1| OmpA/MotB domain protein [Variovorax paradoxus EPS]
          Length = 219

 Score =  111 bits (277), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 46/217 (21%), Positives = 82/217 (37%), Gaps = 32/217 (14%)

Query: 1   MIKELGLSMFIMTTISGCGLASREKKKVF----------------LHKSNDTDIVNKR-- 42
           M K +  +      +SGC     + ++                      N   I      
Sbjct: 1   MKKFVLATCATAIVLSGCAGGMTDTQRNTGIGAGIGALGGAAIGSATGGNRGAIGTGAVV 60

Query: 43  -----------FGSSLDKAEDEFQMQLQDTGIVVSRIGDM-ITCYIPVHVSFV-SEVFLE 89
                      +   ++  + + +   Q TG+ V++  +  +   IP  VSF      ++
Sbjct: 61  GAAAGALGGYLWSQRMENQKRQMEAATQGTGVAVTQTQNNELKLAIPSDVSFDVGRANIK 120

Query: 90  KKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSN 149
             F P+L   A+ L   P+  + I  HTDS G+   N  +S +RA   + YL+ R   + 
Sbjct: 121 PNFAPVLDQFASGLRNNPNAEVRIIGHTDSTGSDAINNPLSVDRAASTRDYLVAR-GVNA 179

Query: 150 RFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRG 186
               + G     P+  N++  GR  N+R+EI +  RG
Sbjct: 180 AAFRIEGRGSHEPVADNNSDAGRAQNRRVEIYVGERG 216


>gi|295134535|ref|YP_003585211.1| OmpA/MotB family outer hypothetical protein [Zunongwangia profunda
           SM-A87]
 gi|294982550|gb|ADF53015.1| OmpA/MotB family outer membrane protein [Zunongwangia profunda
           SM-A87]
          Length = 232

 Score =  111 bits (277), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 39/224 (17%), Positives = 78/224 (34%), Gaps = 35/224 (15%)

Query: 1   MIKE----LGLSMFIMTTISGCGLASREKKKVFL------------------HKSNDTDI 38
           M+K+    +    F  + +  C        K                         ++ +
Sbjct: 1   MMKKTINKIVAVFFAASVLVSCDAIQNANNKQKGAVIGSAGGAAIGGVIGNNTGDGNSAL 60

Query: 39  VNKR-----------FGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVS-EV 86
                           G+ +DK   + + ++    +     G  +T      V F + + 
Sbjct: 61  GAIIGGVVGGAAGAYIGNRMDKQAKKIETEVPGAEVERVGEGINVTFDENSGVYFATEKY 120

Query: 87  FLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGV 146
            +  K    L  +A I  ++P T I ++ HTD+ G+   NL +S+ RA  + +  +    
Sbjct: 121 NINAKSEETLNKLANIFKEYPDTNILVEGHTDNTGSESYNLTLSKNRAQAVTN-FLTDHG 179

Query: 147 SSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGNIKK 190
            +      + +    P   N T  GR  N+R+EI I    ++K+
Sbjct: 180 IAASRFDTKWYGEAQPKYDNSTAEGRSKNRRVEIAIVANEDLKQ 223


>gi|194336698|ref|YP_002018492.1| OmpA/MotB domain protein [Pelodictyon phaeoclathratiforme BU-1]
 gi|194309175|gb|ACF43875.1| OmpA/MotB domain protein [Pelodictyon phaeoclathratiforme BU-1]
          Length = 229

 Score =  111 bits (277), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 49/211 (23%), Positives = 90/211 (42%), Gaps = 29/211 (13%)

Query: 6   GLSMFIMTTIS-GCGLASREK------------------------KKVFLHKSNDTDIVN 40
            L +  MTT++ GC   +                            K  +  +       
Sbjct: 13  FLLILAMTTVTWGCQTTTNAGQGAGIGAAAGGVIGGIIGSRSGSWAKGAIIGAVLGGAGG 72

Query: 41  KRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLI 99
              G+ +DK   E    +   G  V R+G+ I       + F      +       ++ +
Sbjct: 73  ALIGNYMDKQAAEIDHDV--EGARVERVGEGIRVIFDSGILFSTGSATITSTSRYNIEKL 130

Query: 100 ATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAY 159
           A ILN++  T + I+ HTDSIG+   N  +S+ RAD + + L++    S R +S  G+  
Sbjct: 131 ARILNRYNETSLVIEGHTDSIGSDDANQSLSERRADSVAN-LLEAYRVSGRRLSPIGYGE 189

Query: 160 KYPIDTNDTKVGRQNNQRIEIQIFPRGNIKK 190
             P+ +N+T+ GR+ N+R+E+ I+   ++K+
Sbjct: 190 TRPVSSNETEYGRKLNRRVEVLIYANDDLKR 220


>gi|82701882|ref|YP_411448.1| OmpA/MotB [Nitrosospira multiformis ATCC 25196]
 gi|82409947|gb|ABB74056.1| OmpA/MotB [Nitrosospira multiformis ATCC 25196]
          Length = 225

 Score =  110 bits (276), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 47/216 (21%), Positives = 78/216 (36%), Gaps = 35/216 (16%)

Query: 1   MIKEL-GLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVN------------------- 40
           M K+L  +S+  +  + GC  +   +       +    I                     
Sbjct: 1   MRKQLSVISITTVLALGGCASSPETQSTRTRDTAIGAGIGAGTGALIGAIAGKGKGAAIG 60

Query: 41  ------------KRFGSSLDKAEDEFQMQLQDTGIVVSRI-GDMITCYIPVHV-SFVSEV 86
                         +   +++ + E +     TG+ V +   + +   IP  +       
Sbjct: 61  AAAGAGLGAIAGNVWSRRMEEQKREMEQATAGTGVEVVKTSDNRLRLDIPSDISFDTGRA 120

Query: 87  FLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGV 146
            +   F P+L   AT LN  P T + I  HTDS G+   N  +S  RA   + YL  R  
Sbjct: 121 DIRPNFRPVLDSFATSLNNNPITEVTIIGHTDSSGSDAVNNPLSLNRAASTRDYLASR-G 179

Query: 147 SSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
            S   + + G   + PI  NDT   R  N+R+EI +
Sbjct: 180 VSPNRVRIEGRGSREPIVANDTPQNRARNRRVEIYV 215


>gi|149191103|ref|ZP_01869362.1| flagellar motor protein MotB [Vibrio shilonii AK1]
 gi|148835031|gb|EDL52009.1| flagellar motor protein MotB [Vibrio shilonii AK1]
          Length = 294

 Score =  110 bits (276), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 39/174 (22%), Positives = 79/174 (45%), Gaps = 6/174 (3%)

Query: 15  ISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITC 74
           ++G   A R +K      S  ++  N+      +  +   Q +++   + V  +G  +  
Sbjct: 107 MTGGQTADRTQKNQIGTASAQSEQENEDLDKLEEIIKKALQQEIKQGAVEVDNLGQQLVI 166

Query: 75  YIPVHVSFV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGT----LKNNLLI 129
            I    +F     FL+ KF P+++ +A ++   P   + +  HTD++       ++N  +
Sbjct: 167 RIQEKGAFPEGSAFLQPKFRPLVRQVADLVKDIPG-QVRVSGHTDNLPLDSELYRSNWDL 225

Query: 130 SQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
           S +RA  +   + +    S++ + V G A   P+  NDT+  R  N+R+EI I 
Sbjct: 226 SSQRAVSVAQEMEKVKGFSHQRLRVLGVADTEPLGPNDTERQRARNRRVEISIM 279


>gi|300690749|ref|YP_003751744.1| outer membrane lipoprotein [Ralstonia solanacearum PSI07]
 gi|299077809|emb|CBJ50447.1| putative outer membrane lipoprotein [Ralstonia solanacearum PSI07]
          Length = 209

 Score =  110 bits (276), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 48/207 (23%), Positives = 74/207 (35%), Gaps = 24/207 (11%)

Query: 1   MIKELGLSMFIMTTISGCGLASREKK---------------------KVFLHKSNDTDIV 39
           M  +L     I    +GC    + +                      K            
Sbjct: 1   MKAKLISVSLIALLAAGCATQQQNQTLAGTGVGAAVGAGIGALVGNSKGAAIGGALGAAG 60

Query: 40  NKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDM-ITCYIPVHV-SFVSEVFLEKKFLPMLQ 97
               G + +  + +       TG  +S   D  +   IP  V        ++  F   L 
Sbjct: 61  GAAVGYNWNAIKSKLTGDTAGTGTQISEQPDGSLKLNIPSQVSFDTDSAVIKPSFRGPLD 120

Query: 98  LIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGF 157
            +A  L + P     +  HTDS G    N+ +SQ RA  + SYL  RGV+ NR ++  G 
Sbjct: 121 SVAETLTQHPELAANVVGHTDSTGNPNYNMSLSQRRAQSVTSYLTDRGVARNR-LTAEGR 179

Query: 158 AYKYPIDTNDTKVGRQNNQRIEIQIFP 184
               P+  N T+ GR  N+R+EI + P
Sbjct: 180 GQTQPVGDNATEAGRSQNRRVEIYLKP 206


>gi|59711322|ref|YP_204098.1| flagellar motor protein MotB [Vibrio fischeri ES114]
 gi|197335182|ref|YP_002155478.1| flagellar motor protein [Vibrio fischeri MJ11]
 gi|59479423|gb|AAW85210.1| flagellar motor protein MotB1 [Vibrio fischeri ES114]
 gi|197316672|gb|ACH66119.1| flagellar motor protein [Vibrio fischeri MJ11]
          Length = 309

 Score =  110 bits (276), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 37/170 (21%), Positives = 74/170 (43%), Gaps = 6/170 (3%)

Query: 19  GLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPV 78
           G +     +     +++++   +      D  +   + ++ +  I V  +G  +   I  
Sbjct: 126 GESPSNSTQTSAQSNSESESQTQSQQELEDTIKKALEREISEGAIEVENLGQQLVIRIRE 185

Query: 79  HVSFV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGT----LKNNLLISQER 133
             +F     FL+ KF P+++ IA ++   P   I +  HTD+        ++N  +S +R
Sbjct: 186 KGAFPAGSAFLQPKFRPLIRQIAELVKDVPGI-IRVSGHTDNQPLDSELYRSNWDLSAQR 244

Query: 134 ADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
           A  +   + +     +  + VRG A   P+ +N T  GR  N+R+EI I 
Sbjct: 245 AVSVALEMERVKGFESDRLRVRGMASTEPLVSNKTAEGRARNRRVEISIM 294


>gi|292492509|ref|YP_003527948.1| OmpA/MotB domain protein [Nitrosococcus halophilus Nc4]
 gi|291581104|gb|ADE15561.1| OmpA/MotB domain protein [Nitrosococcus halophilus Nc4]
          Length = 243

 Score =  110 bits (276), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 43/151 (28%), Positives = 71/151 (47%), Gaps = 6/151 (3%)

Query: 39  VNKRFGSSLDKA---EDEFQMQLQDTGIVVSRIGDM-ITCYIPVHV-SFVSEVFLEKKFL 93
                G   D+    E     + +   + + R+ D  +   IP  V        L++ FL
Sbjct: 75  TGSAVGYMNDQQREMEAALAEERRRHQLEIQRLQDESLKLDIPSEVSFDHDSASLKQAFL 134

Query: 94  PMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFIS 153
           P L  IA +L K+  TV+ +  HTDS G+ + NL +S  RA  + +  +++    +  +S
Sbjct: 135 PTLDKIADVLKKYNKTVVHVIGHTDSTGSEEYNLDLSVRRAANV-AVYLEQKGVPSPRLS 193

Query: 154 VRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           + G     P  +NDT  GRQ N+R+EI + P
Sbjct: 194 IYGEGESQPRASNDTAAGRQLNRRVEIILKP 224


>gi|17547099|ref|NP_520501.1| hypothetical protein RSc2380 [Ralstonia solanacearum GMI1000]
 gi|17429400|emb|CAD16087.1| probable bacterial outer membrane transmembrane protein [Ralstonia
           solanacearum GMI1000]
          Length = 209

 Score =  110 bits (276), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 48/207 (23%), Positives = 74/207 (35%), Gaps = 24/207 (11%)

Query: 1   MIKELGLSMFIMTTISGCGLASREKK---------------------KVFLHKSNDTDIV 39
           M  +L     +    +GC    + +                      K            
Sbjct: 1   MKAKLISVSLVALLAAGCATEQQNQTLAGTGVGAAVGAGIGALVGNSKGAAIGGALGAAG 60

Query: 40  NKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDM-ITCYIPVHV-SFVSEVFLEKKFLPMLQ 97
               G + +  + +       TG  +S   D  +   IP  V        ++  F   L 
Sbjct: 61  GAAVGYNWNAIKSKLTGDTAGTGTQISEQPDGSLKLNIPSQVSFDTDSAVIKPSFRGPLD 120

Query: 98  LIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGF 157
            +A  L++ P     +  HTDS G    N+ +SQ RA  + SYL  RGV+ NR  S  G 
Sbjct: 121 SVAETLSQHPELAANVVGHTDSTGNPNYNMSLSQRRAQSVASYLTDRGVARNRM-SAEGR 179

Query: 158 AYKYPIDTNDTKVGRQNNQRIEIQIFP 184
               P+  N T+ GR  N+R+EI + P
Sbjct: 180 GQTQPVGDNATEAGRAQNRRVEIYLKP 206


>gi|299066021|emb|CBJ37202.1| putative outer membrane lipoprotein [Ralstonia solanacearum CMR15]
          Length = 209

 Score =  110 bits (276), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 47/207 (22%), Positives = 73/207 (35%), Gaps = 24/207 (11%)

Query: 1   MIKELGLSMFIMTTISGCGLASREKK---------------------KVFLHKSNDTDIV 39
           M  +L     +    +GC    + +                      K            
Sbjct: 1   MKAKLISVSLVALLAAGCATQQQNQTLAGTGVGAAVGAGIGALVGNSKGAAIGGALGAAG 60

Query: 40  NKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDM-ITCYIPVHV-SFVSEVFLEKKFLPMLQ 97
               G +    + +       TG  +S   D  +   IP  V        ++  F   L 
Sbjct: 61  GAAVGYNWGAIKSKLTGDTAGTGTQISEQPDGSLKLNIPSQVSFDTDSAVIKPSFRGPLD 120

Query: 98  LIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGF 157
            +A  L++ P     +  HTDS G    N+ +SQ RA  + SYL  RGV+  R +S  G 
Sbjct: 121 SVAETLSQHPELAANVVGHTDSTGNPNYNMSLSQRRAQSVASYLTDRGVARTR-LSAEGR 179

Query: 158 AYKYPIDTNDTKVGRQNNQRIEIQIFP 184
               P+  N T+ GR  N+R+EI + P
Sbjct: 180 GQTQPVGDNATEAGRAQNRRVEIYLKP 206


>gi|332293158|ref|YP_004431767.1| OmpA/MotB domain protein [Krokinobacter diaphorus 4H-3-7-5]
 gi|332171244|gb|AEE20499.1| OmpA/MotB domain protein [Krokinobacter diaphorus 4H-3-7-5]
          Length = 236

 Score =  110 bits (276), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 44/226 (19%), Positives = 92/226 (40%), Gaps = 39/226 (17%)

Query: 1   MIKELGLSMFIMTTISG---CGLA--SREKKKVFLHKSNDTDIVNKRFG----------- 44
           +++ +         ++G   C     +  K+K  +  +    I+    G           
Sbjct: 4   IVRNITAVALGAAMLTGFTSCEATKNANNKQKGAVIGATGGAILGAIIGNNAGKGGNGEL 63

Query: 45  -----------------SSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVH---VSFVS 84
                            + +DK   + + +L   G  V RI D I      +       +
Sbjct: 64  GAVIGGVVGGGAGVLIGNKMDKQAQQIEQELP--GATVERIDDGIVVTFDENSGVYFDTA 121

Query: 85  EVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQR 144
           +  +      +L  ++ I+ ++  T + +  HTDS+G+  NN+ +SQ RA+ + +Y++  
Sbjct: 122 KYNVNTASQTLLNKLSNIMKEYNQTNVVVAGHTDSVGSDTNNMTLSQNRANAVTNYMVGT 181

Query: 145 GVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGNIKK 190
           G+S+ R  +   +    P  +NDT  GR  N+R+++ I P   +K+
Sbjct: 182 GLSAGR-FTTVWYGETQPAASNDTAEGRAQNRRVQLAIVPNEEMKQ 226


>gi|206889281|ref|YP_002248656.1| chemotaxis protein MotB [Thermodesulfovibrio yellowstonii DSM
           11347]
 gi|206741219|gb|ACI20276.1| chemotaxis protein MotB [Thermodesulfovibrio yellowstonii DSM
           11347]
          Length = 213

 Score =  110 bits (276), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 49/190 (25%), Positives = 88/190 (46%), Gaps = 14/190 (7%)

Query: 6   GLSMFIMTTISGCGLASREKKKVFLHKSNDTDI---VNKRFGSSLDKAED---EFQMQLQ 59
            L++     ++   L+S +  K     S+   +   +++      D+ +    + +  L 
Sbjct: 25  FLTLLFTFFVALYALSSVDVTKAEKMTSSLRKVFKVIDEPVSFEEDRNKAIIEDLRKLLN 84

Query: 60  D-TGIVVSRIGDMITCYIPVHVSFV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHT 117
           D +GI +      I   +P  + F      L+ +    L  IA  L + P   +AI+ HT
Sbjct: 85  DISGINIKSDARGIVITLPDSLLFSSGSAELKPESTDALTRIAEKLKELPG-KVAIEGHT 143

Query: 118 DSIGT----LKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQ 173
           D+I       K+N  +S  RA  +  +L+QRG+S +RF+ + G+    P+ TNDT  GR 
Sbjct: 144 DNIPISSSVYKSNWELSAARASSVLHFLLQRGLSPDRFL-IAGYGEYKPVATNDTDEGRA 202

Query: 174 NNQRIEIQIF 183
            N+R+E+ I 
Sbjct: 203 KNRRVELIIL 212


>gi|307728928|ref|YP_003906152.1| OmpA/MotB domain-containing protein [Burkholderia sp. CCGE1003]
 gi|307583463|gb|ADN56861.1| OmpA/MotB domain protein [Burkholderia sp. CCGE1003]
          Length = 217

 Score =  110 bits (276), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 40/205 (19%), Positives = 77/205 (37%), Gaps = 24/205 (11%)

Query: 1   MIKELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRF----------------- 43
           ++  L +     + ++GC         V       T                        
Sbjct: 5   LMTRLAVFAVAGSVLAGCASQQGTNTAVGTGVGAGTGAALGAIFGGGKGAAIGAGVGAAV 64

Query: 44  ----GSSLDKAEDEFQMQLQDTGIVVSRIGDM-ITCYIPVHVSFVSEVF-LEKKFLPMLQ 97
               G +     ++     + TG  ++   D  +   IP  V+F +  + ++  F P+L 
Sbjct: 65  GGITGYNWQAIHNKLSGATKGTGTQITEQPDGSLKLNIPSSVTFDTNSYAIKPSFAPVLD 124

Query: 98  LIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGF 157
            +   L + P  +  +  HTDS G    N  +S  RA  + S  +++   + + +S +G 
Sbjct: 125 QLTQTLQQNPEVIAQVVGHTDSTGQPAYNQTLSVNRAQSVVS-FLEQRGVAAQRLSAQGM 183

Query: 158 AYKYPIDTNDTKVGRQNNQRIEIQI 182
               PI  N+T+ GR  N+R+EI +
Sbjct: 184 GQNQPIADNNTEAGRAANRRVEIYL 208


>gi|292492806|ref|YP_003528245.1| OmpA/MotB domain protein [Nitrosococcus halophilus Nc4]
 gi|291581401|gb|ADE15858.1| OmpA/MotB domain protein [Nitrosococcus halophilus Nc4]
          Length = 286

 Score =  110 bits (276), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 40/162 (24%), Positives = 71/162 (43%), Gaps = 4/162 (2%)

Query: 23  REKKKVFLHKSNDTDIVNKRFGSSLDKAE-DEFQMQLQDTGIVVSRIGDMITCYIPVHVS 81
            ++++  L +  + +    R  + + +A   E + +L +  +   +        +   + 
Sbjct: 115 GQERQQMLMEVRELEARQAREQAKMAEARTRELEQRLAE--LDAEKTKRGYVLTLGDILF 172

Query: 82  FVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYL 141
            V    L    +  L  + T L ++P   + I+ HTDS G+   N  +SQ RAD +    
Sbjct: 173 EVDRAELTPGGMQNLFRLVTFLKEYPDREVVIEGHTDSTGSAVYNQELSQRRADSVYK-F 231

Query: 142 IQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
           +     S   I  RG+   YP+  NDT  GRQ N+R+EI I 
Sbjct: 232 LMNNGISPERIVARGYGEAYPVAPNDTAAGRQRNRRVEIVIL 273


>gi|74318359|ref|YP_316099.1| hypothetical protein Tbd_2341 [Thiobacillus denitrificans ATCC
           25259]
 gi|74057854|gb|AAZ98294.1| conserved hypothetical protein [Thiobacillus denitrificans ATCC
           25259]
          Length = 225

 Score =  110 bits (276), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 43/186 (23%), Positives = 83/186 (44%), Gaps = 12/186 (6%)

Query: 10  FIMTTISGCGLAS----REKKKVFLHKSNDTDIVNKRFGSSLDKA----EDEFQMQLQDT 61
            ++ T+SG  L +    + + K  L  +    +     G  +D+     + + + +++  
Sbjct: 37  AMIGTVSGAALGAIINHKNRGKGALIGAVGGGLTGAGVGYYMDQQAKDLQKQLRPEIEHG 96

Query: 62  GIVVSRI--GDMITCYIP-VHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTD 118
            I V +    + +   +            L+  +LP L  I+ +LN++  T + +  HTD
Sbjct: 97  DISVEKRASDNALLVSMTASTGFDNDSAALKAGYLPTLDKISRVLNQYGKTTVTVIGHTD 156

Query: 119 SIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRI 178
           S+GT + N  +S+ RA  +  Y   + V+  R  S  G     P   N T+ GR+ N+R+
Sbjct: 157 SVGTTQYNQALSERRAQSVLDYFASQKVNPLRLESY-GKGETEPRADNSTEDGRRLNRRV 215

Query: 179 EIQIFP 184
           E+ I P
Sbjct: 216 ELWILP 221


>gi|146296538|ref|YP_001180309.1| OmpA/MotB domain-containing protein [Caldicellulosiruptor
           saccharolyticus DSM 8903]
 gi|145410114|gb|ABP67118.1| OmpA/MotB domain protein [Caldicellulosiruptor saccharolyticus DSM
           8903]
          Length = 257

 Score =  110 bits (276), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 31/171 (18%), Positives = 58/171 (33%), Gaps = 7/171 (4%)

Query: 20  LASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEF---QMQLQDTGIVVSRIGDMITCYI 76
                K           +          D  +      +    +  ++V +    ++  +
Sbjct: 76  SGKNVKGTNTDIGGTTKNRQMTEEEIINDIQKQVLSLIKEHGIEGKVLVIQEERGLSILL 135

Query: 77  PVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNN----LLISQE 132
              +       L  +   ++  IA IL K P+  I I+ HTD++            +S  
Sbjct: 136 KDVLFNSGSAQLTPQAKEVVHEIAKILEKVPNNNIRIEGHTDNVPIHNKYFYSNWELSTA 195

Query: 133 RADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
           RA  +   +++         SV G+    PI +N T  GR  N+R+ I I 
Sbjct: 196 RATTVLQEILRVSKVKPERFSVVGYGEYRPIASNKTPQGRALNRRVTIVIL 246


>gi|325954634|ref|YP_004238294.1| OmpA/MotB domain protein [Weeksella virosa DSM 16922]
 gi|323437252|gb|ADX67716.1| OmpA/MotB domain protein [Weeksella virosa DSM 16922]
          Length = 234

 Score =  110 bits (276), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 44/221 (19%), Positives = 81/221 (36%), Gaps = 34/221 (15%)

Query: 2   IKELGLSMFI--MTTISGCGLASREKKK--VFLHKSNDTDIVNKR--------------- 42
           +K  GL++ +      S C                +    ++                  
Sbjct: 6   LKTTGLAILLGGSFIFSSCEAVQNTNNTQRGAAIGTVAGGVIGGILGNNVGKGGNTALGS 65

Query: 43  -------------FGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVF-L 88
                         G  +DK  ++ +  L    +V +  G  +       V+F      L
Sbjct: 66  VIGAAVGGGAGILIGQHMDKQAEKIEQVLPGAEVVRTDEGINLILNENSSVTFDYNSENL 125

Query: 89  EKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSS 148
             K    L  +  +  ++P T + I  HTD++G+   NL +S++RA  + +YL+ +   S
Sbjct: 126 TSKAKNSLDKLIQVFKEYPDTNLLIVGHTDNVGSQNFNLPLSEKRAKSVVNYLVSK-GIS 184

Query: 149 NRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGNIK 189
           +  ++ +G     PI  N T  GR  N+R+EI I     +K
Sbjct: 185 SSRLTSKGVGLSEPIADNSTAAGRAQNRRVEIAITANEKMK 225


>gi|183221220|ref|YP_001839216.1| hypothetical protein LEPBI_I1834 [Leptospira biflexa serovar Patoc
           strain 'Patoc 1 (Paris)']
 gi|189911311|ref|YP_001962866.1| endoflagellar motor protein [Leptospira biflexa serovar Patoc
           strain 'Patoc 1 (Ames)']
 gi|167775987|gb|ABZ94288.1| Endoflagellar motor protein [Leptospira biflexa serovar Patoc
           strain 'Patoc 1 (Ames)']
 gi|167779642|gb|ABZ97940.1| Putative outer membrane protein [Leptospira biflexa serovar Patoc
           strain 'Patoc 1 (Paris)']
          Length = 354

 Score =  110 bits (275), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 36/150 (24%), Positives = 68/150 (45%), Gaps = 4/150 (2%)

Query: 41  KRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHV-SFVSEVFLEKKFLPMLQLI 99
           +R      + E++   ++    I + R  + +   I   +        L+   LP ++ I
Sbjct: 196 ERLSEQTKEFEEKLAKEITSGQIRLKRFHNKLIINIDDKISFDSGSSELKPAILPAIEKI 255

Query: 100 ATILNKFPSTVIAIQSHTDSIGT---LKNNLLISQERADVIKSYLIQRGVSSNRFISVRG 156
             IL  +P   I ++ HTD++      +NN  +S ERA  +  +++Q    + +  S  G
Sbjct: 256 RDILASYPENYIVVEGHTDNVPIKTKFRNNWHLSSERALSVLEFILQNKNLNPKNFSSAG 315

Query: 157 FAYKYPIDTNDTKVGRQNNQRIEIQIFPRG 186
           +    PI  N TK  +  N+R++I + PRG
Sbjct: 316 YGEHQPIVPNSTKENKALNRRVDIVVIPRG 345


>gi|256840118|ref|ZP_05545627.1| outer membrane protein [Parabacteroides sp. D13]
 gi|256739048|gb|EEU52373.1| outer membrane protein [Parabacteroides sp. D13]
          Length = 226

 Score =  110 bits (275), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 44/163 (26%), Positives = 71/163 (43%), Gaps = 3/163 (1%)

Query: 28  VFLHKSNDTDIVNKRFGSSLDKAEDEFQMQL-QDTGIVVSRIGDMITCYIPVHVSF-VSE 85
             +  +          G  +DK + E +  L +DT I     G+ +       + F  + 
Sbjct: 55  GAVIGAAVGGTAGALIGKKMDKQKKELEATLPEDTKIESVNNGEALKVTFDSGILFATNS 114

Query: 86  VFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRG 145
             L       L+  AT L   P T I I   TD+ G +  N  +S++RA  +  YL+ +G
Sbjct: 115 STLSDASKSALRNFATSLKANPDTDIRIIGFTDNTGKVDYNQTLSEKRAKSVYDYLMMQG 174

Query: 146 VSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGNI 188
           VS++R +   G     P+ +NDT  GR  N+R+EI I     +
Sbjct: 175 VSTDRMVY-EGKGIHDPVASNDTPEGRSLNRRVEIVILANQKM 216


>gi|77164341|ref|YP_342866.1| OmpA/MotB [Nitrosococcus oceani ATCC 19707]
 gi|254434085|ref|ZP_05047593.1| Rickettsia 17 kDa surface antigen family [Nitrosococcus oceani
           AFC27]
 gi|76882655|gb|ABA57336.1| OmpA/MotB [Nitrosococcus oceani ATCC 19707]
 gi|207090418|gb|EDZ67689.1| Rickettsia 17 kDa surface antigen family [Nitrosococcus oceani
           AFC27]
          Length = 248

 Score =  110 bits (275), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 50/217 (23%), Positives = 80/217 (36%), Gaps = 36/217 (16%)

Query: 3   KELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDI------------------------ 38
           K L L++ I   + GC    R  +                                    
Sbjct: 8   KPLWLALAISMGMIGCAADGRYSQTQKGSAVGTVGGAAAGAAIGAAIDGGSGAGWGALAG 67

Query: 39  ------VNKRFGSSLDKA---EDEFQMQLQDTGIVVSRIGDM-ITCYIPVHV-SFVSEVF 87
                      G   D+    E     + +   + + R+ D  +   IP  +        
Sbjct: 68  AVAGGLTGSAVGYMNDQQREMEAALAEERRGHQLEIQRLQDESLKLDIPSEISFDHDSDV 127

Query: 88  LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVS 147
           L+  FLP L  IA +L K+  TV+ +  HTDS G+ K NL +S  RA  + +   +R   
Sbjct: 128 LKPAFLPTLDKIAEVLKKYNKTVVHVIGHTDSTGSEKYNLDLSLRRAGNV-AVYFERKGV 186

Query: 148 SNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
            ++ +S+ G     P  +N T  GRQ N+R+EI + P
Sbjct: 187 PSQRLSIYGRGESEPRASNATAAGRQLNRRVEIILKP 223


>gi|300313671|ref|YP_003777763.1| OmpA family protein [Herbaspirillum seropedicae SmR1]
 gi|300076456|gb|ADJ65855.1| OmpA family protein [Herbaspirillum seropedicae SmR1]
          Length = 241

 Score =  110 bits (275), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 37/213 (17%), Positives = 78/213 (36%), Gaps = 33/213 (15%)

Query: 2   IKELGLSMFI-MTTISGCGLASREKKKVFLHKSNDTDIVNKR------------------ 42
           +K+L ++    +  +SGC   S  ++           +                      
Sbjct: 1   MKKLSIAAIAGVLALSGCADMSPTQRGTATGAGIGAGLGGIIGAATGGGGGGRALGGAAI 60

Query: 43  -----------FGSSLDKAEDEFQMQLQDTGIVVSRI-GDMITCYIPVHV-SFVSEVFLE 89
                      + + ++  +   +   Q TG+ VS+   + +   IP  +        ++
Sbjct: 61  GGAIGAVAGNIWSNRMENQKRAMEEATQGTGVQVSQTADNRLKLEIPSDISFDTGRADIK 120

Query: 90  KKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSN 149
            +  P+L   A  L + P+T + I  HTD+ G+   N  +S +RA   +   +     + 
Sbjct: 121 PEMRPVLDRFAATLVENPATTVTIVGHTDNTGSDAINDPLSLQRASRTRD-YLSSRGVAA 179

Query: 150 RFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
              S++G     P+  N +   R  N+R+EI +
Sbjct: 180 NRFSIQGRGSHEPLVANTSDANRARNRRVEIFV 212


>gi|149925845|ref|ZP_01914109.1| outer membrane protein, OmpA/MotB family [Limnobacter sp. MED105]
 gi|149825962|gb|EDM85170.1| outer membrane protein, OmpA/MotB family [Limnobacter sp. MED105]
          Length = 222

 Score =  110 bits (275), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 41/181 (22%), Positives = 81/181 (44%), Gaps = 12/181 (6%)

Query: 13  TTISGCGLAS--REKKKVFLHKSNDTDIVNKRFGSSLDKAE-------DEFQMQLQDTGI 63
             ++GC +A   +         +    I     G+S+D  +             L  + I
Sbjct: 41  VAVAGCPMAPERKVDNTKTAIGTAVGAIGGAIVGNSIDGKDTVRGAALGGLFGYLVGSQI 100

Query: 64  VV-SRIGDMITCYIPVH-VSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIG 121
            V  +    +   IP   +   ++  ++ +F   L  IA  L   P+T++ +  +TDS G
Sbjct: 101 AVREQRDGSVMLDIPGAALFDTNKSDVKAQFAGTLDQIAATLRDNPNTIVCVIGYTDSTG 160

Query: 122 TLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQ 181
           + + N  +S  RA  + ++L  +G+S  R ++  G    +P+ +NDT+ GR  N+R+E+ 
Sbjct: 161 SDQYNQDLSVRRAQSVTNFLTAKGISGAR-LTAAGLGEGFPVASNDTESGRAQNRRVEMY 219

Query: 182 I 182
           +
Sbjct: 220 V 220


>gi|329117988|ref|ZP_08246701.1| OmpA family protein [Neisseria bacilliformis ATCC BAA-1200]
 gi|327465876|gb|EGF12148.1| OmpA family protein [Neisseria bacilliformis ATCC BAA-1200]
          Length = 226

 Score =  110 bits (275), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 54/210 (25%), Positives = 86/210 (40%), Gaps = 28/210 (13%)

Query: 5   LGLSMFIMTTISGCGLASREKKKVFLHK--SNDTDIVNKRFGS----------------- 45
              ++     +SGC   +   +K             V    G+                 
Sbjct: 8   TAAAVACTLALSGCITYADGTQKASKTAMYGLGGAAVCGIIGALSHGSKGARNSALACGA 67

Query: 46  -------SLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQ 97
                   +D  E + +  L +TG+ V R GD I   +P +V+F      L       L 
Sbjct: 68  VGAGVGGYMDYQEKKLRENLANTGVDVQRSGDQIKLVMPENVTFATGSATLSTNAQNALA 127

Query: 98  LIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGF 157
             A  L ++P T ++I  HTD+ G+   N  +SQ RA  + S+L  RGV+ +R ++  G 
Sbjct: 128 AAAQTLTQYPDTTLSINGHTDNTGSDAINAPLSQRRAQAVASFLQSRGVNGSR-LATYGH 186

Query: 158 AYKYPIDTNDTKVGRQNNQRIEIQIFPRGN 187
             + P+ +N T  GR  N+R+EI I P  N
Sbjct: 187 GSRQPVASNATAEGRAQNRRVEILINPDQN 216


>gi|237654130|ref|YP_002890444.1| OmpA/MotB domain protein [Thauera sp. MZ1T]
 gi|237625377|gb|ACR02067.1| OmpA/MotB domain protein [Thauera sp. MZ1T]
          Length = 222

 Score =  110 bits (275), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 46/217 (21%), Positives = 83/217 (38%), Gaps = 37/217 (17%)

Query: 2   IKELGLSMFIMTT----ISGCGLASREKKKVFLHKSN--------DTDIVNKRFG----- 44
           +K++ +++  +      +SGC   +  ++   +  +                  G     
Sbjct: 1   MKKIIVTLSAVALAVSGLSGCANMNETQRDTGMGAAIGAVAGGLIGAATAGGNKGKSAAT 60

Query: 45  -----------------SSLDKAEDEFQMQLQDTGIVVSRI-GDMITCYIPVHV-SFVSE 85
                             ++ K   E +     TGI +S+   + +   IP  V   V  
Sbjct: 61  GAAIGAALGAGGGYLWSQNMQKQRAEMEQATAGTGIGISQTTDNQLKVDIPADVSFDVGR 120

Query: 86  VFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRG 145
             ++    P+L  +A+ LN+ P T + I  HTDS G+   N  +S  RA       + + 
Sbjct: 121 HAIKPNMRPVLDRLASTLNQHPVTTVTIIGHTDSTGSDAVNDPLSINRAA-ATRDYLVQR 179

Query: 146 VSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
             S + I+V G   + P+  N T  GR  N+R+EI I
Sbjct: 180 GVSAQRIAVDGRGSRQPVADNSTASGRAMNRRVEIFI 216


>gi|254302748|ref|ZP_04970106.1| outer membrane protein OmpF [Fusobacterium nucleatum subsp.
           polymorphum ATCC 10953]
 gi|148322940|gb|EDK88190.1| outer membrane protein OmpF [Fusobacterium nucleatum subsp.
           polymorphum ATCC 10953]
          Length = 182

 Score =  110 bits (275), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 48/170 (28%), Positives = 75/170 (44%), Gaps = 6/170 (3%)

Query: 18  CGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIP 77
           C      KK      S +   V     +   K   E  +   + G+ + R G+ +   +P
Sbjct: 18  CSSTKTTKKTNVGVDSTNKYAVEDTEAN---KKPLEDIIVFNEEGVTIRREGNNLILSMP 74

Query: 78  VHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADV 136
             + F   +  ++    P L  +A  L +     I I  +TD IGT   NL +S +RA  
Sbjct: 75  ELILFDFDKYAVKDGIKPSLSTLAKALGENKDIHIKIDGYTDFIGTEAYNLDLSVKRARA 134

Query: 137 IKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRG 186
           IK +LI +G   +  IS+ G+  + P  TN T+ GR  N+R+E  I  RG
Sbjct: 135 IKDFLISKGAIGSN-ISIEGYGEQNPAATNQTEAGRSKNRRVEF-IISRG 182


>gi|311106780|ref|YP_003979633.1| OmpA family protein 1 [Achromobacter xylosoxidans A8]
 gi|310761469|gb|ADP16918.1| OmpA family protein 1 [Achromobacter xylosoxidans A8]
          Length = 183

 Score =  110 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 40/195 (20%), Positives = 73/195 (37%), Gaps = 24/195 (12%)

Query: 2   IK--ELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQ 59
           +K  +L +   +M  +SGC       K+  +                      +   +L 
Sbjct: 1   MKPGKLAVMACLMLAVSGCVTKKTYDKEAQMAAEYAA-------------LNQKLTAELS 47

Query: 60  DTGIVVSRIGDMITCYIPVHVSFV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTD 118
                ++++ + +   +   + F      L  K    L  IA  L+  P   + +Q +TD
Sbjct: 48  GDRAQITQLQNELKVTMVNEILFPEGGWRLSPKGEQTLAKIAPTLSNLPGQQVVVQGYTD 107

Query: 119 SIG-------TLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVG 171
           +            +NL +S  RAD +  +L  +       IS +GF    P+ +N T  G
Sbjct: 108 NEPIGPELRSQFPSNLELSSARADNVARFLTSK-GVPPNSISAQGFGEARPVASNSTPQG 166

Query: 172 RQNNQRIEIQIFPRG 186
           +  N+R+EI I   G
Sbjct: 167 KAQNRRVEIVITSAG 181


>gi|258621630|ref|ZP_05716662.1| flagellar motor protein [Vibrio mimicus VM573]
 gi|262165143|ref|ZP_06032880.1| Flagellar motor rotation protein MotB [Vibrio mimicus VM223]
 gi|258586102|gb|EEW10819.1| flagellar motor protein [Vibrio mimicus VM573]
 gi|262024859|gb|EEY43527.1| Flagellar motor rotation protein MotB [Vibrio mimicus VM223]
          Length = 319

 Score =  110 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 37/173 (21%), Positives = 73/173 (42%), Gaps = 6/173 (3%)

Query: 16  SGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCY 75
           S        +      +      ++++  +  +  +     +++   I V  +G  I   
Sbjct: 129 SAESSTQDNQNTQSEMQQQQAKAMSEQMETVAESIKKALSREIEQGAIEVENLGQQIDIR 188

Query: 76  IPVHVSFV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSI----GTLKNNLLIS 130
           I    +F     FL+ KF P+++ IA ++   P   + +  HTD+        ++N  +S
Sbjct: 189 IREKGAFPEGSAFLQPKFRPLVRQIADLVKDIPG-KVRVTGHTDNQKLDSELYRSNWDLS 247

Query: 131 QERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
            +RA  +   + +     ++ + VRG A   PI  NDT+  R  N+R+EI I 
Sbjct: 248 AQRAVSVAQEMEKVKGFDHQRLQVRGMADTQPIGPNDTEAQRALNRRVEISIL 300


>gi|76809785|ref|YP_332623.1| ompA family protein [Burkholderia pseudomallei 1710b]
 gi|76579238|gb|ABA48713.1| ompA family protein [Burkholderia pseudomallei 1710b]
          Length = 316

 Score =  110 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 41/202 (20%), Positives = 73/202 (36%), Gaps = 24/202 (11%)

Query: 4   ELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSL---------------- 47
            L +       ++GC         V                                   
Sbjct: 109 RLSVFALAGALLAGCATQQGTNTAVGTGTGAALGAGIGALAGGGKGAAIGAGVGALVGGV 168

Query: 48  -----DKAEDEFQMQLQDTGIVVSRIGDM-ITCYIPVHVSF-VSEVFLEKKFLPMLQLIA 100
                   +++     Q TG  V+   D  +   +P  V+F   +  +   F P+L  +A
Sbjct: 169 TGYNWQAIKNKLAPSAQQTGTQVTEQPDGSLKLNVPSSVTFATDQYAITPAFTPLLNDLA 228

Query: 101 TILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYK 160
           T LN+ P    ++  +TDS G+  +N  +SQ RA  + +  + +   +   +S +G    
Sbjct: 229 TTLNQNPQITASVVGYTDSTGSAAHNQTLSQNRAQSVVN-ALAQRGVAANRLSAQGMGAS 287

Query: 161 YPIDTNDTKVGRQNNQRIEIQI 182
            PI  N T+ GR  N+R+EI +
Sbjct: 288 NPIADNATEAGRAQNRRVEIYL 309


>gi|255013439|ref|ZP_05285565.1| OmpA family outer membrane protein [Bacteroides sp. 2_1_7]
          Length = 213

 Score =  110 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 44/163 (26%), Positives = 71/163 (43%), Gaps = 3/163 (1%)

Query: 28  VFLHKSNDTDIVNKRFGSSLDKAEDEFQMQL-QDTGIVVSRIGDMITCYIPVHVSF-VSE 85
             +  +          G  +DK + E +  L +DT I     G+ +       + F  + 
Sbjct: 42  GAVIGAAVGGTAGALIGKKMDKQKKELEATLPEDTKIESVNNGEALKVTFDSGILFATNS 101

Query: 86  VFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRG 145
             L       L+  AT L   P T I I   TD+ G +  N  +S++RA  +  YL+ +G
Sbjct: 102 STLSDASKSALRNFATSLKANPDTDIRIIGFTDNTGKVDYNQTLSEKRAKSVYDYLMMQG 161

Query: 146 VSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGNI 188
           VS++R +   G     P+ +NDT  GR  N+R+EI I     +
Sbjct: 162 VSTDRMVY-EGKGIHDPVASNDTPEGRSLNRRVEIVILANQKM 203


>gi|194290514|ref|YP_002006421.1| outer membrane lipoprotein [Cupriavidus taiwanensis LMG 19424]
 gi|193224349|emb|CAQ70360.1| putative outer membrane lipoprotein [Cupriavidus taiwanensis LMG
           19424]
          Length = 212

 Score =  110 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 38/195 (19%), Positives = 68/195 (34%), Gaps = 31/195 (15%)

Query: 17  GCGLASREKKKVFLHKSNDTDIVNKRFGSSL-------------------------DKAE 51
           GC     E++      +     V    G+ +                         +   
Sbjct: 19  GCAT---EQQTHTAVGTGVGAAVGAGLGNLIGGNTTGTLVGAAVGGAIGGATGYNWNAIR 75

Query: 52  DEFQMQLQDTGIVVSRIGDM-ITCYIPVHVSFV-SEVFLEKKFLPMLQLIATILNKFPST 109
            +       TG  ++   D  +   IP  V+F      ++  F  +L  +A  L++    
Sbjct: 76  GKLNKDTAGTGTQITEQPDGSLKVNIPSQVTFDTDSATIKPSFRSVLDQVAQTLSQHQDV 135

Query: 110 VIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTK 169
              +  HTDS G    N+ +SQ RA  + +  +     +   +S  G     P+  N T+
Sbjct: 136 SANVVGHTDSTGNPNYNMQLSQRRAQSV-AGYLGDRGVARNRLSAEGRGQSQPVADNGTE 194

Query: 170 VGRQNNQRIEIQIFP 184
            GR  N+R+EI + P
Sbjct: 195 AGRAQNRRVEIFLKP 209


>gi|150025563|ref|YP_001296389.1| lipoprotein YiaD precursor [Flavobacterium psychrophilum JIP02/86]
 gi|149772104|emb|CAL43580.1| Probable lipoprotein YiaD precursor [Flavobacterium psychrophilum
           JIP02/86]
          Length = 231

 Score =  110 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 38/222 (17%), Positives = 71/222 (31%), Gaps = 35/222 (15%)

Query: 1   MIKELG----LSMFIMTTISGCGL--ASREKKKVFLHKSNDTDIVNKR------------ 42
           M K +     LS  + T +S C     S   ++     +    ++               
Sbjct: 1   MKKSIIYMLSLSFLLGTVLSSCDAIKNSNNTQRGATGGAVLGAVLGGVLGNNIGHGGNGA 60

Query: 43  ----------------FGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEV 86
                            G+ +DK   +    L    +     G  +           ++ 
Sbjct: 61  LGAVLGGVIGGVAGGVIGNKMDKQARKISESLPGAKVERVGEGIRLVLGENAIRFDTNKS 120

Query: 87  FLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGV 146
            L       L  +  +  ++P T I I  +TDS G    NL +S++RA  +    +    
Sbjct: 121 TLTASAKANLDKLVKVFTEYPDTDIQIYGYTDSSGADDYNLKLSEQRAASV-KTYLSAKG 179

Query: 147 SSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGNI 188
            ++   +  G     PI  N+T  G+  N+R+E  I     +
Sbjct: 180 LASTRFNTSGLGEADPIAPNETADGKSQNRRVEFAITANDKM 221


>gi|94311700|ref|YP_584910.1| OmpA/MotB [Cupriavidus metallidurans CH34]
 gi|93355552|gb|ABF09641.1| outer membrane protein, OmpA/MotB family(modular protein)
           [Cupriavidus metallidurans CH34]
          Length = 294

 Score =  110 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 37/175 (21%), Positives = 66/175 (37%), Gaps = 3/175 (1%)

Query: 12  MTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDM 71
               +G G          L  +     +    G + +    +       TG  ++   D 
Sbjct: 118 AAVGAGIGNLIGGNTTGTLVGAAVGGALGGATGYNWNAIRGKLNKDTAGTGTQITEQPDG 177

Query: 72  -ITCYIPVHVSFV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLI 129
            +   IP  V+F      ++  F  +L  +A  L +       +  HTDS G  + N+ +
Sbjct: 178 SLKVNIPSQVTFDTDSSTIKPSFRNVLDQVAQTLAQHQDVSANVVGHTDSTGNPQYNMQL 237

Query: 130 SQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           SQ RA  + +  +     +   +S  G     P+  N T+ GR  N+R+EI + P
Sbjct: 238 SQRRAQSV-AGYLGDRGVARTRLSAEGRGQTQPVADNSTEAGRAQNRRVEIFLKP 291


>gi|146298022|ref|YP_001192613.1| OmpA/MotB domain-containing protein [Flavobacterium johnsoniae
           UW101]
 gi|146152440|gb|ABQ03294.1| OmpA/MotB domain protein [Flavobacterium johnsoniae UW101]
          Length = 231

 Score =  110 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 36/146 (24%), Positives = 60/146 (41%), Gaps = 1/146 (0%)

Query: 43  FGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATI 102
            G+ +DK   E    L    +     G  +T          ++  L       L  +  +
Sbjct: 77  IGNKMDKQAREIDQALPGASVERVGEGIHLTLNENSVRFDTNKSTLTPTAKANLDKLVPV 136

Query: 103 LNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYP 162
            N++  T I I  +TD+ G  + NL +S +RA  +++YL+ +    +      G     P
Sbjct: 137 FNEYGDTDIQIFGYTDNTGKPEYNLTLSGQRAASVQAYLVSK-GLKSSRFKTSGLGIADP 195

Query: 163 IDTNDTKVGRQNNQRIEIQIFPRGNI 188
           I TNDT  GR  N+R+E  I     +
Sbjct: 196 IATNDTPEGRAQNRRVEFSITANDKM 221


>gi|186476941|ref|YP_001858411.1| OmpA/MotB domain-containing protein [Burkholderia phymatum STM815]
 gi|184193400|gb|ACC71365.1| OmpA/MotB domain protein [Burkholderia phymatum STM815]
          Length = 217

 Score =  110 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 42/205 (20%), Positives = 75/205 (36%), Gaps = 24/205 (11%)

Query: 1   MIKELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRF----------------- 43
           ++  +     +   ++GC         V       T                        
Sbjct: 6   IMTRVSALAVVGALLAGCATEQGTNTAVGTGVGAGTGAALGAIFGGGKGAAIGAGVGAAV 65

Query: 44  ----GSSLDKAEDEFQMQLQDTGIVVSRIGDM-ITCYIPVHVSFVSEVF-LEKKFLPMLQ 97
               G +    +++     + TG  ++   D  +   IP  V+F +  + ++  F P+L 
Sbjct: 66  GGVTGYNWQNIKNKLGGATKGTGTQITEQPDGSLKLNIPSSVTFDTNSYAIKPSFAPVLS 125

Query: 98  LIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGF 157
            +A  LN+ P  V  +  HTDS G    N  +S  RA  +   L      + + +S  G 
Sbjct: 126 QVAQTLNQNPEVVAQVVGHTDSTGQPAYNQTLSVNRAQSVAQQLAT-DGVAPQRLSATGM 184

Query: 158 AYKYPIDTNDTKVGRQNNQRIEIQI 182
               PI  N+T+ GR  N+R+EI +
Sbjct: 185 GANQPIADNNTETGRAQNRRVEIYL 209


>gi|34497346|ref|NP_901561.1| outer membrane protein [Chromobacterium violaceum ATCC 12472]
 gi|34103202|gb|AAQ59565.1| probable outer membrane protein [Chromobacterium violaceum ATCC
           12472]
          Length = 223

 Score =  110 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 55/224 (24%), Positives = 87/224 (38%), Gaps = 36/224 (16%)

Query: 1   MIKELGLSMFIMTT---ISGCGLASREKK------------------------------K 27
           M+K   +SM +  +   +SGC   S  +K                               
Sbjct: 1   MMKNAMVSMLVAVSVAGLSGCANMSDTQKGVGGGAAIGAGVGAAIGALTAGGHGGRSAAT 60

Query: 28  VFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRI-GDMITCYIPVHVSFVSEV 86
                          +   + K ++  +   + TGI VS+   + +   IP   SF +  
Sbjct: 61  GAAIGGLLGAGGGYLWSQHMQKQKEAMEQATKGTGIGVSQTADNRLKINIPSDASFDTNS 120

Query: 87  F-LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRG 145
           + L+    P+L  +AT L + P T + I  HTD+ G+   N  +S  RA   + YL  RG
Sbjct: 121 YALKPSLKPVLDKLATTLQQNPVTSVNIIGHTDNTGSDAINNPLSVNRAKATQGYLASRG 180

Query: 146 VSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGNIK 189
           V  NR I + G   + P+  N T  GR  N+R+EI +      K
Sbjct: 181 VDINR-IGIDGRGSREPVADNGTVSGRAMNRRVEIYVAEPAQAK 223


>gi|85711188|ref|ZP_01042248.1| flagellar motor protein [Idiomarina baltica OS145]
 gi|85695101|gb|EAQ33039.1| flagellar motor protein [Idiomarina baltica OS145]
          Length = 309

 Score =  110 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 38/179 (21%), Positives = 75/179 (41%), Gaps = 7/179 (3%)

Query: 17  GCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYI 76
           G   A  E+ K  +  S     V ++    +++  ++    ++   + + ++G  I   I
Sbjct: 125 GGQQADSEEDKKAVDGSESDPAVEQQVKELMERIREQLSDNIKAGSLELEQLGQQIIIRI 184

Query: 77  PVHVSFV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIG----TLKNNLLISQ 131
             + SF     FL+ +F P+++ +A  L   P   I I  HTD+         +   +S 
Sbjct: 185 KENGSFPEGSAFLQPQFKPVIREVAQALKDIPG-EITISGHTDNQPLVSEMYTSKWDLSA 243

Query: 132 ERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGNIKK 190
           +RA  +   +          +   G+A   PI  N++   R  N+R++I I  +G  K+
Sbjct: 244 KRAVAVAEEMTSVDGFDQSRLVTMGYADTKPIVPNNSTSNRALNRRVDIAIM-QGKAKE 301


>gi|224823894|ref|ZP_03697003.1| OmpA/MotB domain protein [Lutiella nitroferrum 2002]
 gi|224604349|gb|EEG10523.1| OmpA/MotB domain protein [Lutiella nitroferrum 2002]
          Length = 221

 Score =  110 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 54/217 (24%), Positives = 90/217 (41%), Gaps = 37/217 (17%)

Query: 2   IKELGLSM----FIMTTISGCGLASREKKKVFLHKSNDTD--------IVNKRFGSS--- 46
           +K++ +++    F ++ +SGC   +  ++      +                  G S   
Sbjct: 1   MKKIIVTLTAVAFGVSALSGCANMNETQRDTGTGAAIGAAAGAVIGGLTAGGHTGRSAAT 60

Query: 47  -------------------LDKAEDEFQMQLQDTGIVVSRIGDM-ITCYIPVHV-SFVSE 85
                              + + +   +   + TG+ VS+  D  +   IP  V      
Sbjct: 61  GAAVGAALGAGGGYLWSKHMQEQKAAMEQATKGTGVSVSQTADNQLKLDIPSDVSFDSGR 120

Query: 86  VFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRG 145
             ++    P+L   AT LN+ P T + I  HTDS G+   N  +S  RA   +SYL+ RG
Sbjct: 121 YDIKSNMRPILDRFATTLNQNPVTTVKIIGHTDSTGSDAINGPLSVNRASATRSYLVARG 180

Query: 146 VSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           V+ NR IS+ G     PI +N T  GR  N+R+EI +
Sbjct: 181 VAMNR-ISIDGRGSSEPIASNGTAAGRAKNRRVEIFV 216


>gi|14331084|emb|CAC40971.1| hypothetical protein [Vibrio pommerensis]
          Length = 378

 Score =  110 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 38/154 (24%), Positives = 67/154 (43%)

Query: 28  VFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVF 87
                 ++   V       + + E   +   +    V+     +++      +       
Sbjct: 210 AAQTAMSEPMDVRPVDEVVMSEPEPVMETVAEPEPQVIETYTQVVSSAFGEALFETGSTS 269

Query: 88  LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVS 147
           L    +  LQ +   L ++P TV+ I  HTDS G+   N  +S++RA  + +YLI +GV 
Sbjct: 270 LSPSLMLQLQPLLARLKQYPETVVEISGHTDSKGSDTLNQRLSEQRAQSVANYLISKGVD 329

Query: 148 SNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQ 181
             R   V G+    P+ +NDT+ GR  N+R+EI 
Sbjct: 330 PERITRVVGYGESLPVASNDTESGRAQNRRVEIV 363


>gi|332667579|ref|YP_004450367.1| OmpA/MotB domain-containing protein [Haliscomenobacter hydrossis
           DSM 1100]
 gi|332336393|gb|AEE53494.1| OmpA/MotB domain protein [Haliscomenobacter hydrossis DSM 1100]
          Length = 239

 Score =  110 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 46/232 (19%), Positives = 79/232 (34%), Gaps = 45/232 (19%)

Query: 1   MIKELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDI---------------------- 38
           M K L   +       GC  A + +                                   
Sbjct: 1   MKKILFFLLISGMLFVGCKSAQKTQTSTGQRSDKPKSAKDKTTKGAVIGAAGGAVIGGII 60

Query: 39  --------------------VNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPV 78
                               V    GS +DK   + +  L +T   V R+G+ I      
Sbjct: 61  GNKGNNTVIGAIIGAAAGGAVGAVIGSKMDKQAKKMEEDLGNT-ATVERVGEGIKVTFNS 119

Query: 79  HVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVI 137
            + F   +  L +     L+  A  L + P T + I  HTD++G+   N  +S+ RA  +
Sbjct: 120 QLLFDFGKSSLMESNKQTLESFAETLKQNPDTDLLIVGHTDNVGSDAFNQSLSENRAAAV 179

Query: 138 KSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGNIK 189
            ++ +     S+  + ++G   K P+  N T+  R  N+R+EI I     +K
Sbjct: 180 SNH-LSTFGVSSSRLKIQGMGEKQPLVANTTESERAQNRRVEIAIIANEAMK 230


>gi|227540121|ref|ZP_03970170.1| OmpA/MotB:Rickettsia surface antigen [Sphingobacterium spiritivorum
           ATCC 33300]
 gi|300771844|ref|ZP_07081715.1| OmpA family protein [Sphingobacterium spiritivorum ATCC 33861]
 gi|227239982|gb|EEI89997.1| OmpA/MotB:Rickettsia surface antigen [Sphingobacterium spiritivorum
           ATCC 33300]
 gi|300761230|gb|EFK58055.1| OmpA family protein [Sphingobacterium spiritivorum ATCC 33861]
          Length = 173

 Score =  110 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 46/188 (24%), Positives = 78/188 (41%), Gaps = 20/188 (10%)

Query: 2   IKEL---GLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQL 58
           +K+L    L +F   T+  C       K+  L  +    +        L   ++EF+   
Sbjct: 1   MKQLNIFTLILFCAVTLFSC-------KQQALTVNPGAVLSKDGTDDGLKNVKEEFKDA- 52

Query: 59  QDTGIVVSRIGDMITCYIPVHVSFVS-EVFLEKKFLPMLQLIATILNKFPSTVIAIQSHT 117
                  SR  + I   +     F +   +L  K    L  +A +L     T I +  HT
Sbjct: 53  -------SRTEEGIKFSLSSDFLFPTNSSYLTDKSKGELSKLAKLLKDNSKTKIRVDGHT 105

Query: 118 DSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQR 177
           D+ GT + NL +S +RA  +K +L+     S   I+ +G     P+  N T  GRQ N+R
Sbjct: 106 DATGTPEYNLWLSDKRAVSVKKFLVD-SGISESRITTKGIGQAKPVADNKTPEGRQMNRR 164

Query: 178 IEIQIFPR 185
           +E+ +  +
Sbjct: 165 VEVVLLNQ 172


>gi|146306467|ref|YP_001186932.1| OmpA/MotB domain-containing protein [Pseudomonas mendocina ymp]
 gi|145574668|gb|ABP84200.1| OmpA/MotB domain protein [Pseudomonas mendocina ymp]
          Length = 217

 Score =  109 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 42/191 (21%), Positives = 72/191 (37%), Gaps = 8/191 (4%)

Query: 1   MIKELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQD 60
           M      +      I+GC     EKK+V          V + +   LD+ E + +  ++ 
Sbjct: 1   MRANTIFAFTCCLLIAGCA--GSEKKEVAKAAVMPPPQVTRAW---LDEYEPKLREAVKG 55

Query: 61  TGIVVSRIGDMITCYIPVHVSFVSE--VFLEKKFLPMLQLIATILNKFPSTVIAIQSHTD 118
           +     R  +++    PV  SF  +    L    L  +  +A +L       + +  H D
Sbjct: 56  SHFEFERRENLLVVTAPVQGSFNPDRPHMLLPVSLGPITRVAKLLESDEDMAVVVLGHAD 115

Query: 119 SIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRI 178
           S G    N  +S +RA  + S            + V G     P   ND+  GR  N+R+
Sbjct: 116 SSGDATRNRELSDQRARAVTSIFRL-SGLKQNRLQVMGLGSDMPRAANDSAAGRALNRRV 174

Query: 179 EIQIFPRGNIK 189
           EI +  R  ++
Sbjct: 175 EILLTSRDTMQ 185


>gi|258624381|ref|ZP_05719329.1| flagellar motor protein [Vibrio mimicus VM603]
 gi|258583343|gb|EEW08144.1| flagellar motor protein [Vibrio mimicus VM603]
          Length = 319

 Score =  109 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 36/173 (20%), Positives = 73/173 (42%), Gaps = 6/173 (3%)

Query: 16  SGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCY 75
           S        +      +      ++++  +  +  +     +++   I V  +G  I   
Sbjct: 129 SAESSTQDNQNTQSEMQQQQAKAMSEQMETVAESIKKALSREIEQGAIEVENLGQQIDIR 188

Query: 76  IPVHVSFV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSI----GTLKNNLLIS 130
           I    +F     FL+ KF P+++ IA ++   P   + +  HTD+        ++N  +S
Sbjct: 189 IREKGAFPEGSAFLQPKFRPLVRQIADLVKDIPG-KVRVTGHTDNQKLDSELYRSNWDLS 247

Query: 131 QERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
            +RA  +   + +     ++ + VRG A   P+  NDT+  R  N+R+EI I 
Sbjct: 248 AQRAVSVAQEMEKVKGFDHQRLQVRGMADTQPLGPNDTEAQRALNRRVEISIL 300


>gi|298504468|gb|ADI83191.1| OmpA family outer membrane protein [Geobacter sulfurreducens KN400]
          Length = 429

 Score =  109 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 35/146 (23%), Positives = 62/146 (42%), Gaps = 5/146 (3%)

Query: 37  DIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPML 96
           D         LDK         +D  +      + I   + V      +  ++ ++   +
Sbjct: 282 DTDGDGVYDYLDKCP----DTPKDLAVDAKGCPERICITLGVQ-FDTDKAVVKPQYNDEI 336

Query: 97  QLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRG 156
           +  A  L ++P     I+ HTDS+G+   N  +S+ RA  +  YL+ +   S + +S +G
Sbjct: 337 KKAADFLKEYPDATAVIEGHTDSVGSDAYNQKLSERRAKAVMKYLVDKFGISAKRLSAKG 396

Query: 157 FAYKYPIDTNDTKVGRQNNQRIEIQI 182
           F    PI  N T+ GR  N+R+   I
Sbjct: 397 FGESKPIADNATEEGRYKNRRVVAVI 422


>gi|39995468|ref|NP_951419.1| OmpA domain-containing protein [Geobacter sulfurreducens PCA]
 gi|39982231|gb|AAR33692.1| OmpA domain protein [Geobacter sulfurreducens PCA]
          Length = 429

 Score =  109 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 35/146 (23%), Positives = 62/146 (42%), Gaps = 5/146 (3%)

Query: 37  DIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPML 96
           D         LDK         +D  +      + I   + V      +  ++ ++   +
Sbjct: 282 DTDGDGVYDYLDKCP----DTPKDLAVDAKGCPERICITLGVQ-FDTDKAVVKPQYNDEI 336

Query: 97  QLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRG 156
           +  A  L ++P     I+ HTDS+G+   N  +S+ RA  +  YL+ +   S + +S +G
Sbjct: 337 KKAADFLKEYPDATAVIEGHTDSVGSDAYNQKLSERRAKAVMKYLVDKFGISAKRLSAKG 396

Query: 157 FAYKYPIDTNDTKVGRQNNQRIEIQI 182
           F    PI  N T+ GR  N+R+   I
Sbjct: 397 FGESKPIADNATEEGRYKNRRVVAVI 422


>gi|66967954|gb|AAY59422.1| outer membrane protein A [Allochromatium vinosum]
          Length = 225

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 51/216 (23%), Positives = 85/216 (39%), Gaps = 35/216 (16%)

Query: 3   KELGLSMFIMTTISGCG----------------------------LASREKKKVFLHKSN 34
           + L LS      ISGC                               S +  K  L  + 
Sbjct: 7   RTLVLSGVTAALISGCAADGSGLTETGRGAAIGTTAGAATGAIIGSLSGDAGKGALIGAV 66

Query: 35  DTDIVNKRFGSSLDKA----EDEFQMQLQDTGIVVSRIGD-MITCYIPVHVSFV-SEVFL 88
              ++    GS +++     E +   ++    I V ++ D  +   +    +F      +
Sbjct: 67  GGALLGTMVGSYMEEQQRDFERQLAPEIASGVIRVQKLPDHQLLVGMTGATAFEVDSDRI 126

Query: 89  EKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSS 148
              F   L+ I+ I+ K+  T +A+  HTDS G    N  +S+ RA  +  YL + GV  
Sbjct: 127 RPGFYSTLEKISAIVRKYGKTQLAVSGHTDSTGAAAYNQTLSERRAASVGYYLERSGVLP 186

Query: 149 NRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
            R  S  G+    PI +N T+ GR+ N+R++I I P
Sbjct: 187 QRIYSA-GYGMNQPIASNATEDGRRLNRRVDILIMP 221


>gi|83589323|ref|YP_429332.1| OmpA/MotB [Moorella thermoacetica ATCC 39073]
 gi|83572237|gb|ABC18789.1| OmpA/MotB [Moorella thermoacetica ATCC 39073]
          Length = 249

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 33/195 (16%), Positives = 69/195 (35%), Gaps = 12/195 (6%)

Query: 3   KELGLSMFIMTTISGCGLASREKKKV--FLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQD 60
           K   L+  +  T++G              +             G+ L +A  E Q  +Q 
Sbjct: 45  KMAALANSLAQTLTGAPTTGILTSGGLTSIVPGIAPAPGQGDEGAELARARAELQQYIQQ 104

Query: 61  TG----IVVSRIGDMITCYIPVHVSFV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQS 115
            G    + ++     +   +   V F      L  +   +L+ +   L + P+  + ++ 
Sbjct: 105 EGLESQVTLNTEERGLVVSVADAVLFPKGSADLTPEARDLLRQVGRALARLPNY-LRVEG 163

Query: 116 HTDSIGTLKN----NLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVG 171
           HTD++         N  +S  RA  +   LI         +S  G+    P+  N+++  
Sbjct: 164 HTDNLPINTPAFPSNWELSTARATNVVKVLISEAGIKPERLSATGYGEYRPVAPNNSEAD 223

Query: 172 RQNNQRIEIQIFPRG 186
              N+R++I +    
Sbjct: 224 MARNRRVDIVVLKEA 238


>gi|300114861|ref|YP_003761436.1| OmpA/MotB domain-containing protein [Nitrosococcus watsonii C-113]
 gi|299540798|gb|ADJ29115.1| OmpA/MotB domain protein [Nitrosococcus watsonii C-113]
          Length = 249

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 51/224 (22%), Positives = 84/224 (37%), Gaps = 42/224 (18%)

Query: 2   IKELG------LSMFIMTTISGCGLASREKKKV--------------------------- 28
           +K++       L + I   + GC    R  +                             
Sbjct: 7   MKKIIKCKLLWLVLAIGIGMLGCATDGRYSQTQKGSAVGTAGGAAAGAAIGAAIDGGSGA 66

Query: 29  ---FLHKSNDTDIVNKRFGSSLDKA---EDEFQMQLQDTGIVVSRIGDM-ITCYIPVHV- 80
               L  +    +     G   D+    E     + +   + + R+ D  +   IP  V 
Sbjct: 67  GWGALAGAVVGGLTGSAVGYMNDQQREMEAALAEERRRHQLEIQRLQDESLKLDIPSEVS 126

Query: 81  SFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSY 140
                  L+  FLP L  IA +L K+  TV+ +  HTDS G  K NL +S  RA  + + 
Sbjct: 127 FDHDSDALKPAFLPTLDKIADVLKKYNKTVVHVIGHTDSTGAEKYNLDLSLRRAGNV-AL 185

Query: 141 LIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
            ++R    ++ +S+ G     P  +N T  GRQ N+R+EI + P
Sbjct: 186 YLERQGIPSQRLSIYGRGENEPRASNATASGRQLNRRVEIILKP 229


>gi|77919971|ref|YP_357786.1| outer membrane protein/peptidoglycan-associated (lipo)proteins
           [Pelobacter carbinolicus DSM 2380]
 gi|77546054|gb|ABA89616.1| outer membrane protein/peptidoglycan-associated (lipo)protein
           [Pelobacter carbinolicus DSM 2380]
          Length = 427

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 39/165 (23%), Positives = 71/165 (43%), Gaps = 9/165 (5%)

Query: 18  CGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIP 77
           C     +       +    D         +DK            G++V + G  I+  + 
Sbjct: 266 CPDTPAD--TPVDTEGCMGDADKDGVADQMDKCPG------TPAGLMVDQQGCPISLTLA 317

Query: 78  VHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVI 137
           +    V +  ++ ++   L+  A  + K+P + I I  HTDS  +   NL +SQ RAD +
Sbjct: 318 IE-FDVDKADIKPRYHSELKRGADFIRKYPESRILIAGHTDSTASDAYNLALSQRRADSV 376

Query: 138 KSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           ++Y+I         +  +G+   +PI  N T  GRQ N+R+E+ +
Sbjct: 377 RNYVISNFGIKAERLEAKGYGEAFPIADNATVQGRQRNRRVELSV 421


>gi|225619153|ref|YP_002720379.1| outer membrane protein OmpA family [Brachyspira hyodysenteriae WA1]
 gi|225213972|gb|ACN82706.1| outer membrane protein OmpA family [Brachyspira hyodysenteriae WA1]
          Length = 403

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 30/140 (21%), Positives = 64/140 (45%), Gaps = 4/140 (2%)

Query: 45  SSLDKAEDEFQMQL-QDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATIL 103
              D    + +  L  D  + +  + + +   +   +       L+ +    +  +   +
Sbjct: 263 EEEDYNRKKLEDNLYNDDNVTIDTVPEGLVLRLGEILFDTDSYTLKPEAKNTIDNVIKAI 322

Query: 104 NK-FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYP 162
            + +P   I ++ HTD+ G  + N  +S++RA  +  Y++      +  +S +GFA   P
Sbjct: 323 KETYPDREIIVEGHTDNTGRKEYNQDLSEKRAKSVADYILPN--LDHDKLSYKGFADDEP 380

Query: 163 IDTNDTKVGRQNNQRIEIQI 182
           I +NDT  GR+ N+R++I I
Sbjct: 381 IASNDTPDGRRKNRRVDIII 400


>gi|152981732|ref|YP_001352854.1| OmpA family protein [Janthinobacterium sp. Marseille]
 gi|151281809|gb|ABR90219.1| OmpA family protein [Janthinobacterium sp. Marseille]
          Length = 229

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 44/211 (20%), Positives = 78/211 (36%), Gaps = 31/211 (14%)

Query: 2   IKELGL-SMFIMTTISGCGLASREKKKVFLHKSNDTDIVN-------------------- 40
           ++ L + S+  +  +SGC   S  ++           +                      
Sbjct: 1   MRTLMIGSLAAVLALSGCANMSETERGTAQGAGIGAGVGALLGGITGGSRNIAGGAAIGG 60

Query: 41  -------KRFGSSLDKAEDEFQMQLQDTGIVVSRI-GDMITCYIPVHVSF-VSEVFLEKK 91
                    + S ++  +   +   Q TG+ VS+   + +   IP  +SF      +   
Sbjct: 61  VIGAVAGNVWSSKMENQKRAMEQATQGTGVQVSQTSDNRLKLEIPSDISFATGRSDINPS 120

Query: 92  FLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRF 151
             P+L   AT L   P+  + I  HTDS G+   N  +S +RA   +   +     + + 
Sbjct: 121 LQPILDRFATGLVDNPTATVTIIGHTDSTGSDAINNPLSFDRASRTRD-YLTGRGVAPQR 179

Query: 152 ISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           I V G     PI +N    GR  N+R+EI +
Sbjct: 180 IYVDGRGSHEPIASNADAAGRARNRRVEIFV 210


>gi|120435967|ref|YP_861653.1| OmpA/MotB family outer membrane protein [Gramella forsetii KT0803]
 gi|117578117|emb|CAL66586.1| OmpA/MotB family outer membrane protein [Gramella forsetii KT0803]
          Length = 235

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 39/220 (17%), Positives = 84/220 (38%), Gaps = 31/220 (14%)

Query: 1   MIKELGLSMFIMTTISGCGLA--SREKKKVFLHKSNDTDIVNKRFGS------------- 45
           +  ++   + + + + GC     +  K+K  +  +    ++    G+             
Sbjct: 4   VFNKMFAVLVVSSLLFGCEATRNANNKQKGAVIGATGGAVIGGVIGNNTGDGNTALGSII 63

Query: 46  --------------SLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVS-EVFLEK 90
                          +DK   + + ++    +     G  +T      V F + +  +  
Sbjct: 64  GGVVGGAAGAIIGNKMDKQAKQIEEEIPGAEVERVGEGINVTFDESSGVYFDTEKYNINA 123

Query: 91  KFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNR 150
           K    L  +A I  ++P + + ++ HTD  G+   NL +S+ RA  +  YL+  G+   R
Sbjct: 124 KSQTTLNKLADIFKEYPQSNVLVEGHTDDTGSDSYNLTLSKNRAQAVTGYLVDNGIDRGR 183

Query: 151 FISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGNIKK 190
             + + +    P   N T  GR  N+R+E+ I     +K+
Sbjct: 184 -FTTKWYGESQPKYDNTTADGRSKNRRVELAIVANEELKE 222


>gi|209522383|ref|ZP_03270996.1| OmpA/MotB domain protein [Burkholderia sp. H160]
 gi|209497180|gb|EDZ97422.1| OmpA/MotB domain protein [Burkholderia sp. H160]
          Length = 150

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 38/142 (26%), Positives = 69/142 (48%), Gaps = 3/142 (2%)

Query: 43  FGSSLDKAEDEFQMQLQDTGIVVSRIGDM-ITCYIPVHVSFVSEVF-LEKKFLPMLQLIA 100
            G + D   +      + TG  ++   D  +   IP  V+F +  + ++  F P+L  +A
Sbjct: 1   TGYNWDNIRNRMSGATKGTGTQITEQPDGSLKLNIPSSVTFDTSSYTIKPSFAPVLDQLA 60

Query: 101 TILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYK 160
             L + P  V ++  HTDS G+L+ N  +S  RA+ +    + +   + + +S  G    
Sbjct: 61  QTLQQNPEVVASVVGHTDSTGSLQYNQTLSVNRAESVT-GYLTQRGIAPQRLSATGMGPN 119

Query: 161 YPIDTNDTKVGRQNNQRIEIQI 182
            PI  N+T+ GR  N+R+EI +
Sbjct: 120 QPIADNNTEAGRAANRRVEIYL 141


>gi|153004433|ref|YP_001378758.1| OmpA/MotB domain-containing protein [Anaeromyxobacter sp. Fw109-5]
 gi|152028006|gb|ABS25774.1| OmpA/MotB domain protein [Anaeromyxobacter sp. Fw109-5]
          Length = 498

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 45/170 (26%), Positives = 74/170 (43%), Gaps = 10/170 (5%)

Query: 22  SREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIV-------VSRIGDMITC 74
             E    F       +  N R G + D  E   + +    G         V+   + IT 
Sbjct: 330 QAEDADGFQDGDGCPEDDNDRDGIADDDDECPDEAEDPGGGARDGCPDGVVTYRENRITV 389

Query: 75  YIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTV-IAIQSHTDSIGTLKNNLLISQER 133
              V         L+ +   +L  +A+IL   P    + ++ HTD +G    N  +S+ R
Sbjct: 390 RGKVQ-FETGSARLKPESQRLLDQVASILRAHPEIRRVRVEGHTDDVGPALTNKELSERR 448

Query: 134 ADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
           AD ++  L++RG++ +R +S+RG+    PI  N TK GR  N+R+E  I 
Sbjct: 449 ADSVRDALVRRGIAPSR-LSIRGYGESRPIAPNKTKAGRAKNRRVEFVIT 497


>gi|110597916|ref|ZP_01386198.1| OmpA/MotB:Rickettsia 17 kDa surface antigen [Chlorobium
           ferrooxidans DSM 13031]
 gi|110340493|gb|EAT58979.1| OmpA/MotB:Rickettsia 17 kDa surface antigen [Chlorobium
           ferrooxidans DSM 13031]
          Length = 229

 Score =  108 bits (271), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 52/211 (24%), Positives = 93/211 (44%), Gaps = 29/211 (13%)

Query: 6   GLSMFIMTTIS-GCGLASREK------------------------KKVFLHKSNDTDIVN 40
            L +  MTT++ GC  +S                            K  L  +       
Sbjct: 13  LLLILAMTTLTWGCQSSSNAGRGAGIGATAGGVIGGIIGSRTGSWAKGALIGAAIGGASG 72

Query: 41  KRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKF-LPMLQLI 99
              G+ +DK   E + ++   G+ V R G+ I   +   + F S            ++ +
Sbjct: 73  ALIGNYMDKQAAEIRNEV--NGVQVEREGEGIRVTMDSGILFTSGSSTLTSTSRANIEKL 130

Query: 100 ATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAY 159
           A I N++  T + I+ HTD+ G+  +N L+S+ RA+ +   L+     S+R +S  G+  
Sbjct: 131 ARIFNRYNDTKVVIEGHTDNTGSAASNQLLSERRAESVAK-LLSAYGVSDRRLSPVGYGQ 189

Query: 160 KYPIDTNDTKVGRQNNQRIEIQIFPRGNIKK 190
             P+ +NDT+ GRQNN+R+E+ I+    +K+
Sbjct: 190 SRPVASNDTEYGRQNNRRVEVLIYANEELKQ 220


>gi|288942206|ref|YP_003444446.1| OmpA/MotB domain-containing protein [Allochromatium vinosum DSM
           180]
 gi|288897578|gb|ADC63414.1| OmpA/MotB domain protein [Allochromatium vinosum DSM 180]
          Length = 225

 Score =  108 bits (271), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 51/216 (23%), Positives = 86/216 (39%), Gaps = 35/216 (16%)

Query: 3   KELGLSMFIMTTISGCG----------------------------LASREKKKVFLHKSN 34
           + L LS      ISGC                               S +  K  L  + 
Sbjct: 7   RTLVLSGVTAALISGCAADGSGLTETGRGAAIGTTAGAATGAIIGSLSGDAGKGALIGAV 66

Query: 35  DTDIVNKRFGSSLDKA----EDEFQMQLQDTGIVVSRIGD-MITCYIPVHVSFV-SEVFL 88
              ++    GS +++     E +   ++    I V ++ D  +   +    +F      +
Sbjct: 67  GGALLGTMVGSYMEEQQRDFERQLAPEIASGVIRVQKLPDHQLLVGMTGATAFEVDSDRI 126

Query: 89  EKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSS 148
           +  F   L+ I+ I+ K+  T +A+  HTDS G    N  +S+ RA  +  YL + GV  
Sbjct: 127 QPGFYSTLEKISAIVRKYGKTQLAVSGHTDSTGAAAYNQTLSERRAASVGYYLERSGVLP 186

Query: 149 NRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
            R  S  G+    PI +N T+ GR+ N+R++I I P
Sbjct: 187 QRIYSA-GYGMNQPIASNATEDGRRLNRRVDILIMP 221


>gi|317121531|ref|YP_004101534.1| OmpA/MotB domain protein [Thermaerobacter marianensis DSM 12885]
 gi|315591511|gb|ADU50807.1| OmpA/MotB domain protein [Thermaerobacter marianensis DSM 12885]
          Length = 343

 Score =  108 bits (271), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 32/176 (18%), Positives = 61/176 (34%), Gaps = 12/176 (6%)

Query: 21  ASREKKKVFLHKSNDTDIVNKRFGSS------LDKAEDEFQMQLQDTGIVVSRIGDMITC 74
           A  E             +V    G        +D+     +                +  
Sbjct: 157 APEENPGGQGEGPGRLPVVTGPPGEEERLRDLVDQVNAALRDAGLGGRASAQLTDRGVAI 216

Query: 75  YIPVHVSFV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKN----NLLI 129
                V F      L  +   +L+ +A IL + P T I ++ HTD++    +    N  +
Sbjct: 217 IFEDQVFFDLGRADLRPEGRELLRRLAPILARVPGT-ILVEGHTDNLPIHSDRFPSNWEL 275

Query: 130 SQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPR 185
           S  RA  +  +L ++     R ++  G+    P   N ++  R  N+R+EI +  +
Sbjct: 276 STARATTVVRFLAEQAGLDPRRLAAAGYGEWRPRFPNTSEANRARNRRVEIVVLRQ 331


>gi|4322001|gb|AAD15905.1| sodium-driven polar flagellar protein [Vibrio parahaemolyticus]
          Length = 315

 Score =  108 bits (271), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 35/169 (20%), Positives = 74/169 (43%), Gaps = 6/169 (3%)

Query: 20  LASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVH 79
                +      +   +  +++   + ++  +   + +++   I V  +G  I   +   
Sbjct: 134 STQSNQSAESDMQQQQSKEMSQEMETLMESIKKALEREIEQGAIEVENLGQQIVIRMREK 193

Query: 80  VSFV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSI----GTLKNNLLISQERA 134
            +F     FL+ KF P+++ IA ++   P   + I  HTD+        ++N  +S +RA
Sbjct: 194 GAFPEGSAFLQPKFRPLVRQIAELVKDVPGI-VRISGHTDNQRLDSELYRSNWDLSSQRA 252

Query: 135 DVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
             +   + +    S++ + VRG A   P+  ND+   R  N+R+EI I 
Sbjct: 253 VSVAQEMEKVRGFSHQRLRVRGMADTEPLVPNDSDENRALNRRVEISIM 301


>gi|254487455|ref|ZP_05100660.1| OmpA family domain protein [Roseobacter sp. GAI101]
 gi|214044324|gb|EEB84962.1| OmpA family domain protein [Roseobacter sp. GAI101]
          Length = 221

 Score =  108 bits (271), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 42/169 (24%), Positives = 79/169 (46%), Gaps = 3/169 (1%)

Query: 19  GLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPV 78
                 + +  L  +     V    G +LD+ E + + QL D+ ++++  GD +   +P 
Sbjct: 55  SKGDGNRAEGALAGALAGGAVGAGVGYTLDQQEADLRRQL-DSNVIITNTGDRLIVTLPQ 113

Query: 79  HVSFVSEVF-LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVI 137
            + F ++   ++      L  +A  +N + ++ + +  HTDS+G    N  +S+ RA+ +
Sbjct: 114 DILFATDSTTVQSGMQSDLAALARNVNVYSNSTLQVIGHTDSVGDASYNQQLSEGRANAV 173

Query: 138 KSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRG 186
            + LI  GV  NR I   G     P+ +N    G+  N+R+EI I P  
Sbjct: 174 ANVLIGNGVPRNR-IQAVGRGESQPVASNLNASGKAQNRRVEIVILPNA 221


>gi|221199341|ref|ZP_03572385.1| ompA family protein [Burkholderia multivorans CGD2M]
 gi|221205757|ref|ZP_03578772.1| ompA family protein [Burkholderia multivorans CGD2]
 gi|221211556|ref|ZP_03584535.1| inner membrane lipoprotein YiaD [Burkholderia multivorans CGD1]
 gi|221168917|gb|EEE01385.1| inner membrane lipoprotein YiaD [Burkholderia multivorans CGD1]
 gi|221174595|gb|EEE07027.1| ompA family protein [Burkholderia multivorans CGD2]
 gi|221180626|gb|EEE13029.1| ompA family protein [Burkholderia multivorans CGD2M]
          Length = 214

 Score =  108 bits (271), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 40/207 (19%), Positives = 74/207 (35%), Gaps = 27/207 (13%)

Query: 2   IK---ELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSL----------- 47
           +K    L +       ++GC         V                              
Sbjct: 3   MKIATRLSVFALAGALLAGCASQQGTNTAVGTGTGAALGAGIGALAGGGKGAAIGAGVGA 62

Query: 48  ----------DKAEDEFQMQLQDTGIVVSRIGDM-ITCYIPVHVSFVSE-VFLEKKFLPM 95
                        +++       TG  V+   D  +   +P  V+F +    +   F P+
Sbjct: 63  LVGGVTGYNWQAIKNKLAPSAAQTGTQVTEQPDGSLKLNVPSSVTFATNQYAITPAFTPL 122

Query: 96  LQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVR 155
           L  +AT LN+ P    ++  +TDS G+ + N  +SQ RA  + +  + +   +   +S +
Sbjct: 123 LNDLATTLNQNPQVTASVIGYTDSTGSAQLNQTLSQNRAQSVVN-ALVQRGVAGNRLSAQ 181

Query: 156 GFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           G     P+  N T+ GR  N+R+EI +
Sbjct: 182 GMGPSNPVADNSTEAGRAQNRRVEIYL 208


>gi|110638110|ref|YP_678319.1| OmpA family peptidoglycan-associated lipoprotein [Cytophaga
           hutchinsonii ATCC 33406]
 gi|110280791|gb|ABG58977.1| peptidoglycan-associated lipoprotein, OmpA family [Cytophaga
           hutchinsonii ATCC 33406]
          Length = 640

 Score =  108 bits (271), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 31/113 (27%), Positives = 55/113 (48%)

Query: 74  CYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQER 133
             +      V +  L  + +  L  +  IL   P+  I +  HTDS G   +N+++S  R
Sbjct: 528 IILRNVFFDVDKATLRPESVQELDKLVDILRHNPNLKIELSGHTDSDGNDDHNMVLSDNR 587

Query: 134 ADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRG 186
           A  +  YLI++G  +   ++ +G+    PI+ NDT   +Q N+R E++I    
Sbjct: 588 AKAVVDYLIKKGGINPNRLTWKGYGETKPIELNDTPEHKQQNRRTEVKILSNE 640


>gi|260911422|ref|ZP_05918013.1| lipoprotein PG3 [Prevotella sp. oral taxon 472 str. F0295]
 gi|260634469|gb|EEX52568.1| lipoprotein PG3 [Prevotella sp. oral taxon 472 str. F0295]
          Length = 225

 Score =  108 bits (271), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 37/209 (17%), Positives = 70/209 (33%), Gaps = 27/209 (12%)

Query: 1   MIK-ELGLSMFIMTTISGCGLASRE----------------------KKKVFLHKSNDTD 37
           M K +L   +  +  + GC                                 +  +    
Sbjct: 1   MKKMKLMTLLMCLALVFGCKTKQGTGALIGTGGGALLGAVIGKVAGNTVVGSVVGATVGA 60

Query: 38  IVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMIT---CYIPVHVSF-VSEVFLEKKFL 93
                 G  +DK       Q++   +      + +          + F  ++  L +   
Sbjct: 61  AAGSMIGKHMDKVAKRTAEQVKSAKVEEVTDANGLKAVKVTFDSGILFATNKAVLSQSSK 120

Query: 94  PMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFIS 153
             L   + +L +     + I  HTD+ G    N+ +S  RA  + +YL   GV   +F  
Sbjct: 121 NELAKFSQVLKENRDCHVDIYGHTDNTGNDGINIPLSNSRAQSVVNYLSNCGVPRGQFQK 180

Query: 154 VRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           V G     P+ +N +  GRQ N+R+E+ +
Sbjct: 181 VEGKGSSEPVASNASASGRQQNRRVEVYL 209


>gi|89070689|ref|ZP_01157958.1| OmpA family protein [Oceanicola granulosus HTCC2516]
 gi|89043710|gb|EAR49914.1| OmpA family protein [Oceanicola granulosus HTCC2516]
          Length = 229

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 52/163 (31%), Positives = 75/163 (46%), Gaps = 3/163 (1%)

Query: 23  REKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF 82
            E+ +     +     V    G SLD+ E E +  L    + +   GD +   +P  + F
Sbjct: 67  EERNRNIAAGALVGAAVGAGVGYSLDRQEAELRRSL-GNNVRIDNTGDSLVVTLPQDILF 125

Query: 83  V-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYL 141
                 L       L  +A  LN +PST I +  HTD+ G    N  +S+ RA  + S L
Sbjct: 126 DTDSATLSGSLQSDLNALARSLNNYPSTTITVIGHTDNTGEASYNQNLSRRRAQAVTSTL 185

Query: 142 IQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           I  GVS+ R  +V G     PI TN T+ GR+ N+R+EI I P
Sbjct: 186 ISSGVSAGRINTV-GRGEDAPIATNLTEDGRRQNRRVEIIINP 227


>gi|237744058|ref|ZP_04574539.1| outer membrane porin F [Fusobacterium sp. 7_1]
 gi|256028141|ref|ZP_05441975.1| Outer membrane porin F [Fusobacterium sp. D11]
 gi|260494357|ref|ZP_05814488.1| type VI secretion system OmpA/MotB [Fusobacterium sp. 3_1_33]
 gi|289766078|ref|ZP_06525456.1| outer membrane porin F [Fusobacterium sp. D11]
 gi|229431287|gb|EEO41499.1| outer membrane porin F [Fusobacterium sp. 7_1]
 gi|260198503|gb|EEW96019.1| type VI secretion system OmpA/MotB [Fusobacterium sp. 3_1_33]
 gi|289717633|gb|EFD81645.1| outer membrane porin F [Fusobacterium sp. D11]
          Length = 182

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 50/172 (29%), Positives = 78/172 (45%), Gaps = 6/172 (3%)

Query: 16  SGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCY 75
           + C      +K      S +   V     +   K   E  +   + G+ + R G+ +   
Sbjct: 16  TACSSTKTNRKTNVGVDSTNKYAVEDTEAN---KKPLEDIIVFNEEGVTIRREGNNLILS 72

Query: 76  IPVHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERA 134
           +P  + F   +  ++ K  P L  +A  L +     I I  +TD IGT   NL +S +RA
Sbjct: 73  MPELILFDFDKYIVKDKIKPSLSTLAKALGENKDIHIKIDGYTDFIGTEAYNLELSVKRA 132

Query: 135 DVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRG 186
           + IK +LI RG   +  IS+ G+  + P DTN T  GR  N+R+E  I  RG
Sbjct: 133 NAIKDFLISRGAIGSN-ISIEGYGEQNPADTNQTAAGRSRNRRVEF-IISRG 182


>gi|262375710|ref|ZP_06068942.1| type VI secretion system OmpA/MotB [Acinetobacter lwoffii SH145]
 gi|262309313|gb|EEY90444.1| type VI secretion system OmpA/MotB [Acinetobacter lwoffii SH145]
          Length = 217

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 48/209 (22%), Positives = 85/209 (40%), Gaps = 32/209 (15%)

Query: 5   LGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGS------------------- 45
           +  ++     ++GC         V   K+    ++    G                    
Sbjct: 6   ISAAVAGAVALTGCQSTGSNIGGVEYDKAALGTLIGTAAGYGVSKSNANTSRQNNRAAAI 65

Query: 46  ----------SLDKAEDEFQMQLQDTGIVVSRIGDM-ITCYIPVHVSFVS-EVFLEKKFL 93
                      LD  E + +     TG+ V+R  D  I   +P  ++F + +  ++  F 
Sbjct: 66  GAVVGGAAGVYLDNKEKKLRQATAGTGVDVNRNADGSINLVMPGSITFDTNKSNIKPNFY 125

Query: 94  PMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFIS 153
             L  +A +L +   + I +  +TDS G    NL +SQ RA+ + +YL  +GVS  R I+
Sbjct: 126 GTLNKVAQVLTEDNQSGILVTGYTDSTGNDSINLPLSQARANSVATYLAGQGVSRTR-IN 184

Query: 154 VRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
            +G     PI  N T  G++ N+R+EI +
Sbjct: 185 AQGLGSANPIADNTTAAGKEQNRRVEIAV 213


>gi|222054259|ref|YP_002536621.1| OmpA/MotB domain protein [Geobacter sp. FRC-32]
 gi|221563548|gb|ACM19520.1| OmpA/MotB domain protein [Geobacter sp. FRC-32]
          Length = 242

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 44/217 (20%), Positives = 76/217 (35%), Gaps = 35/217 (16%)

Query: 2   IKELGLSMFIMTTISGCGLAS------------------------------REKKKVFLH 31
           IK +  +  +    +GC                                    + +    
Sbjct: 21  IKVVAGASIVAMLAAGCATNPDGSYEFKRSAIGSLGGAALGAGIGALAGGKTHRGRNAAI 80

Query: 32  KSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV-SEVFLEK 90
                 +V    G  +D+     +  L +    V R GD +   +P  + F   +  L+ 
Sbjct: 81  GGLSGAVVGGGIGYYMDRQAAALKKNLPE--AEVVRDGDKVYVALPSGILFDLGKDALKS 138

Query: 91  KFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNR 150
                L   A  L     T I +Q HTDS G+   N  +S+ RA  ++ +L   GV + R
Sbjct: 139 GAKESLSKAAATLKA-SETNIVVQGHTDSTGSDAINQPLSERRAKQVRDFLTANGVPAFR 197

Query: 151 FISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGN 187
            ++  G+    P   NDT   R  N+R++++I P   
Sbjct: 198 -LTAVGYGSSRPAVANDTDANRALNRRVQLEISPNEK 233


>gi|320536711|ref|ZP_08036721.1| OmpA family protein [Treponema phagedenis F0421]
 gi|320146448|gb|EFW38054.1| OmpA family protein [Treponema phagedenis F0421]
          Length = 412

 Score =  108 bits (270), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 37/157 (23%), Positives = 65/157 (41%), Gaps = 3/157 (1%)

Query: 32  KSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIV---VSRIGDMITCYIPVHVSFVSEVFL 88
           +   +  + +          ++   ++++ GI    +S+  + IT  I           L
Sbjct: 256 EGTASAEITETKKLDKAAVAEDLTQKIEELGIENTTISQTDEGITISIENIQFEADSARL 315

Query: 89  EKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSS 148
                  LQ I  +L  FP   + I  HT   GT      +S+ERAD +  YL + G+  
Sbjct: 316 LSSEKEKLQKIGRLLQGFPDKELLISGHTALRGTAAERQKLSEERADSVARYLEEIGIRD 375

Query: 149 NRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPR 185
            + +  RGF  + P+  N  +  R  N+R+EI I  +
Sbjct: 376 TQHLYTRGFGARRPLAPNTNEENRARNRRVEITILEK 412


>gi|241663775|ref|YP_002982135.1| OmpA/MotB domain-containing protein [Ralstonia pickettii 12D]
 gi|240865802|gb|ACS63463.1| OmpA/MotB domain protein [Ralstonia pickettii 12D]
          Length = 209

 Score =  108 bits (270), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 49/207 (23%), Positives = 74/207 (35%), Gaps = 24/207 (11%)

Query: 1   MIKELGLSMFIMTTISGCGLASREKK---------------------KVFLHKSNDTDIV 39
           M  +L     I    +GC    + +                      K            
Sbjct: 1   MKAKLISVSLIALLAAGCATEQQNQTAMGTGVGAAVGAGIGALVGNGKGAAIGGALGAAT 60

Query: 40  NKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDM-ITCYIPVHV-SFVSEVFLEKKFLPMLQ 97
               G +    + +       TG  +S   D  +   IP  V        ++  F   L 
Sbjct: 61  GAAVGYNWGAIKSKLAGDTAGTGTQISEQPDGSLKLNIPSQVSFDTDSAVIKPSFRGPLD 120

Query: 98  LIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGF 157
            +A  L + P     +  HTDS G    N+ +SQ+RA  + SYL  RGV+ NR +S  G 
Sbjct: 121 SVAQTLTQHPELAANVVGHTDSTGNPNYNMTLSQKRAQSVASYLTDRGVARNR-LSAEGR 179

Query: 158 AYKYPIDTNDTKVGRQNNQRIEIQIFP 184
               P+  N T+ GR  N+R+EI + P
Sbjct: 180 GQNQPVADNATEAGRAQNRRVEIYLKP 206


>gi|187929665|ref|YP_001900152.1| OmpA/MotB domain-containing protein [Ralstonia pickettii 12J]
 gi|309781567|ref|ZP_07676302.1| inner membrane lipoprotein YiaD [Ralstonia sp. 5_7_47FAA]
 gi|187726555|gb|ACD27720.1| OmpA/MotB domain protein [Ralstonia pickettii 12J]
 gi|308919672|gb|EFP65334.1| inner membrane lipoprotein YiaD [Ralstonia sp. 5_7_47FAA]
          Length = 209

 Score =  108 bits (270), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 50/207 (24%), Positives = 74/207 (35%), Gaps = 24/207 (11%)

Query: 1   MIKELGLSMFIMTTISGCGLASREKK---------------------KVFLHKSNDTDIV 39
           M  +L     I    +GC    + +                      K            
Sbjct: 1   MKAKLISVSLIALLAAGCATEQQNQTAMGTGVGAAVGAGIGALVGNGKGAAIGGALGAAT 60

Query: 40  NKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDM-ITCYIPVHV-SFVSEVFLEKKFLPMLQ 97
               G +    + +       TG  +S   D  +   IP  V        ++  F   L 
Sbjct: 61  GAAVGYNWGAIKSKLAGDTAGTGTQISEQPDGSLKLNIPSQVSFDTDSAVIKPSFRGPLD 120

Query: 98  LIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGF 157
            +A  L + P     +  HTDS G    NL +SQ+RA  + SYL  RGV+ NR +S  G 
Sbjct: 121 SVAQTLTQHPELAANVVGHTDSTGNPNYNLTLSQKRAQSVASYLTDRGVARNR-LSAEGR 179

Query: 158 AYKYPIDTNDTKVGRQNNQRIEIQIFP 184
               P+  N T+ GR  N+R+EI + P
Sbjct: 180 GQNQPVADNATEAGRAQNRRVEIYLKP 206


>gi|262402758|ref|ZP_06079319.1| Flagellar motor rotation protein MotB [Vibrio sp. RC586]
 gi|262351540|gb|EEZ00673.1| Flagellar motor rotation protein MotB [Vibrio sp. RC586]
          Length = 304

 Score =  108 bits (270), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 36/173 (20%), Positives = 73/173 (42%), Gaps = 6/173 (3%)

Query: 16  SGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCY 75
           S        +      +      ++++  +  +  +     +++   I V  +G  I   
Sbjct: 114 SAESSTQENQNTQSDMQQQQAKAMSEQMETVAESIKKALSREIEQGAIEVENLGQQIDIR 173

Query: 76  IPVHVSFV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSI----GTLKNNLLIS 130
           I    +F     FL+ KF P+++ IA ++   P   + +  HTD+        ++N  +S
Sbjct: 174 IREKGAFPEGSAFLQPKFRPLVRQIADLVKDIPG-KVRVTGHTDNQKLDSELYRSNWDLS 232

Query: 131 QERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
            +RA  +   + +     ++ + VRG A   P+  NDT+  R  N+R+EI I 
Sbjct: 233 AQRAVSVAQEMEKVKGFDHQRLQVRGMADTQPLGPNDTEAQRALNRRVEISIL 285


>gi|269962340|ref|ZP_06176690.1| flagellar motor protein [Vibrio harveyi 1DA3]
 gi|269832836|gb|EEZ86945.1| flagellar motor protein [Vibrio harveyi 1DA3]
          Length = 314

 Score =  108 bits (270), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 37/178 (20%), Positives = 77/178 (43%), Gaps = 10/178 (5%)

Query: 15  ISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKA----EDEFQMQLQDTGIVVSRIGD 70
           ++G        +     +S+     +++    +D      +   + +++   I V  +G 
Sbjct: 124 LTGGQSPETSTQNNQSAESDMQQQQSEQTSQEMDTLMESIKKALEREIEQGAIEVENLGQ 183

Query: 71  MITCYIPVHVSFV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGT----LKN 125
            I   +    +F     FL+ KF P+++ IA ++   P   + +  HTD+        ++
Sbjct: 184 QIVIRMREKGAFPEGSAFLQPKFRPLVRQIAELVKDVPGI-VRVSGHTDNQPLDSELYRS 242

Query: 126 NLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
           N  +S +RA  +   + +    S++ + VRG A   P+  ND+   R  N+R+EI I 
Sbjct: 243 NWDLSSQRAVSVAQEMEKVRGFSHQRLRVRGMADTEPLAPNDSDANRALNRRVEISIM 300


>gi|2130949|dbj|BAA20285.1| PomB [Vibrio alginolyticus]
          Length = 315

 Score =  108 bits (270), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 36/178 (20%), Positives = 77/178 (43%), Gaps = 10/178 (5%)

Query: 15  ISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKA----EDEFQMQLQDTGIVVSRIGD 70
           ++G    +   +     +++     +K     ++      +   + +++   I V  +G 
Sbjct: 125 LTGGQSPATSTQNNESAEADMQQQQSKEMSQEMETLMESIKKALEREIEQGAIEVENLGQ 184

Query: 71  MITCYIPVHVSFV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGT----LKN 125
            I   +    +F     FL+ KF P+++ IA ++   P   + +  HTD+        ++
Sbjct: 185 QIVIRMREKGAFPEGSAFLQPKFRPLVRQIAELVKDVPGI-VRVSGHTDNRPLDSELYRS 243

Query: 126 NLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
           N  +S +RA  +   + +    S++ + VRG A   P+  ND+   R  N+R+EI I 
Sbjct: 244 NWDLSSQRAVSVAQEMEKVRGFSHQRLRVRGMADTEPLLPNDSDDNRALNRRVEISIM 301


>gi|53718641|ref|YP_107627.1| OmpA family transmembrane protein [Burkholderia pseudomallei
           K96243]
 gi|53725212|ref|YP_102481.1| ompA family protein [Burkholderia mallei ATCC 23344]
 gi|67639751|ref|ZP_00438587.1| OmpA family protein [Burkholderia mallei GB8 horse 4]
 gi|121600283|ref|YP_993611.1| ompA family protein [Burkholderia mallei SAVP1]
 gi|124385832|ref|YP_001028928.1| ompA family protein [Burkholderia mallei NCTC 10229]
 gi|126440263|ref|YP_001058104.1| ompA family protein [Burkholderia pseudomallei 668]
 gi|126449467|ref|YP_001081159.1| ompA family protein [Burkholderia mallei NCTC 10247]
 gi|126452105|ref|YP_001065339.1| ompA family protein [Burkholderia pseudomallei 1106a]
 gi|134281074|ref|ZP_01767783.1| OmpA family protein [Burkholderia pseudomallei 305]
 gi|167003046|ref|ZP_02268836.1| OmpA family protein [Burkholderia mallei PRL-20]
 gi|167718574|ref|ZP_02401810.1| ompA family protein [Burkholderia pseudomallei DM98]
 gi|167814738|ref|ZP_02446418.1| ompA family protein [Burkholderia pseudomallei 91]
 gi|167901748|ref|ZP_02488953.1| ompA family protein [Burkholderia pseudomallei NCTC 13177]
 gi|217419903|ref|ZP_03451409.1| ompA family protein [Burkholderia pseudomallei 576]
 gi|226194470|ref|ZP_03790068.1| ompA family protein [Burkholderia pseudomallei Pakistan 9]
 gi|237811323|ref|YP_002895774.1| OmpA family protein [Burkholderia pseudomallei MSHR346]
 gi|242316655|ref|ZP_04815671.1| ompA family protein [Burkholderia pseudomallei 1106b]
 gi|254177848|ref|ZP_04884503.1| ompA family protein [Burkholderia mallei ATCC 10399]
 gi|254190801|ref|ZP_04897308.1| ompA family protein [Burkholderia pseudomallei Pasteur 52237]
 gi|254196800|ref|ZP_04903224.1| ompA family protein [Burkholderia pseudomallei S13]
 gi|254261713|ref|ZP_04952767.1| ompA family protein [Burkholderia pseudomallei 1710a]
 gi|254298274|ref|ZP_04965726.1| ompA family protein [Burkholderia pseudomallei 406e]
 gi|254357860|ref|ZP_04974133.1| OmpA family protein [Burkholderia mallei 2002721280]
 gi|52209055|emb|CAH34995.1| putative OmpA family transmembrane protein [Burkholderia
           pseudomallei K96243]
 gi|52428635|gb|AAU49228.1| ompA family protein [Burkholderia mallei ATCC 23344]
 gi|121229093|gb|ABM51611.1| ompA family protein [Burkholderia mallei SAVP1]
 gi|124293852|gb|ABN03121.1| ompA family protein [Burkholderia mallei NCTC 10229]
 gi|126219756|gb|ABN83262.1| ompA family protein [Burkholderia pseudomallei 668]
 gi|126225747|gb|ABN89287.1| ompA family protein [Burkholderia pseudomallei 1106a]
 gi|126242337|gb|ABO05430.1| ompA family protein [Burkholderia mallei NCTC 10247]
 gi|134247380|gb|EBA47465.1| OmpA family protein [Burkholderia pseudomallei 305]
 gi|148026987|gb|EDK85008.1| OmpA family protein [Burkholderia mallei 2002721280]
 gi|157808098|gb|EDO85268.1| ompA family protein [Burkholderia pseudomallei 406e]
 gi|157938476|gb|EDO94146.1| ompA family protein [Burkholderia pseudomallei Pasteur 52237]
 gi|160698887|gb|EDP88857.1| ompA family protein [Burkholderia mallei ATCC 10399]
 gi|169653543|gb|EDS86236.1| ompA family protein [Burkholderia pseudomallei S13]
 gi|217397207|gb|EEC37223.1| ompA family protein [Burkholderia pseudomallei 576]
 gi|225933555|gb|EEH29544.1| ompA family protein [Burkholderia pseudomallei Pakistan 9]
 gi|237503911|gb|ACQ96229.1| OmpA family protein [Burkholderia pseudomallei MSHR346]
 gi|238520349|gb|EEP83810.1| OmpA family protein [Burkholderia mallei GB8 horse 4]
 gi|242139894|gb|EES26296.1| ompA family protein [Burkholderia pseudomallei 1106b]
 gi|243061351|gb|EES43537.1| OmpA family protein [Burkholderia mallei PRL-20]
 gi|254220402|gb|EET09786.1| ompA family protein [Burkholderia pseudomallei 1710a]
          Length = 215

 Score =  108 bits (270), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 41/202 (20%), Positives = 73/202 (36%), Gaps = 24/202 (11%)

Query: 4   ELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSL---------------- 47
            L +       ++GC         V                                   
Sbjct: 8   RLSVFALAGALLAGCATQQGTNTAVGTGTGAALGAGIGALAGGGKGAAIGAGVGALVGGV 67

Query: 48  -----DKAEDEFQMQLQDTGIVVSRIGDM-ITCYIPVHVSF-VSEVFLEKKFLPMLQLIA 100
                   +++     Q TG  V+   D  +   +P  V+F   +  +   F P+L  +A
Sbjct: 68  TGYNWQAIKNKLAPSAQQTGTQVTEQPDGSLKLNVPSSVTFATDQYAITPAFTPLLNDLA 127

Query: 101 TILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYK 160
           T LN+ P    ++  +TDS G+  +N  +SQ RA  + +  + +   +   +S +G    
Sbjct: 128 TTLNQNPQITASVVGYTDSTGSAAHNQTLSQNRAQSVVN-ALAQRGVAANRLSAQGMGAS 186

Query: 161 YPIDTNDTKVGRQNNQRIEIQI 182
            PI  N T+ GR  N+R+EI +
Sbjct: 187 NPIADNATEAGRAQNRRVEIYL 208


>gi|161524037|ref|YP_001579049.1| OmpA/MotB domain-containing protein [Burkholderia multivorans ATCC
           17616]
 gi|189351202|ref|YP_001946830.1| putative OmpA family transmembrane protein [Burkholderia
           multivorans ATCC 17616]
 gi|160341466|gb|ABX14552.1| OmpA/MotB domain protein [Burkholderia multivorans ATCC 17616]
 gi|189335224|dbj|BAG44294.1| putative OmpA family transmembrane protein [Burkholderia
           multivorans ATCC 17616]
          Length = 214

 Score =  108 bits (270), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 40/207 (19%), Positives = 74/207 (35%), Gaps = 27/207 (13%)

Query: 2   IK---ELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSL----------- 47
           +K    L +       ++GC         V                              
Sbjct: 3   MKIATRLSVFALAGALLAGCATQQGNNTAVGTGTGAALGAGIGALAGGGKGAAIGAGVGA 62

Query: 48  ----------DKAEDEFQMQLQDTGIVVSRIGDM-ITCYIPVHVSFVSE-VFLEKKFLPM 95
                        +++       TG  V+   D  +   +P  V+F +    +   F P+
Sbjct: 63  LVGGVTGYNWQAIKNKLAPSAAQTGTQVTEQPDGSLKLNVPSSVTFATNQYAITPAFTPL 122

Query: 96  LQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVR 155
           L  +AT LN+ P    ++  +TDS G+ + N  +SQ RA  + +  + +   +   +S +
Sbjct: 123 LNDLATTLNQNPQVTASVIGYTDSTGSAQLNQTLSQNRAQSVVN-ALVQRGVAGNRLSAQ 181

Query: 156 GFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           G     P+  N T+ GR  N+R+EI +
Sbjct: 182 GMGPSNPVADNSTEAGRAQNRRVEIYL 208


>gi|73540381|ref|YP_294901.1| OmpA [Ralstonia eutropha JMP134]
 gi|72117794|gb|AAZ60057.1| OmpA [Ralstonia eutropha JMP134]
          Length = 212

 Score =  108 bits (270), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 39/195 (20%), Positives = 69/195 (35%), Gaps = 31/195 (15%)

Query: 17  GCGLASREKKKVFLHKSNDTDIVNKRFGSSL-------------------------DKAE 51
           GC     E++      +     V    G+ +                         +   
Sbjct: 19  GCAT---EQQTHTAVGTGVGAAVGAGLGNLIGGNTTGTLVGAAVGGAVGGATGYNWNAIR 75

Query: 52  DEFQMQLQDTGIVVSRIGDM-ITCYIPVHVSFV-SEVFLEKKFLPMLQLIATILNKFPST 109
            +       TG  ++   D  +   IP  V+F      ++  F  +L  +A  L +    
Sbjct: 76  GKLNKDTAGTGTQITEQPDGSLKVNIPSQVTFDTDSATIKPSFRSVLDQVAQTLGQHQDV 135

Query: 110 VIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTK 169
           V  +  HTDS G  + N+ +SQ RA  + +  +     +   +S  G     P+  N T+
Sbjct: 136 VANVVGHTDSTGNAQYNMQLSQRRAQSV-ATYLGDRGVARNRLSAEGRGQTQPVADNATE 194

Query: 170 VGRQNNQRIEIQIFP 184
            GR  N+R+EI + P
Sbjct: 195 AGRTQNRRVEIFLKP 209


>gi|239818112|ref|YP_002947022.1| OmpA/MotB domain protein [Variovorax paradoxus S110]
 gi|239804689|gb|ACS21756.1| OmpA/MotB domain protein [Variovorax paradoxus S110]
          Length = 219

 Score =  108 bits (270), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 47/220 (21%), Positives = 82/220 (37%), Gaps = 35/220 (15%)

Query: 1   MIKELGLSMFIMTTISGCGLASREKKKVF----------------LHKSNDTDIVNKR-- 42
           M K +  +      +SGC     + ++                      N   I      
Sbjct: 1   MKKFVLATTAAALVLSGCAGGMTDTQRNTGIGAGIGALGGAAIGSATGGNRGAIGTGAVV 60

Query: 43  -----------FGSSLDKAEDEFQMQLQDTGIVVSRIGDM-ITCYIPVHV-SFVSEVFLE 89
                      +   ++  + + +   Q TG+ V++  +  +   IP  V   V    ++
Sbjct: 61  GAAAGALGGYLWSQRMENQKRQMEAATQGTGVAVTQTPNNELKLQIPSDVSFDVGRSNIK 120

Query: 90  KKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSN 149
             F P+L   A+ L   P+  + I  HTD+ G+   N  +S +RA   + YL+ R   S 
Sbjct: 121 SNFAPVLDQFASGLRNNPNAEVRIIGHTDNTGSDAINNPLSVDRAASTRDYLVAR-GVSA 179

Query: 150 RFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI---FPRG 186
               + G     PI  N++  GR  N+R+EI +    PRG
Sbjct: 180 AAFRIEGRGSHEPIANNNSDAGRAQNRRVEIYVGERAPRG 219


>gi|305666954|ref|YP_003863241.1| OmpA family protein [Maribacter sp. HTCC2170]
 gi|88709183|gb|EAR01417.1| OmpA family protein [Maribacter sp. HTCC2170]
          Length = 217

 Score =  108 bits (270), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 42/212 (19%), Positives = 87/212 (41%), Gaps = 36/212 (16%)

Query: 12  MTTISGCGLA--SREKKKVFLHKSNDTDIVNKRFGS------------------------ 45
           M  I+GC     +  K+K  +  ++   ++    G+                        
Sbjct: 1   MALITGCSATRNANNKQKGAVIGASGGAVIGGIIGNNVGKKGNTALGAIIGAVVGGVAGG 60

Query: 46  ----SLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPV---HVSFVSEVFLEKKFLPMLQL 98
                +D+  +  + ++   G  V+R+G+ I              S+  ++      L  
Sbjct: 61  YIGDRMDRQAERIEEEIP--GAEVTRVGEGINVTFNEEAGVYFDTSKSNVKGTSATTLDK 118

Query: 99  IATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFA 158
           +A I  ++P++ + I+ HTDS G    N+ +SQ+RA+ + +YLI +        S + + 
Sbjct: 119 LAGIFKEYPNSDVLIEGHTDSAGPDDYNMKLSQQRAESVTNYLISK-GIEANRFSTKWYG 177

Query: 159 YKYPIDTNDTKVGRQNNQRIEIQIFPRGNIKK 190
              P   N+T  G+  N+R+E+ I    ++K+
Sbjct: 178 ENQPKADNETTEGKAKNRRVELAIIASKDLKE 209


>gi|110636642|ref|YP_676849.1| outer membrane porin F [Cytophaga hutchinsonii ATCC 33406]
 gi|110279323|gb|ABG57509.1| outer membrane protein, porin F precursor [Cytophaga hutchinsonii
           ATCC 33406]
          Length = 669

 Score =  108 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 36/173 (20%), Positives = 68/173 (39%), Gaps = 4/173 (2%)

Query: 17  GCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQ----DTGIVVSRIGDMI 72
                     K+ L        + ++ G        +          +  + ++ I    
Sbjct: 497 ASSNYDSATYKIVLPAGAKYGYLAEKEGYVSINENIDLTDMKAYKEYEKDLYITPIETGQ 556

Query: 73  TCYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQE 132
              +       ++  L+ +  P L  + T+L    +  I I  +TDSIGT   N  +S  
Sbjct: 557 VVVLNNVFFDFNKYELKSESYPELDRLVTLLKNNNAMKIEISGYTDSIGTKSYNDKLSGR 616

Query: 133 RADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPR 185
           RA  + +YLI +       I+V+ F  + P+ +N T  GR+ N+R+E +I  +
Sbjct: 617 RAQAVATYLITKSAIDKSRITVKAFGEENPVTSNKTAKGRELNRRVEFKITNK 669


>gi|37679056|ref|NP_933665.1| flagellar motor protein MotB [Vibrio vulnificus YJ016]
 gi|326423687|ref|NP_759314.2| flagellar motor rotation protein motB [Vibrio vulnificus CMCP6]
 gi|37197798|dbj|BAC93636.1| flagellar motor protein [Vibrio vulnificus YJ016]
 gi|319999044|gb|AAO08841.2| Flagellar motor rotation protein motB [Vibrio vulnificus CMCP6]
          Length = 318

 Score =  108 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 37/153 (24%), Positives = 74/153 (48%), Gaps = 6/153 (3%)

Query: 36  TDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV-SEVFLEKKFLP 94
           ++ ++K   + ++  +   + +++   I V  +G  I   +    +F     FL+ KF P
Sbjct: 150 SEAMSKEMETLMESIKKALEREIEQGAIEVENLGQQIVIRMREKGAFPEGSAFLQPKFRP 209

Query: 95  MLQLIATILNKFPSTVIAIQSHTDSI----GTLKNNLLISQERADVIKSYLIQRGVSSNR 150
           +++ IA ++   P   + I  HTD+        ++N  +S +RA  +   + +    S++
Sbjct: 210 LVRQIAELVKDVPGI-VRISGHTDNQRLDSELYRSNWDLSAQRAVSVAQEMEKVRGFSHQ 268

Query: 151 FISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
            + VRG A   P+  NDT+  R  N+R+EI I 
Sbjct: 269 RLRVRGMADTDPLVDNDTEENRARNRRVEISIM 301


>gi|254283478|ref|ZP_04958446.1| OmpA family protein [gamma proteobacterium NOR51-B]
 gi|219679681|gb|EED36030.1| OmpA family protein [gamma proteobacterium NOR51-B]
          Length = 199

 Score =  108 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 45/155 (29%), Positives = 76/155 (49%), Gaps = 3/155 (1%)

Query: 31  HKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLE 89
             +  + +     G  LD         L   G+ V R  D +   +P   SF      L+
Sbjct: 26  TAAKHSPVDTDSIGYYLDVQTARL-QALAREGVSVERRDDHLLIVMPGTASFASDSALLK 84

Query: 90  KKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSN 149
              L +L  ++T+L +F  ++I I  H+DS+G    NL +S++RA  + ++ + +    +
Sbjct: 85  SNMLGLLDDLSTVLQEFNKSLIFIGGHSDSLGDSGYNLYLSRQRALAVGTH-LSKVGIDS 143

Query: 150 RFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
             + VRGF    PI TNDT+ GR  N+RIE+ ++P
Sbjct: 144 WRLVVRGFGDAKPIATNDTESGRAGNRRIELTVWP 178


>gi|269965067|ref|ZP_06179232.1| flagellar motor protein [Vibrio alginolyticus 40B]
 gi|269830370|gb|EEZ84595.1| flagellar motor protein [Vibrio alginolyticus 40B]
          Length = 315

 Score =  108 bits (269), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 34/169 (20%), Positives = 74/169 (43%), Gaps = 6/169 (3%)

Query: 20  LASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVH 79
                +      +   +  +++   + ++  +   + +++   I V  +G  I   +   
Sbjct: 134 STQNNESAEADMQQQQSKEMSQEMETLMESIKKALEREIEQGAIEVENLGQQIVIRMREK 193

Query: 80  VSFV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGT----LKNNLLISQERA 134
            +F     FL+ KF P+++ IA ++   P   + +  HTD+        ++N  +S +RA
Sbjct: 194 GAFPEGSAFLQPKFRPLVRQIAELVKDVPGI-VRVSGHTDNRPLDSELYRSNWDLSSQRA 252

Query: 135 DVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
             +   + +    S++ + VRG A   P+  ND+   R  N+R+EI I 
Sbjct: 253 VSVAQEMEKVRGFSHQRLRVRGMADTEPLLPNDSDDNRALNRRVEISIM 301


>gi|114776523|ref|ZP_01451568.1| putative lipoprotein [Mariprofundus ferrooxydans PV-1]
 gi|114553353|gb|EAU55751.1| putative lipoprotein [Mariprofundus ferrooxydans PV-1]
          Length = 223

 Score =  108 bits (269), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 44/171 (25%), Positives = 72/171 (42%), Gaps = 5/171 (2%)

Query: 17  GCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQ---MQLQDTGIVVSRIGDMIT 73
               A+       L  +    +V +     LD+ E   +          +V       + 
Sbjct: 49  AASTAANAGLYGGLIGAAAGFVVGETAVQYLDRQEKAVRLSKDATAGNIVVQRETPQALK 108

Query: 74  CYIPVHVSFVSEV-FLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQE 132
             +    +F S    L ++    L  +AT+L ++  T + I  HTDS GT   N  +S+ 
Sbjct: 109 LTLSRDAAFASGSNELSEQGKQTLDDVATLLKRYKKTRLTITGHTDSTGTALFNQSLSER 168

Query: 133 RADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
           RA  + SY+I +GVS++R I+  G     P   ND+   R  N+R+EI I 
Sbjct: 169 RALAVASYMISKGVSADR-IASSGMGESSPAYPNDSAANRAKNRRVEILIT 218


>gi|300113742|ref|YP_003760317.1| OmpA/MotB domain-containing protein [Nitrosococcus watsonii C-113]
 gi|299539679|gb|ADJ27996.1| OmpA/MotB domain protein [Nitrosococcus watsonii C-113]
          Length = 286

 Score =  108 bits (269), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 39/159 (24%), Positives = 62/159 (38%), Gaps = 7/159 (4%)

Query: 32  KSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKK 91
           ++       K      DK E           +   +        +   +  V    L   
Sbjct: 129 EARQAKEQAKMAEVRADKLEKRLAA------LNAEKTERGYVLTLGDILFEVDSAELTSG 182

Query: 92  FLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRF 151
            +  L  + T L ++P   + I+ HTDS G+   N+ +SQ RAD +    +     S   
Sbjct: 183 GMQNLFRLVTFLKEYPDRQVVIEGHTDSTGSGVYNMELSQRRADAVYE-FLVNNGISPAR 241

Query: 152 ISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGNIKK 190
           I+  G+   YP+  N+T  GRQ N+R+EI I   G   K
Sbjct: 242 IAAHGYGKAYPVAPNNTAAGRQKNRRVEIVILDAGKKAK 280


>gi|197116705|ref|YP_002137132.1| OmpA family outer membrane protein [Geobacter bemidjiensis Bem]
 gi|197086065|gb|ACH37336.1| OmpA family outer membrane protein [Geobacter bemidjiensis Bem]
          Length = 169

 Score =  108 bits (269), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 36/183 (19%), Positives = 76/183 (41%), Gaps = 16/183 (8%)

Query: 1   MIKELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQD 60
           M K++ ++  +   +SG   A  +  K    ++      + + G+ L    ++ +    +
Sbjct: 1   MFKKVAIAAVLSLMVSGVAYAGLDALKGLGKEAGKGVAASAKEGA-LSAVTNKLKKVQNE 59

Query: 61  TGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSI 120
            G                      +  ++      +  IA I+  +P   + +  HTD++
Sbjct: 60  KGP---------------IKFKTGKAEIDPSCDKTMTAIAAIMTDYPGFHVQVDGHTDNV 104

Query: 121 GTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEI 180
           G  + N  +SQ+RAD +  YL+ +     + +S +GF    PI  N TK G+  N+R++ 
Sbjct: 105 GKPEANQKLSQDRADAVVKYLVDKKAVDAKRLSAKGFGDSKPIADNKTKAGQAKNRRVDF 164

Query: 181 QIF 183
            + 
Sbjct: 165 TVT 167


>gi|254454298|ref|ZP_05067735.1| OmpA family domain protein [Octadecabacter antarcticus 238]
 gi|198268704|gb|EDY92974.1| OmpA family domain protein [Octadecabacter antarcticus 238]
          Length = 219

 Score =  107 bits (268), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 47/214 (21%), Positives = 78/214 (36%), Gaps = 34/214 (15%)

Query: 5   LGLSMFIMTTISGCGLAS------REKKKVFLHKSNDTDIVNKRFGSS------------ 46
             +++  +  +S C   +      R  +   +  +     V    G S            
Sbjct: 8   FAVALSGVLVLSACDTVTDPNNPNRNAQTAAIVGAGLGAAVGIARGDSAGERNRGAVLGA 67

Query: 47  -------------LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV-SEVFLEKKF 92
                        LD+ E E + Q+  +   +   G  +   +P  + F      L    
Sbjct: 68  LVGAGLGAGVGTLLDRQEAELRQQM-GSNAQIVNTGSQLIVTLPQDILFDTGSAALSGGL 126

Query: 93  LPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFI 152
              L  +A  +N FP++ + +  HTDS GT   N  +S  RA  + S LI +   S   I
Sbjct: 127 RSDLNALAASMNNFPNSTVNVIGHTDSDGTAAFNQDLSARRAQAVSSVLI-QSGVSANRI 185

Query: 153 SVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRG 186
              G     PI +N    G++ N+R+EI I P G
Sbjct: 186 RSIGRGEDAPIASNLNAEGKRQNRRVEITITPNG 219


>gi|83814826|ref|YP_444492.1| OmpA family protein [Salinibacter ruber DSM 13855]
 gi|83756220|gb|ABC44333.1| OmpA family protein [Salinibacter ruber DSM 13855]
          Length = 230

 Score =  107 bits (268), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 40/147 (27%), Positives = 69/147 (46%), Gaps = 4/147 (2%)

Query: 45  SSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATIL 103
           + +D   +E   +L +    V R+G+ I       + F      L  +    L   A  +
Sbjct: 75  NRMDTKAEELDEELDN--ADVERVGEGIKVTFDSGILFDFDSSTLRAEARQNLTEFAESM 132

Query: 104 NKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPI 163
             F  T I +  HTD+ G+ + N  +S  RA+    +L+ RGV  +R  SV G     P+
Sbjct: 133 QGFEDTKILVVGHTDAQGSEEYNQKLSDRRAESATRHLVDRGVDPSRLTSV-GRGETEPV 191

Query: 164 DTNDTKVGRQNNQRIEIQIFPRGNIKK 190
            +N+T+ GRQ N+R+E+ I+     ++
Sbjct: 192 ASNETEEGRQQNRRVEVAIYANEEYRE 218


>gi|317402399|gb|EFV82971.1| OmpA family protein [Achromobacter xylosoxidans C54]
          Length = 232

 Score =  107 bits (268), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 46/206 (22%), Positives = 75/206 (36%), Gaps = 25/206 (12%)

Query: 1   MIKELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKR------------------ 42
           M+K + +       ++GC    +    V                                
Sbjct: 23  MLKRIAVVAASGALLAGCATQQQTNTAVGTGAGAAVGAGIGALIGHGTGAAVGAGIGAVA 82

Query: 43  ---FGSSLDKAEDEFQMQLQDT-GIVVSRIGDM-ITCYIPVHV-SFVSEVFLEKKFLPML 96
               G +    +D+ Q     + GI V  + D  +   IP +V     +  L+   LP+L
Sbjct: 83  GGLIGYNWKVVKDDVQRSGATSLGIDVVEMPDGSLKVNIPSNVSFDTDKTDLKPALLPVL 142

Query: 97  QLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRG 156
             +A  LN+ P     +  HTDS G L +N  +S  RA  +    + R   +   +SV G
Sbjct: 143 DSVARSLNQHPELRAKVVGHTDSTGALAHNQTLSVNRARSVTD-YLSRQGVAATRLSVEG 201

Query: 157 FAYKYPIDTNDTKVGRQNNQRIEIQI 182
                PI  N T  GR  N+R+E+ +
Sbjct: 202 RGPSDPIGDNATAEGRALNRRVEVYL 227


>gi|325279362|ref|YP_004251904.1| OmpA/MotB domain-containing protein [Odoribacter splanchnicus DSM
           20712]
 gi|324311171|gb|ADY31724.1| OmpA/MotB domain protein [Odoribacter splanchnicus DSM 20712]
          Length = 235

 Score =  107 bits (268), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 43/156 (27%), Positives = 71/156 (45%), Gaps = 6/156 (3%)

Query: 39  VNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDM---ITCYIPVHVSF-VSEVFLEKKFLP 94
                G  +DK + E    ++   +   +  +    I       + F  ++  L      
Sbjct: 74  TGALIGRRMDKQKKEL-EAIEGAKVESVQDVNNLQAIKVTFDNGILFATNKSELSPASRE 132

Query: 95  MLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISV 154
            L   AT L   P T + I  HTD+ GT   N  IS+ERAD + ++L+ +G+S +R ++ 
Sbjct: 133 ALTKFATSLKNSPDTDVTIYGHTDNTGTRAVNERISKERADAVANFLVGQGISRSR-LTT 191

Query: 155 RGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGNIKK 190
            G A+  P+  N T  GR  N+R+EI I    ++ K
Sbjct: 192 EGLAFDQPVADNSTAEGRAQNRRVEIYITANADMIK 227


>gi|300870134|ref|YP_003785005.1| OmpA family outer membrane protein [Brachyspira pilosicoli 95/1000]
 gi|300687833|gb|ADK30504.1| outer membrane protein, OmpA family [Brachyspira pilosicoli
           95/1000]
          Length = 401

 Score =  107 bits (268), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 31/143 (21%), Positives = 63/143 (44%), Gaps = 3/143 (2%)

Query: 41  KRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIA 100
                  ++   +      +  +VV  + + +   +   +       L++     +  I 
Sbjct: 258 STITEEENELNRKKIEDNLNDDVVVDTVPEGLVIRLGEILFDTDSYTLKEDAKDTVDNII 317

Query: 101 TILNK-FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAY 159
             + + +P   I ++ HTD+ G    N  +S++RA  +  Y++ +    +  +S RGF  
Sbjct: 318 NAIKQTYPDREIIVEGHTDNTGEANYNQALSEKRAKTVADYILPK--LEHDKLSYRGFGD 375

Query: 160 KYPIDTNDTKVGRQNNQRIEIQI 182
           K PI +ND   GRQ N+R++I I
Sbjct: 376 KEPIASNDNPDGRQKNRRVDIII 398


>gi|237742388|ref|ZP_04572869.1| outer membrane porin F [Fusobacterium sp. 4_1_13]
 gi|256845716|ref|ZP_05551174.1| type VI secretion system OmpA/MotB [Fusobacterium sp. 3_1_36A2]
 gi|294785038|ref|ZP_06750326.1| outer membrane porin F [Fusobacterium sp. 3_1_27]
 gi|229430036|gb|EEO40248.1| outer membrane porin F [Fusobacterium sp. 4_1_13]
 gi|256719275|gb|EEU32830.1| type VI secretion system OmpA/MotB [Fusobacterium sp. 3_1_36A2]
 gi|294486752|gb|EFG34114.1| outer membrane porin F [Fusobacterium sp. 3_1_27]
          Length = 182

 Score =  107 bits (268), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 50/170 (29%), Positives = 76/170 (44%), Gaps = 6/170 (3%)

Query: 18  CGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIP 77
           C      KK      S +   V     +   K   E  +   + G+ + R G+ +   +P
Sbjct: 18  CSSTKTTKKTNVGVDSTNKYAVEDTEAN---KKPLEDIIVFNEEGVTIRREGNNLILSMP 74

Query: 78  VHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADV 136
             + F   +  ++ K  P L  +A  L +     I I  +TD IGT   NL +S +RA  
Sbjct: 75  ELILFDFDKYVVKDKIKPSLSTLAKALGENKDIHIKIDGYTDFIGTEAYNLDLSVKRARA 134

Query: 137 IKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRG 186
           IK +LI +G   +  IS+ G+  + P DTN T  GR  N+R+E  I  RG
Sbjct: 135 IKDFLISKGAIGSN-ISIEGYGEQNPADTNQTAAGRSRNRRVEF-IISRG 182


>gi|223936109|ref|ZP_03628023.1| OmpA/MotB domain protein [bacterium Ellin514]
 gi|223895331|gb|EEF61778.1| OmpA/MotB domain protein [bacterium Ellin514]
          Length = 280

 Score =  107 bits (268), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 42/168 (25%), Positives = 71/168 (42%), Gaps = 4/168 (2%)

Query: 21  ASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHV 80
            ++E+      +  D     ++ G +    EDE +  L+   + +S +   +T  I   V
Sbjct: 78  KNQEQISELQAQVADLQKEKEKVGQTAKGLEDEMRSDLESRDVTISNLKGKLTVNILDRV 137

Query: 81  SFV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTL---KNNLLISQERADV 136
            F   E  ++     +L+ IATIL   P   I +  HTD++       +N  +S  RA  
Sbjct: 138 MFDSGEAAVKPDGESVLRKIATILAGHPELKIQVIGHTDNVPIRNRFASNWELSAARAIA 197

Query: 137 IKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
              ++ ++     R +   G+    PI  N T  GR  N+RI I I P
Sbjct: 198 AVHFITEKAGVDPRRVGAAGYGEYRPIADNSTAEGRARNRRIAITILP 245


>gi|254228602|ref|ZP_04922026.1| Flagellar motor protein [Vibrio sp. Ex25]
 gi|262395023|ref|YP_003286877.1| Flagellar motor rotation protein MotB [Vibrio sp. Ex25]
 gi|151938781|gb|EDN57615.1| Flagellar motor protein [Vibrio sp. Ex25]
 gi|262338617|gb|ACY52412.1| Flagellar motor rotation protein MotB [Vibrio sp. Ex25]
          Length = 315

 Score =  107 bits (268), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 34/169 (20%), Positives = 75/169 (44%), Gaps = 6/169 (3%)

Query: 20  LASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVH 79
                +      +   ++ +++   + ++  +   + +++   I V  +G  I   +   
Sbjct: 134 STQNNQSAEADMQQQQSEEMSQEMETLMESIKKALEREIEQGAIEVENLGQQIVIRMREK 193

Query: 80  VSFV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGT----LKNNLLISQERA 134
            +F     FL+ KF P+++ IA ++   P   + +  HTD+        ++N  +S +RA
Sbjct: 194 GAFPEGSAFLQPKFRPLVRQIAELVKDVPGI-VRVSGHTDNRPLDSELYRSNWDLSSQRA 252

Query: 135 DVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
             +   + +    S++ + VRG A   P+  ND+   R  N+R+EI I 
Sbjct: 253 VSVAQEMEKVRGFSHQRLRVRGMADTEPLLPNDSDENRALNRRVEISIM 301


>gi|91204077|emb|CAJ71730.1| similar to flagellar motor protein B [Candidatus Kuenenia
           stuttgartiensis]
          Length = 215

 Score =  107 bits (268), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 50/214 (23%), Positives = 86/214 (40%), Gaps = 28/214 (13%)

Query: 1   MIKELGLS-------MFIMTTI-SGCG------------LASREKKKVFLHKSNDTDIVN 40
           M+K++GL        MF M  + +GCG              S    +      + T    
Sbjct: 1   MLKKVGLMRGICLLGMFGMFAVGTGCGELKQLRVENQQLSQSLASLQQENANLSATASRY 60

Query: 41  KRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLI 99
           +   + L+ +  + + +L  TG +       ++  +P  + F   +  L ++    L+ I
Sbjct: 61  ESELNRLENSRRDLESKLAGTGAITKIKDGSVSIVLPDSILFDPGQTKLREQSKATLKKI 120

Query: 100 ATILN-KFPSTVIAIQSHTDSIGT------LKNNLLISQERADVIKSYLIQRGVSSNRFI 152
           A IL     + ++ I+ HTDS           +N  +S  RA+ +  YL+     S   +
Sbjct: 121 AGILKTDISNEMVRIEGHTDSDPIQKQKDKYPSNWELSTARANSVLHYLVDECGISPTRV 180

Query: 153 SVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRG 186
            V GF    PI  N TK G+  N+R+E  I   G
Sbjct: 181 YVAGFGQFQPISDNKTKAGKAQNRRVEFVIISGG 214


>gi|162456349|ref|YP_001618716.1| exported OmpA domain-containing protein [Sorangium cellulosum 'So
           ce 56']
 gi|161166931|emb|CAN98236.1| exported OmpA domain protein [Sorangium cellulosum 'So ce 56']
          Length = 610

 Score =  107 bits (268), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 38/169 (22%), Positives = 76/169 (44%), Gaps = 2/169 (1%)

Query: 22  SREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVS 81
           S++  K    +  D D       +   +         ++      R+ +     +     
Sbjct: 433 SKDPAKNGCPRDTDGDTFRDDVDACPREKGFADPDPEKNGCPKAVRVTEKHVVILQQVQF 492

Query: 82  FVSEVFLEKKFLPMLQLIATILNKFPSTV-IAIQSHTDSIGTLKNNLLISQERADVIKSY 140
              +  ++    P+L  +A +L + P  V I IQ HTD+ GT+++N ++SQ RA+ + + 
Sbjct: 493 DTDKATIKPVSDPLLDEVAEVLKEHPEIVLIEIQGHTDNRGTVEHNRILSQNRANSVMA- 551

Query: 141 LIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGNIK 189
            + R    +  ++ +G+  + PID N T+ GRQ N+R++  I  +   K
Sbjct: 552 ALVRRGIDSTRLTAQGYGREQPIDDNATEAGRQRNRRVQFNIIKKAAYK 600


>gi|312890939|ref|ZP_07750468.1| OmpA/MotB domain protein [Mucilaginibacter paludis DSM 18603]
 gi|311296722|gb|EFQ73862.1| OmpA/MotB domain protein [Mucilaginibacter paludis DSM 18603]
          Length = 252

 Score =  107 bits (268), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 45/148 (30%), Positives = 71/148 (47%), Gaps = 4/148 (2%)

Query: 43  FGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV-SEVFLEKKFLPMLQLIAT 101
            G ++DK   E +  +   G  V R G+ I       + F   +  L+      +  ++ 
Sbjct: 99  IGRNMDKQAAEIKNTVP--GAQVVREGEGIIVKFDSGILFDIDKTALKPVAKTNIDQLSA 156

Query: 102 ILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKY 161
            L K P T I I  HTD+ GT  +N+ +S  RA+ +K+Y I  GV ++R ++ +G     
Sbjct: 157 SLKKNPETNILIVGHTDNTGTAAHNMDLSVRRAEAVKAYAIAAGVDASR-LTTQGKGDTE 215

Query: 162 PIDTNDTKVGRQNNQRIEIQIFPRGNIK 189
           PI  N T  GR  N+R+EI I     +K
Sbjct: 216 PIADNTTVDGRTQNRRVEIVIVANDQMK 243


>gi|310814625|ref|YP_003962589.1| OmpA family protein [Ketogulonicigenium vulgare Y25]
 gi|308753360|gb|ADO41289.1| OmpA family protein [Ketogulonicigenium vulgare Y25]
          Length = 227

 Score =  107 bits (268), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 50/184 (27%), Positives = 83/184 (45%), Gaps = 12/184 (6%)

Query: 10  FIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQ--------DT 61
            ++  ++G    S ++ +     +     +    G +LD+ E E     Q          
Sbjct: 45  AVVGALTG--DDSNDRWRNAAIGAAVGGGLGAVGGQALDRQEAELARARQEAELRQQLGG 102

Query: 62  GIVVSRIGDMITCYIPVHVSFVSEVF-LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSI 120
            + +   G  +T  +P  V F +    +  +    L+ +A  LN++P+T I++  HTDS 
Sbjct: 103 NVGIVNNGQNLTVTMPQDVLFGTNSTAVSIQSQTDLRTVAASLNRYPNTSISVIGHTDST 162

Query: 121 GTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEI 180
           G+   N  +S  RA  + S LI  GV+  R  +V G     PI +N T  GRQ N+R+EI
Sbjct: 163 GSASYNQDLSVRRAQAVASVLINGGVAPARVYTV-GRGASQPIASNATPDGRQLNRRVEI 221

Query: 181 QIFP 184
            I P
Sbjct: 222 IITP 225


>gi|86134861|ref|ZP_01053443.1| OmpA family protein [Polaribacter sp. MED152]
 gi|85821724|gb|EAQ42871.1| OmpA family protein [Polaribacter sp. MED152]
          Length = 234

 Score =  107 bits (268), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 43/228 (18%), Positives = 75/228 (32%), Gaps = 43/228 (18%)

Query: 2   IKELG-------LSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKR------------ 42
           +K L        L++ +  T S C        K                           
Sbjct: 1   MKNLTKKIYTVALALSVAFTFSSCEATKNANNKQKGAAIGAAGGAILGAIIGNNVGSGKN 60

Query: 43  ------------------FGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVH---VS 81
                              G  +D+   + + ++   G  V R+ D I      +     
Sbjct: 61  SELGAVIGGVIGGGAGVLIGKRMDEQAKKIETEVP--GAKVERVDDGIVVTFDENSGVYF 118

Query: 82  FVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYL 141
             ++  +  K    L  +A +  +FP T I +  HTD+ G    NL +S++RA  + +YL
Sbjct: 119 DTNKSNINTKSQQTLDRLAKVFLEFPDTKILVVGHTDNTGNADYNLTLSEKRAKSVTNYL 178

Query: 142 IQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGNIK 189
           I     ++       +    P   N T  GR  N+R+ + I P   +K
Sbjct: 179 IS-DGIASPRFQTLWYGEAQPKYDNSTAEGRAKNRRVNVAIVPNEKMK 225


>gi|107023374|ref|YP_621701.1| OmpA/MotB [Burkholderia cenocepacia AU 1054]
 gi|116690456|ref|YP_836079.1| OmpA/MotB domain-containing protein [Burkholderia cenocepacia
           HI2424]
 gi|170733777|ref|YP_001765724.1| OmpA/MotB domain-containing protein [Burkholderia cenocepacia
           MC0-3]
 gi|254247501|ref|ZP_04940822.1| Outer membrane porin F [Burkholderia cenocepacia PC184]
 gi|105893563|gb|ABF76728.1| OmpA/MotB [Burkholderia cenocepacia AU 1054]
 gi|116648545|gb|ABK09186.1| OmpA/MotB domain protein [Burkholderia cenocepacia HI2424]
 gi|124872277|gb|EAY63993.1| Outer membrane porin F [Burkholderia cenocepacia PC184]
 gi|169817019|gb|ACA91602.1| OmpA/MotB domain protein [Burkholderia cenocepacia MC0-3]
          Length = 215

 Score =  107 bits (268), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 42/207 (20%), Positives = 74/207 (35%), Gaps = 27/207 (13%)

Query: 2   IK---ELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSL----------- 47
           +K    L +       ++GC         V                              
Sbjct: 3   MKIATRLSVFALAGALLAGCATQQGNNTAVGTGTGAALGAGIGALAGGGKGAAIGAGVGA 62

Query: 48  ----------DKAEDEFQMQLQDTGIVVSRIGDM-ITCYIPVHVSFVSE-VFLEKKFLPM 95
                        +++       TG  V+   D  +   +P  V+F +    +   F P+
Sbjct: 63  LVGGVTGYNWQAIKNKLAPSAAQTGTQVTEQPDGSLKLNVPSSVTFATNQYAITPAFTPL 122

Query: 96  LQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVR 155
           L  +AT LN+ P    +I  +TDS G+ + N  +SQ RA  + +  + +   +   +S +
Sbjct: 123 LNDLATTLNQNPQVTASIVGYTDSTGSQQLNQTLSQNRAQSVVN-ALVQRGVNGGRLSAQ 181

Query: 156 GFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           G     PI  N T+ GR  N+R+EI +
Sbjct: 182 GMGPSNPIADNATEAGRAQNRRVEIYL 208


>gi|71909465|ref|YP_287052.1| surface antigen protein [Dechloromonas aromatica RCB]
 gi|71849086|gb|AAZ48582.1| OmpA/MotB:Rickettsia 17 kDa surface antigen [Dechloromonas
           aromatica RCB]
          Length = 221

 Score =  107 bits (268), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 44/174 (25%), Positives = 73/174 (41%), Gaps = 3/174 (1%)

Query: 11  IMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGD 70
           ++ T++  G   R         +         +   + + +   +   Q TGI V++  D
Sbjct: 44  LLGTVTAGGNKGRSAATGAAVGAALGAGGGYLWSRHMQEQKAAMEQATQGTGIGVTQTAD 103

Query: 71  M-ITCYIPVHVSFVSE-VFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLL 128
             +   IP  +SF S    +      +L   A+ L + P T + I  HTD++G    N  
Sbjct: 104 NQLKLDIPSDLSFDSGHYDINPALHAVLDRFASTLIQNPVTHVRIVGHTDNVGGDAINNP 163

Query: 129 ISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           +S  RA   + YL  R   ++  IS+ G     PI  N T  GR  N+R+EI +
Sbjct: 164 LSVNRAAATRDYLASR-GVASNRISIDGRGSHEPIADNSTPAGRAKNRRVEIFV 216


>gi|323495111|ref|ZP_08100198.1| flagellar motor protein MotB [Vibrio brasiliensis LMG 20546]
 gi|323310662|gb|EGA63839.1| flagellar motor protein MotB [Vibrio brasiliensis LMG 20546]
          Length = 314

 Score =  107 bits (268), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 36/175 (20%), Positives = 78/175 (44%), Gaps = 6/175 (3%)

Query: 20  LASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVH 79
                +     ++   +  +++   + ++  +   + +++   I V  +G  I   I   
Sbjct: 133 STQNNQNSESDNEQQQSAEMSQELETLMESIKKALEREIEQGAIEVENLGQQIDIRIREK 192

Query: 80  VSFV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGT----LKNNLLISQERA 134
            +F     FL+ KF P+++ IA ++   P  V+ +  HTD+        ++N  +S +RA
Sbjct: 193 GAFPEGSAFLQPKFRPLVRQIADLVKDIPG-VVRVSGHTDNQRIDSELYRSNWDLSAQRA 251

Query: 135 DVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGNIK 189
             +   + +    ++  + VRG A   P+  NDT+  R  N+R+EI I     ++
Sbjct: 252 VSVAQEMEKVRGFNHERLRVRGMADTEPLGPNDTEAQRSRNRRVEISIMQGEALQ 306


>gi|257453597|ref|ZP_05618887.1| OmpA/MotB [Enhydrobacter aerosaccus SK60]
 gi|257449055|gb|EEV24008.1| OmpA/MotB [Enhydrobacter aerosaccus SK60]
          Length = 385

 Score =  107 bits (268), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 40/184 (21%), Positives = 75/184 (40%), Gaps = 6/184 (3%)

Query: 6   GLSMFIMTTISGC----GLASREKKKVFLHKSNDTDIVNKRFGSSLDKAED-EFQMQLQD 60
           GL++  +  + G          E   V      D D       +S+DK       + +  
Sbjct: 186 GLALAGLNVVLGGHLAPAAPVVEPTPVEPIVVTDGDDDQDGVPNSVDKCPGTPLNVVVDA 245

Query: 61  TGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSI 120
            G       D              +  ++ ++ P +Q +A  +N++P++  +I+ H    
Sbjct: 246 DGCPREIPIDDALRMELRVFFDNDKTVIKDQYKPEIQKVAEKMNEYPNSTASIEGHASKT 305

Query: 121 GT-LKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIE 179
           G   + N  +S+ RA+ +KS L+ +   + + IS  G+ Y  PI  N+T  GR  N+R+ 
Sbjct: 306 GPSARYNQRLSEARANAVKSMLVNQFGVAPQRISTVGYGYDRPIADNNTAEGRAMNRRVY 365

Query: 180 IQIF 183
             I 
Sbjct: 366 AIIT 369


>gi|53804092|ref|YP_114257.1| OmpA domain-containing protein [Methylococcus capsulatus str. Bath]
 gi|53757853|gb|AAU92144.1| OmpA domain protein [Methylococcus capsulatus str. Bath]
          Length = 179

 Score =  107 bits (267), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 34/192 (17%), Positives = 75/192 (39%), Gaps = 25/192 (13%)

Query: 1   MIKELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQD 60
           M+K+   ++     +SGC + S   + V                    +  ++ + +++ 
Sbjct: 1   MVKKFATTVLTAGVLSGCVMQSTYDRDVG----------------YERQLNEQLRTEVEA 44

Query: 61  TGIVVSRIGDMITCYIPVHVSFV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDS 119
             + + ++ D +   +   + F      + K+    +  I   L    +  I ++ HTD+
Sbjct: 45  DEVKIQQLRDRLRVTMEDELLFPEGGYQISKEGKASIDKIIPTLQSATNHRIEVEGHTDN 104

Query: 120 IG-------TLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGR 172
           +           +N  +S  RA  +  YL  +G+   R  +  G     P+ +N T  G+
Sbjct: 105 VPIGKHLAHRFSSNWELSAGRACEVVKYLQSKGIDPARM-TAAGHGEYQPVASNATAEGK 163

Query: 173 QNNQRIEIQIFP 184
             N+RI+I + P
Sbjct: 164 AQNRRIDIDLVP 175


>gi|146281899|ref|YP_001172052.1| putative outer membrane protein [Pseudomonas stutzeri A1501]
 gi|145570104|gb|ABP79210.1| putative outer membrane protein [Pseudomonas stutzeri A1501]
          Length = 229

 Score =  107 bits (267), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 47/187 (25%), Positives = 79/187 (42%), Gaps = 8/187 (4%)

Query: 4   ELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGI 63
           +    +  M  I+GC     +K            +  K   + LD+ E + +  L D+  
Sbjct: 25  KSASLILCMIVIAGCSSKGEKK-----PSEAAAPVAPKVDYAWLDEYEPKLRDALVDSRF 79

Query: 64  VVSRIGDMITCYIPVHVSFVSEV--FLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIG 121
            V R  +++    PV  SF  +    L    L  +  +A ++ K   T + I  H DS G
Sbjct: 80  EVERRDNVLVVTAPVDSSFNPDRPGMLLPVTLGPITRVAKLVEKDEKTAVVILGHADSTG 139

Query: 122 TLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQ 181
               N  IS+ERA  + +     G   +R + +RG     P   ND+K GR  N+R+E+ 
Sbjct: 140 ADDVNRTISRERASAVAAIFRLSGFKHDR-LRIRGLGSDMPRAANDSKEGRAMNRRVEMV 198

Query: 182 IFPRGNI 188
           + P+  +
Sbjct: 199 LAPQTTM 205


>gi|298372336|ref|ZP_06982326.1| OmpA domain protein [Bacteroidetes oral taxon 274 str. F0058]
 gi|298275240|gb|EFI16791.1| OmpA domain protein [Bacteroidetes oral taxon 274 str. F0058]
          Length = 705

 Score =  107 bits (267), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 36/174 (20%), Positives = 67/174 (38%), Gaps = 2/174 (1%)

Query: 18  CGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCY-I 76
           C    +E + +        D          D+      ++       V +    +    +
Sbjct: 531 CPNTPKEVRGLVDENGCPKDTDGDGIPDYKDECPTIKGVKENKGCPAVKKDVLKVFKQAL 590

Query: 77  PVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADV 136
                   +  ++     +L ++  I+   P   + I  HTDS G    N+ +S +RA  
Sbjct: 591 HGIQFDTGKSTIKSVSYGVLNMVVDIMKNNPDYNLVIAGHTDSQGNDDFNMTLSDKRAAA 650

Query: 137 IKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGNIKK 190
           ++ YLI +GV   R  S+ G+    P+ TN T  GR  N+R+E  +     +K+
Sbjct: 651 VRQYLIDKGVEDARLQSI-GYGETKPVATNKTAKGRAQNRRVEFTVVFEKLVKE 703


>gi|254438169|ref|ZP_05051663.1| OmpA family protein [Octadecabacter antarcticus 307]
 gi|198253615|gb|EDY77929.1| OmpA family protein [Octadecabacter antarcticus 307]
          Length = 220

 Score =  107 bits (267), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 40/221 (18%), Positives = 77/221 (34%), Gaps = 38/221 (17%)

Query: 1   MIK----ELGLSMFIMTTISGCGLA--SREKKKVFLHKSNDTDIVNKRFG---------- 44
           M+        +++  +  +S C          +     +     +    G          
Sbjct: 1   MMTLSKMSFAVALSGVLVLSACETVTDPNNPNRNAQTAAIVGAGLGAAIGIARGDDAGER 60

Query: 45  -------------------SSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV-S 84
                              + LD+ E E + ++  +   +   G  +   +P  + F   
Sbjct: 61  NRGAIVGALIGAGVGGGLGTLLDRQEAELRQEM-GSSAQIVNTGSQLIVTLPQDILFDTG 119

Query: 85  EVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQR 144
              L       L  +A  +N+FP++ + +  HTD  G+   N  +S  RA  + + LI +
Sbjct: 120 SSALTGGLRNDLNTLAGSMNRFPNSTVNVIGHTDWDGSAAFNQDLSARRAQAVSAVLI-Q 178

Query: 145 GVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPR 185
              +   I   G     PI TN  + G++ N+R+EI I P 
Sbjct: 179 SGVAPNRIRSIGRGEDAPIATNLNEEGKRQNRRVEITITPN 219


>gi|197105040|ref|YP_002130417.1| outer membrane protein [Phenylobacterium zucineum HLK1]
 gi|196478460|gb|ACG77988.1| outer membrane protein [Phenylobacterium zucineum HLK1]
          Length = 190

 Score =  107 bits (267), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 37/181 (20%), Positives = 71/181 (39%), Gaps = 10/181 (5%)

Query: 5   LGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIV 64
            G+ +     +SGC      + +V +  +  T +           A +          + 
Sbjct: 19  TGVLLLAGVAVSGCASHRFVRDQVAVVDTRVTGVEG--------TAGEALARANAAHKLA 70

Query: 65  VSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATILN-KFPSTVIAIQSHTDSIGTL 123
             +    +          V    L  +    L  +A  L  +  +  + IQ HTDS G  
Sbjct: 71  EGKFLYQVVLSDDSVKFPVDRHALSPEAEARLNELAERLKSENRNVYLEIQGHTDSTGPE 130

Query: 124 KNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
             N  + + RA+ ++ +L + GV+ NR  ++  +  + P+ +NDT  GR  N+R+EI + 
Sbjct: 131 AYNDQLGEARAEAVRKHLAKAGVALNRMGTIS-YGEEAPVASNDTAEGRAQNRRVEIIVL 189

Query: 184 P 184
            
Sbjct: 190 S 190


>gi|167561951|ref|ZP_02354867.1| ompA family protein [Burkholderia oklahomensis EO147]
 gi|167569201|ref|ZP_02362075.1| ompA family protein [Burkholderia oklahomensis C6786]
          Length = 215

 Score =  107 bits (267), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 45/202 (22%), Positives = 79/202 (39%), Gaps = 24/202 (11%)

Query: 4   ELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSL---------------- 47
            L +       ++GC         V                                   
Sbjct: 8   RLSVFALAGALLAGCATPQGTNTAVGTGTGAALGAGIGALAGGGKGAAIGAGVGALVGGV 67

Query: 48  -----DKAEDEFQMQLQDTGIVVSRIGDM-ITCYIPVHVSF-VSEVFLEKKFLPMLQLIA 100
                   +++     Q TG  V+   D  +   +P  V+F   +  +   F P+L  +A
Sbjct: 68  TGYNWQAIKNKLAPSAQQTGTQVTEQPDGSLKLNVPSSVTFATDQYAVTPAFTPLLNDLA 127

Query: 101 TILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYK 160
           + LN+ P    ++  +TDS G+  +N  +SQ RA  + + + QRGV+++R +S +G    
Sbjct: 128 STLNQNPQITASVVGYTDSTGSAAHNQTLSQNRAQSVVNAMSQRGVAASR-LSAQGMGAS 186

Query: 161 YPIDTNDTKVGRQNNQRIEIQI 182
            PI  N T+ GR  N+R+EI +
Sbjct: 187 NPIADNATEAGRAQNRRVEIYL 208


>gi|260776526|ref|ZP_05885421.1| Flagellar motor rotation protein MotB [Vibrio coralliilyticus ATCC
           BAA-450]
 gi|260607749|gb|EEX34014.1| Flagellar motor rotation protein MotB [Vibrio coralliilyticus ATCC
           BAA-450]
          Length = 300

 Score =  107 bits (267), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 36/169 (21%), Positives = 75/169 (44%), Gaps = 6/169 (3%)

Query: 20  LASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVH 79
                +      +   +  +++   + ++  +   + +++   I V  +G  I   I   
Sbjct: 116 STQDSQNSESDSEQQQSAELSQELETLMESIKKALEREIEQGAIEVENLGQQIDIRIREK 175

Query: 80  VSFV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGT----LKNNLLISQERA 134
            +F     FL+ KF P+++ IA ++   P   + +  HTD+        ++N  +S +RA
Sbjct: 176 GAFPEGSAFLQPKFRPLVRQIAELVKDIPGI-VRVSGHTDNQRIDSELYRSNWDLSAQRA 234

Query: 135 DVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
             +   + +    S++ + VRG A   P+  NDT+  R  N+R+EI I 
Sbjct: 235 VSVAQEMEKVRDFSHQRLQVRGMADTQPLGPNDTEAQRSRNRRVEISIM 283


>gi|260773298|ref|ZP_05882214.1| Flagellar motor rotation protein MotB [Vibrio metschnikovii CIP
           69.14]
 gi|260612437|gb|EEX37640.1| Flagellar motor rotation protein MotB [Vibrio metschnikovii CIP
           69.14]
          Length = 314

 Score =  107 bits (267), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 35/170 (20%), Positives = 74/170 (43%), Gaps = 6/170 (3%)

Query: 19  GLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPV 78
                +  +    +   ++ +++     L+  +     +++   + V  +G  I   I  
Sbjct: 132 STEDSQDNEDAEQEQEQSEALSEEMEIVLENIKKALDREIEQGAVEVENLGQQILIRIRE 191

Query: 79  HVSFV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSI----GTLKNNLLISQER 133
             +F     FL+ +F P+++ IA ++   P   + +  HTD+        ++N  +S +R
Sbjct: 192 RGAFPEGSAFLQPQFRPLVRQIAELVKDVPGI-VQVTGHTDNQRLDSELYRSNWDLSAQR 250

Query: 134 ADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
           A  +   + +     +R + VRG A   P+  NDT+  R  N+R+EI I 
Sbjct: 251 AVSVAQEMERVTGFDHRRLEVRGLADTAPVGPNDTEAQRSRNRRVEIGIM 300


>gi|167580182|ref|ZP_02373056.1| ompA family protein [Burkholderia thailandensis TXDOH]
 gi|257139912|ref|ZP_05588174.1| ompA family protein [Burkholderia thailandensis E264]
          Length = 215

 Score =  107 bits (267), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 41/202 (20%), Positives = 73/202 (36%), Gaps = 24/202 (11%)

Query: 4   ELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSL---------------- 47
            L +       ++GC         V                                   
Sbjct: 8   RLSVFALAGALLAGCATQQGTNTAVGTGTGAALGAGIGALAGGGKGAAIGAGVGALVGGV 67

Query: 48  -----DKAEDEFQMQLQDTGIVVSRIGDM-ITCYIPVHVSF-VSEVFLEKKFLPMLQLIA 100
                   +++     Q TG  V+   D  +   +P  V+F   +  +   F P+L  +A
Sbjct: 68  TGYNWQAIKNKLAPSAQQTGTQVTEQPDGSLKLNVPSSVTFATDQYAVTPAFTPLLNDLA 127

Query: 101 TILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYK 160
           T LN+ P    ++  +TDS G+  +N  +SQ RA  + +  + +   +   +S +G    
Sbjct: 128 TTLNQNPQITASVVGYTDSTGSAAHNQTLSQNRAQSVVN-ALAQRGVAATRLSAQGMGAS 186

Query: 161 YPIDTNDTKVGRQNNQRIEIQI 182
            PI  N T+ GR  N+R+EI +
Sbjct: 187 NPIADNATEAGRAQNRRVEIYL 208


>gi|296328018|ref|ZP_06870553.1| outer membrane protein OmpF [Fusobacterium nucleatum subsp.
           nucleatum ATCC 23726]
 gi|296154974|gb|EFG95756.1| outer membrane protein OmpF [Fusobacterium nucleatum subsp.
           nucleatum ATCC 23726]
          Length = 182

 Score =  107 bits (267), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 49/170 (28%), Positives = 75/170 (44%), Gaps = 6/170 (3%)

Query: 18  CGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIP 77
           C      KK      S +   V     +   K   E  +   + G+ + R G+ +   +P
Sbjct: 18  CSSTKTTKKTNVGVDSTNKYAVEDTEAN---KKPLEDIIVFNEEGVTIRREGNNLILSMP 74

Query: 78  VHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADV 136
             + F   +  ++    P L  +A  L +     I I  +TD IGT   NL +S +RA  
Sbjct: 75  ELILFDFDKYAVKDGIKPSLSTLAKALGENKDIHIKIDGYTDFIGTEAYNLDLSVKRARA 134

Query: 137 IKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRG 186
           IK +LI +G   +  IS+ G+  + P DTN T  GR  N+R+E  I  RG
Sbjct: 135 IKDFLISKGAIGSN-ISIEGYGEQNPADTNQTAAGRSRNRRVEF-IISRG 182


>gi|295132150|ref|YP_003582826.1| thrombospondin repeat-containing OmpA/MotB family outer
           hypothetical protein [Zunongwangia profunda SM-A87]
 gi|294980165|gb|ADF50630.1| thrombospondin repeat-containing OmpA/MotB family outer membrane
           protein [Zunongwangia profunda SM-A87]
          Length = 470

 Score =  107 bits (267), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 39/173 (22%), Positives = 74/173 (42%), Gaps = 15/173 (8%)

Query: 17  GCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYI 76
           GC     +   V   + +  ++      +   +   E   +L +    V           
Sbjct: 309 GCPYEDTDGDGVIDPEDDCPEVAGTVANNGCPEPTVEVINELNEYSNTV----------- 357

Query: 77  PVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADV 136
              +   ++  +  +    L  I  I+ ++P+TV  I  HTDS+G+ + NL +S+ERA  
Sbjct: 358 ---LFDFNKATIRSESEKALNSIIEIMEEYPNTVFHIGGHTDSVGSDEYNLKLSKERAAS 414

Query: 137 IKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGNIK 189
           ++ +L+         ++  G+    PI TN T+ GRQ N+R+EI +     +K
Sbjct: 415 VRQFLVDG-GIPANRLTSEGYGESRPIATNSTEAGRQENRRVEISLDKDKEMK 466


>gi|120613225|ref|YP_972903.1| OmpA/MotB domain-containing protein [Acidovorax citrulli AAC00-1]
 gi|120591689|gb|ABM35129.1| OmpA/MotB domain protein [Acidovorax citrulli AAC00-1]
          Length = 296

 Score =  107 bits (267), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 34/151 (22%), Positives = 65/151 (43%), Gaps = 8/151 (5%)

Query: 40  NKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLI 99
                + +   E + +       I   +    +   +   +   ++  L  +  P L  +
Sbjct: 151 AADNAARVRALEAQLRD------IEAQQTERGLLVTLGDVLFAFNKAELSAQAGPRLDKL 204

Query: 100 ATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAY 159
           A  L +FP   + I+ HTDS+G    N  +S+ RA  +    + +   +   I+ RG+  
Sbjct: 205 ANFLRQFPDRKLIIEGHTDSVGGDAYNQSLSERRAQAV-QSALVQRGVAPDRITARGYGK 263

Query: 160 KYPIDTNDTKVGRQNNQRIEIQIF-PRGNIK 189
            YP+  N +  GR  N+R+EI I   +GN++
Sbjct: 264 TYPVADNSSPEGRAMNRRVEIVIADEKGNLR 294


>gi|262172094|ref|ZP_06039772.1| Flagellar motor rotation protein MotB [Vibrio mimicus MB-451]
 gi|261893170|gb|EEY39156.1| Flagellar motor rotation protein MotB [Vibrio mimicus MB-451]
          Length = 279

 Score =  107 bits (267), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 37/173 (21%), Positives = 73/173 (42%), Gaps = 6/173 (3%)

Query: 16  SGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCY 75
           S        +      +      ++++  +  +  +     +++   I V  +G  I   
Sbjct: 89  SAESSTQDNQNTQSEMQQQQAKAMSEQMETVAESIKKALSREIEQGAIEVENLGQQIDIR 148

Query: 76  IPVHVSFV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSI----GTLKNNLLIS 130
           I    +F     FL+ KF P+++ IA ++   P   + +  HTD+        ++N  +S
Sbjct: 149 IREKGAFPEGSAFLQPKFRPLVRQIADLVKDIPG-KVRVTGHTDNQKLDSELYRSNWDLS 207

Query: 131 QERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
            +RA  +   + +     ++ + VRG A   PI  NDT+  R  N+R+EI I 
Sbjct: 208 AQRAVSVAQEMEKVKGFDHQRLQVRGMADTQPIGPNDTEAQRALNRRVEISIL 260


>gi|296127617|ref|YP_003634869.1| OmpA/MotB domain protein [Brachyspira murdochii DSM 12563]
 gi|296019433|gb|ADG72670.1| OmpA/MotB domain protein [Brachyspira murdochii DSM 12563]
          Length = 403

 Score =  107 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 31/140 (22%), Positives = 63/140 (45%), Gaps = 4/140 (2%)

Query: 45  SSLDKAEDEFQMQL-QDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATIL 103
              D    + +  L  D  + +  + + +   +   +       L  +    +  I   +
Sbjct: 263 EEEDYNRKKLENDLYDDDNVTIDTVPEGLVVRLGEILFDTDSYTLRPEAKNTIDNIVKAI 322

Query: 104 NK-FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYP 162
            + +P   I ++ HTD+ G  + N  +S++RA  +  Y++      +  +S +G A + P
Sbjct: 323 KETYPDREIIVEGHTDNTGRKEYNQELSEKRAKSVADYILPN--LEHDKLSYKGLADEEP 380

Query: 163 IDTNDTKVGRQNNQRIEIQI 182
           I +NDT  GRQ N+R++I I
Sbjct: 381 IASNDTADGRQKNRRVDIII 400


>gi|206560984|ref|YP_002231749.1| putative OmpA family membrane protein [Burkholderia cenocepacia
           J2315]
 gi|198037026|emb|CAR52947.1| putative OmpA family membrane protein [Burkholderia cenocepacia
           J2315]
          Length = 215

 Score =  107 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 42/207 (20%), Positives = 74/207 (35%), Gaps = 27/207 (13%)

Query: 2   IK---ELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSL----------- 47
           +K    L +       ++GC         V                              
Sbjct: 3   MKIATRLSVFALAGALLAGCATQQGNNTAVGTGTGAALGAGIGALAGGGKGAAIGAGVGA 62

Query: 48  ----------DKAEDEFQMQLQDTGIVVSRIGDM-ITCYIPVHVSFVSE-VFLEKKFLPM 95
                        +++       TG  V+   D  +   +P  V+F +    +   F P+
Sbjct: 63  LVGGVTGYNWQAIKNKLAPSAAQTGTQVTEQPDGSLKLNVPSSVTFATNQYAITPAFTPL 122

Query: 96  LQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVR 155
           L  +AT LN+ P    +I  +TDS G+ + N  +SQ RA  + +  + +   +   +S +
Sbjct: 123 LNDLATTLNQNPQVTASIVGYTDSTGSAQLNQTLSQNRAQSVVN-ALVQRGVNGGRLSAQ 181

Query: 156 GFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           G     PI  N T+ GR  N+R+EI +
Sbjct: 182 GMGASNPIADNATEAGRAQNRRVEIYL 208


>gi|167909987|ref|ZP_02497078.1| ompA family protein [Burkholderia pseudomallei 112]
 gi|254199385|ref|ZP_04905751.1| OmpA family protein [Burkholderia mallei FMH]
 gi|254205699|ref|ZP_04912051.1| OmpA family protein [Burkholderia mallei JHU]
 gi|147748981|gb|EDK56055.1| OmpA family protein [Burkholderia mallei FMH]
 gi|147753142|gb|EDK60207.1| OmpA family protein [Burkholderia mallei JHU]
          Length = 207

 Score =  107 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 40/197 (20%), Positives = 71/197 (36%), Gaps = 24/197 (12%)

Query: 9   MFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSL--------------------- 47
                 ++GC         V                                        
Sbjct: 5   ALAGALLAGCATQQGTNTAVGTGTGAALGAGIGALAGGGKGAAIGAGVGALVGGVTGYNW 64

Query: 48  DKAEDEFQMQLQDTGIVVSRIGDM-ITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNK 105
              +++     Q TG  V+   D  +   +P  V+F   +  +   F P+L  +AT LN+
Sbjct: 65  QAIKNKLAPSAQQTGTQVTEQPDGSLKLNVPSSVTFATDQYAITPAFTPLLNDLATTLNQ 124

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
            P    ++  +TDS G+  +N  +SQ RA  + +  + +   +   +S +G     PI  
Sbjct: 125 NPQITASVVGYTDSTGSAAHNQTLSQNRAQSVVN-ALAQRGVAANRLSAQGMGASNPIAD 183

Query: 166 NDTKVGRQNNQRIEIQI 182
           N T+ GR  N+R+EI +
Sbjct: 184 NATEAGRAQNRRVEIYL 200


>gi|28897464|ref|NP_797069.1| flagellar motor protein MotB [Vibrio parahaemolyticus RIMD 2210633]
 gi|153840267|ref|ZP_01992934.1| flagellar motor protein [Vibrio parahaemolyticus AQ3810]
 gi|260876424|ref|ZP_05888779.1| flagellar motor protein MotB [Vibrio parahaemolyticus AN-5034]
 gi|28805676|dbj|BAC58953.1| sodium-driven polar flagellar protein MotB [Vibrio parahaemolyticus
           RIMD 2210633]
 gi|149746069|gb|EDM57199.1| flagellar motor protein [Vibrio parahaemolyticus AQ3810]
 gi|308092849|gb|EFO42544.1| flagellar motor protein MotB [Vibrio parahaemolyticus AN-5034]
 gi|328472526|gb|EGF43389.1| flagellar motor protein MotB [Vibrio parahaemolyticus 10329]
          Length = 315

 Score =  107 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 35/169 (20%), Positives = 75/169 (44%), Gaps = 6/169 (3%)

Query: 20  LASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVH 79
                +      +   ++ +++   + ++  +   + +++   I V  +G  I   +   
Sbjct: 134 STQSNQSAESDMQQQQSEEMSQEMETLMESIKKALEREIEQGAIEVENLGQQIVIRMREK 193

Query: 80  VSFV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSI----GTLKNNLLISQERA 134
            +F     FL+ KF P+++ IA ++   P   + I  HTD+        ++N  +S +RA
Sbjct: 194 GAFPEGSAFLQPKFRPLVRQIAELVKDVPGI-VRISGHTDNQRLDSELYRSNWDLSSQRA 252

Query: 135 DVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
             +   + +    S++ + VRG A   P+  ND+   R  N+R+EI I 
Sbjct: 253 VSVAQEMEKVRGFSHQRLRVRGMADTEPLVPNDSDENRALNRRVEISIM 301


>gi|332886461|gb|EGK06705.1| hypothetical protein HMPREF9456_00579 [Dysgonomonas mossii DSM
           22836]
          Length = 224

 Score =  107 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 44/212 (20%), Positives = 76/212 (35%), Gaps = 29/212 (13%)

Query: 6   GLSMFIMTTISGCGLASREKKKVFLHKSNDTD--------------------------IV 39
            + +     +S CG ++  K       +                                
Sbjct: 9   AIVLSCALLLSSCGASNTVKGGGIGAGAGGALGAGIGAIIGGGKGAAWGAGIGAVVGGSA 68

Query: 40  NKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQ-L 98
               G+ +DK + E   Q+    +     G  I       + F +               
Sbjct: 69  GAIIGNKMDKQKKEL-EQINGAQVESINDGQAIKVTFESGILFATNSSTLSSASQSALSN 127

Query: 99  IATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFA 158
            A  LN  P T + I  HTD+ G+   N  +S++RA  + ++L  +GVS +R +S +GF 
Sbjct: 128 FAASLNNNPDTDVQIYGHTDNTGSDAINNPLSEKRAQAVYNFLQTKGVSGSRMVS-QGFG 186

Query: 159 YKYPIDTNDTKVGRQNNQRIEIQIFPRGNIKK 190
              P+  N +  GR  N+R+E+ I P   + K
Sbjct: 187 STQPVADNSSVAGRAQNRRVEVYILPNEKMLK 218


>gi|78067236|ref|YP_370005.1| OmpA/MotB family protein [Burkholderia sp. 383]
 gi|77967981|gb|ABB09361.1| OmpA/MotB family protein [Burkholderia sp. 383]
          Length = 214

 Score =  107 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 42/207 (20%), Positives = 74/207 (35%), Gaps = 27/207 (13%)

Query: 2   IK---ELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSL----------- 47
           +K    L +       ++GC         V                              
Sbjct: 3   MKIATRLSVFALAGALLAGCATQQGNNTAVGTGTGAALGAGIGALAGGGKGAAIGAGVGA 62

Query: 48  ----------DKAEDEFQMQLQDTGIVVSRIGDM-ITCYIPVHVSFVSE-VFLEKKFLPM 95
                        +++       TG  V+   D  +   +P  V+F +    +   F P+
Sbjct: 63  LVGGVTGYNWQAIKNKLAPSAAQTGTQVTEQPDGSLKLNVPSSVTFATNQYAITPAFQPL 122

Query: 96  LQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVR 155
           L  +AT LN+ P    +I  +TDS G+ + N  +SQ RA  + +  + +   +   +S +
Sbjct: 123 LNDLATTLNQNPQVTASIVGYTDSTGSAQLNQTLSQNRAQSVVN-ALAQRGVNGGRLSAQ 181

Query: 156 GFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           G     PI  N T+ GR  N+R+EI +
Sbjct: 182 GMGASNPIADNATEAGRAQNRRVEIYL 208


>gi|311067881|ref|YP_003972804.1| flagellar motor protein MotB [Bacillus atrophaeus 1942]
 gi|310868398|gb|ADP31873.1| flagellar motor protein MotB [Bacillus atrophaeus 1942]
          Length = 262

 Score =  107 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 35/159 (22%), Positives = 68/159 (42%), Gaps = 5/159 (3%)

Query: 33  SNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV-SEVFLEKK 91
           + D     +   +   + +   + +  +  +      + +   I   + F   +  + ++
Sbjct: 96  AADKTADQEELENVEKQVKQFIKDKKLENQLETKLTDEGLLITIKDSIFFDSGKATIREQ 155

Query: 92  FLPMLQLIATILNKFPSTVIAIQSHTDSIG----TLKNNLLISQERADVIKSYLIQRGVS 147
            +P+ + I+ +L   P   I I  HTD++       ++N  +S  RA      LI+    
Sbjct: 156 DIPLAEEISDLLVLNPPRNIIISGHTDNMPIKNSQFQSNWHLSVMRAVNFMGLLIENPKL 215

Query: 148 SNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRG 186
             +  S +GF    P+ TNDT  GR  N+R+E+ I PRG
Sbjct: 216 DAKVFSAKGFGEYKPVATNDTAEGRSKNRRVEVLILPRG 254


>gi|114769969|ref|ZP_01447579.1| OmpA domain protein [alpha proteobacterium HTCC2255]
 gi|114549674|gb|EAU52556.1| OmpA domain protein [alpha proteobacterium HTCC2255]
          Length = 210

 Score =  107 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 46/192 (23%), Positives = 81/192 (42%), Gaps = 23/192 (11%)

Query: 15  ISGCGLASREKKKVFLHKSNDTDIVN---------------------KRFGSSLDKAEDE 53
           +S C       K+  +  +    +                          G+ LD  E+E
Sbjct: 1   MSACTDNPYNAKQGAIIGATAGIMSGFLTGDDSNGTIKRAIAGGALGAAIGNELDVQEEE 60

Query: 54  FQMQLQDTGIVVSRIGDMITCYIPVHVSFV-SEVFLEKKFLPMLQLIATILNKFPSTVIA 112
            +  L+ +G ++   G+ +   +P  ++F      +       L  ++  LNK+P T + 
Sbjct: 61  LRKNLEGSGALIKNTGNQLIVTLPEAITFDIDSSEVRYSLEDTLIRLSKSLNKYPKTNVE 120

Query: 113 IQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGR 172
           I  HTD++G    N  +S  RA+ + S L Q  VS +R I   G     P+ +N++  GR
Sbjct: 121 IIGHTDNVGGQDYNQKLSTRRAESVSSILAQNDVSRSR-IKAYGRGEIEPMMSNNSSKGR 179

Query: 173 QNNQRIEIQIFP 184
            +N+R+EI I P
Sbjct: 180 ASNRRVEIMITP 191


>gi|313203319|ref|YP_004041976.1| ompa/motb domain protein [Paludibacter propionicigenes WB4]
 gi|312442635|gb|ADQ78991.1| OmpA/MotB domain protein [Paludibacter propionicigenes WB4]
          Length = 817

 Score =  107 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 37/167 (22%), Positives = 72/167 (43%), Gaps = 2/167 (1%)

Query: 18  CGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCY-I 76
           C     E +          D         LDK      +   +    + +    +    +
Sbjct: 645 CPNTPIEARGKVDQNGCPRDTDGDGIPDYLDKCPTIAGVAENEGCPAIKKEVKTLFKKAL 704

Query: 77  PVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADV 136
                   +  ++ K  P+L  IA ++   P+ +I ++ HTD++G  K N ++SQ+RA+ 
Sbjct: 705 QGIQFETGKDKIKPKSYPILNQIAAVMTANPTYLIEVRGHTDNVGDAKLNQVLSQKRAES 764

Query: 137 IKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
           ++ YLI +    ++ ++  G+    P+ TN T  GR  N+R+E +I 
Sbjct: 765 VRKYLIGK-GIDSKRMTANGYGDTLPVSTNSTPAGRTLNRRVEFEIT 810


>gi|254787924|ref|YP_003075353.1| OmpA/MotB domain-containing protein [Teredinibacter turnerae T7901]
 gi|237683974|gb|ACR11238.1| OmpA/MotB domain protein [Teredinibacter turnerae T7901]
          Length = 304

 Score =  107 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 31/156 (19%), Positives = 75/156 (48%), Gaps = 3/156 (1%)

Query: 32  KSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKK 91
            +     +     +S+++   +   +L+   +        +   +   +    E  ++  
Sbjct: 142 AAEQRAEMAVARANSMEEKASQMASKLES--VTTKLDKRGLVITMGDILFATDESEVKPG 199

Query: 92  FLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRF 151
            +  L+ ++ +L ++P   I ++  TDS G    N  +S+ RA+ +   L+  G++ +R 
Sbjct: 200 AVRTLEKVSDLLAEYPDREILVEGFTDSTGAADYNKNLSERRAEAVVKQLVDNGLAEDR- 258

Query: 152 ISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGN 187
           +S +G+  +YP+ +NDT  GRQ N+R+E+ +  + +
Sbjct: 259 LSAKGYGEEYPVASNDTAAGRQQNRRVELVVANKDD 294


>gi|153003419|ref|YP_001377744.1| OmpA/MotB domain-containing protein [Anaeromyxobacter sp. Fw109-5]
 gi|152026992|gb|ABS24760.1| OmpA/MotB domain protein [Anaeromyxobacter sp. Fw109-5]
          Length = 205

 Score =  107 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 47/198 (23%), Positives = 77/198 (38%), Gaps = 27/198 (13%)

Query: 6   GLSMFIMTTISGCGLASR--------------------EKKKVFLHKSNDTDIVNKRFGS 45
            +++  + T+ GCG A +                      KK  L  +    +     G 
Sbjct: 8   VIALATLVTLIGCGTAGKRTAIGGGAGAALGAGIGALAGGKKGALIGAGVGALAGGSVGL 67

Query: 46  SLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVS-EVFLEKKFLPMLQLIATILN 104
            LDK   E +           R  + I   +   + F +    L+ + +  L  +  IL 
Sbjct: 68  YLDKQHKELEKV-----AETKRTENGILVNMKNDILFDTNSADLKGEAVTQLTQVGDILA 122

Query: 105 KFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPID 164
           K+    I I+ HTDS G+   N  +S++RAD +   ++         I+V G     PI 
Sbjct: 123 KYADDRIRIEGHTDSSGSDSLNEALSRKRADSV-RTVLVSRGVREEQITVVGNGETKPIA 181

Query: 165 TNDTKVGRQNNQRIEIQI 182
            N TK GR  N+R+E+ I
Sbjct: 182 DNATKEGRAKNRRVELHI 199


>gi|260438796|ref|ZP_05792612.1| putative chemotaxis protein MotB [Butyrivibrio crossotus DSM 2876]
 gi|292808785|gb|EFF67990.1| putative chemotaxis protein MotB [Butyrivibrio crossotus DSM 2876]
          Length = 265

 Score =  107 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 39/171 (22%), Positives = 66/171 (38%), Gaps = 6/171 (3%)

Query: 17  GCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYI 76
           G      +K ++   +        K      DK E+      Q   I V      +   +
Sbjct: 90  GASDDDSDKSEIDKAQDLIGKEELKDSEQMGDKIENLLDKMGQSNNIEVQVTQHYVCLNM 149

Query: 77  PVHVSFVS-EVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNL----LISQ 131
              + F S    L      +L  +A IL  +   +I I+ HTD++    +      ++S 
Sbjct: 150 KGALLFNSASATLTSDAEKVLSDVAVILKMYEDNLIEIEGHTDNVPINWDIFTSNNVLSD 209

Query: 132 ERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
            RA  +  +L+ +   S   +   G     PI +NDT  GR  N+R+EI+I
Sbjct: 210 YRALAVFDFLVDK-GISPVKLKHSGRGEYNPIASNDTAEGRAQNRRVEIKI 259


>gi|153835783|ref|ZP_01988450.1| PomB [Vibrio harveyi HY01]
 gi|148867501|gb|EDL66863.1| PomB [Vibrio harveyi HY01]
          Length = 314

 Score =  107 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 34/142 (23%), Positives = 67/142 (47%), Gaps = 6/142 (4%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV-SEVFLEKKFLPMLQLIATILNK 105
           ++  +   + +++   I V  +G  I   +    +F     FL+ KF P+++ IA ++  
Sbjct: 160 MESIKKALEREIEQGAIEVENLGQQIVIRMREKGAFPEGSAFLQPKFRPLVRQIAELVKD 219

Query: 106 FPSTVIAIQSHTDSIGT----LKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKY 161
            P   + +  HTD+        ++N  +S +RA  +   + +    S++ + VRG A   
Sbjct: 220 VPGI-VRVSGHTDNQPLDSELYRSNWDLSSQRAVSVAQEMEKVRGFSHQRLRVRGMADTE 278

Query: 162 PIDTNDTKVGRQNNQRIEIQIF 183
           P+  ND+   R  N+R+EI I 
Sbjct: 279 PLAPNDSDANRALNRRVEISIM 300


>gi|320157195|ref|YP_004189574.1| flagellar motor rotation protein MotB [Vibrio vulnificus MO6-24/O]
 gi|319932507|gb|ADV87371.1| flagellar motor rotation protein MotB [Vibrio vulnificus MO6-24/O]
          Length = 300

 Score =  107 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 37/153 (24%), Positives = 74/153 (48%), Gaps = 6/153 (3%)

Query: 36  TDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV-SEVFLEKKFLP 94
           ++ ++K   + ++  +   + +++   I V  +G  I   +    +F     FL+ KF P
Sbjct: 132 SEAMSKEMETLMESIKKALEREIEQGAIEVENLGQQIVIRMREKGAFPEGSAFLQPKFRP 191

Query: 95  MLQLIATILNKFPSTVIAIQSHTDSI----GTLKNNLLISQERADVIKSYLIQRGVSSNR 150
           +++ IA ++   P   + I  HTD+        ++N  +S +RA  +   + +    S++
Sbjct: 192 LVRQIAELVKDVPGI-VRISGHTDNQRLDSELYRSNWDLSAQRAVSVAQEMEKVRGFSHQ 250

Query: 151 FISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
            + VRG A   P+  NDT+  R  N+R+EI I 
Sbjct: 251 RLRVRGMADTDPLVDNDTEENRARNRRVEISIM 283


>gi|83720098|ref|YP_441413.1| ompA family protein [Burkholderia thailandensis E264]
 gi|83653923|gb|ABC37986.1| ompA family protein [Burkholderia thailandensis E264]
          Length = 261

 Score =  107 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 41/202 (20%), Positives = 73/202 (36%), Gaps = 24/202 (11%)

Query: 4   ELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSL---------------- 47
            L +       ++GC         V                                   
Sbjct: 54  RLSVFALAGALLAGCATQQGTNTAVGTGTGAALGAGIGALAGGGKGAAIGAGVGALVGGV 113

Query: 48  -----DKAEDEFQMQLQDTGIVVSRIGDM-ITCYIPVHVSF-VSEVFLEKKFLPMLQLIA 100
                   +++     Q TG  V+   D  +   +P  V+F   +  +   F P+L  +A
Sbjct: 114 TGYNWQAIKNKLAPSAQQTGTQVTEQPDGSLKLNVPSSVTFATDQYAVTPAFTPLLNDLA 173

Query: 101 TILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYK 160
           T LN+ P    ++  +TDS G+  +N  +SQ RA  + +  + +   +   +S +G    
Sbjct: 174 TTLNQNPQITASVVGYTDSTGSAAHNQTLSQNRAQSVVN-ALAQRGVAATRLSAQGMGAS 232

Query: 161 YPIDTNDTKVGRQNNQRIEIQI 182
            PI  N T+ GR  N+R+EI +
Sbjct: 233 NPIADNATEAGRAQNRRVEIYL 254


>gi|156973487|ref|YP_001444394.1| flagellar motor protein MotB [Vibrio harveyi ATCC BAA-1116]
 gi|156525081|gb|ABU70167.1| hypothetical protein VIBHAR_01177 [Vibrio harveyi ATCC BAA-1116]
          Length = 314

 Score =  107 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 34/142 (23%), Positives = 67/142 (47%), Gaps = 6/142 (4%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV-SEVFLEKKFLPMLQLIATILNK 105
           ++  +   + +++   I V  +G  I   +    +F     FL+ KF P+++ IA ++  
Sbjct: 160 MESIKKALEREIEQGAIEVENLGQQIVIRMREKGAFPEGSAFLQPKFRPLVRQIAELVKD 219

Query: 106 FPSTVIAIQSHTDSIGT----LKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKY 161
            P   + +  HTD+        ++N  +S +RA  +   + +    S++ + VRG A   
Sbjct: 220 VPGI-VRVSGHTDNQPLDSELYRSNWDLSSQRAVSVAQEMEKVRGFSHQRLRVRGMADTE 278

Query: 162 PIDTNDTKVGRQNNQRIEIQIF 183
           P+  ND+   R  N+R+EI I 
Sbjct: 279 PLAPNDSDANRALNRRVEISIM 300


>gi|162448390|ref|YP_001610757.1| putative ompA family protein [Sorangium cellulosum 'So ce 56']
 gi|161158972|emb|CAN90277.1| putative ompA family protein [Sorangium cellulosum 'So ce 56']
          Length = 617

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 36/170 (21%), Positives = 70/170 (41%), Gaps = 2/170 (1%)

Query: 22  SREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVS 81
           + +          D D V     +  D+         ++   V  R+ +     +     
Sbjct: 445 TSDPATNGCPGDRDGDTVRDDQDACPDEKGKPDPDPTKNGCPVAVRMTETEIVILQQVQF 504

Query: 82  FVSEVFLEKKFLPMLQLIATILNKFPS-TVIAIQSHTDSIGTLKNNLLISQERADVIKSY 140
              +  ++K   P+L  +A +L + P  T I +Q HTD  G    N+ +SQ RA+ +   
Sbjct: 505 DTGKATIKKVSDPLLDEVAGVLKEHPEITKIEVQGHTDPRGGRAYNIKLSQARAESVTK- 563

Query: 141 LIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGNIKK 190
            + +       ++ +G+    PI  NDT  GRQ N+R++ +I  +   ++
Sbjct: 564 ALVQRGIEAERLASKGYGPDVPIAENDTDEGRQKNRRVQFKILEKKPKQQ 613


>gi|78224724|ref|YP_386471.1| OmpA/MotB [Geobacter metallireducens GS-15]
 gi|78195979|gb|ABB33746.1| OmpA/MotB [Geobacter metallireducens GS-15]
          Length = 193

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 34/193 (17%), Positives = 67/193 (34%), Gaps = 11/193 (5%)

Query: 1   MIK---ELGLSMFIMTTISGCGLASREKKKVFLHK-SNDTDIVNKRFGSSLDKAEDEFQM 56
           M K    L   +      +GC      K +  +   +        +  +   K E     
Sbjct: 1   MRKCTFGLVALLCFGLVAAGCAKKEMVKPEEAVPPVAAPQPTTPAKPAAPPVKEEPIAAQ 60

Query: 57  QLQDTGIVVSRIG-----DMITCYIPVHVSFVSEVFLEKKFLPMLQLIATIL-NKFPSTV 110
            + +  +    +      D +T  +           L +    +L   A  L  K P+  
Sbjct: 61  PIPEAPVKTETLQPATALDTVTATLDRIFFDFDSFVLSQAARDILSKNAEYLLKKQPNAR 120

Query: 111 IAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKV 170
           + I+ H D  G+ + NL + ++RA   + YL+     +   +S+  +  + P+D   T+ 
Sbjct: 121 VLIEGHCDERGSDEYNLALGEKRAKAARDYLVTL-GVAANRLSIISYGEEKPLDPGHTEE 179

Query: 171 GRQNNQRIEIQIF 183
               N+R E  I 
Sbjct: 180 AWAKNRRAEFLIV 192


>gi|319787865|ref|YP_004147340.1| OmpA/MotB domain protein [Pseudoxanthomonas suwonensis 11-1]
 gi|317466377|gb|ADV28109.1| OmpA/MotB domain protein [Pseudoxanthomonas suwonensis 11-1]
          Length = 369

 Score =  106 bits (265), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 33/151 (21%), Positives = 58/151 (38%), Gaps = 6/151 (3%)

Query: 38  IVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQ 97
                 G  ++  +D+         I        ++  +        +  L    + +L 
Sbjct: 217 ADLDDDGDGVNNCDDKCPGSQAGQAIGPDGCPVPVSIDLKGVNFDYDKATLRPDAVAILS 276

Query: 98  LIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGF 157
             A IL ++P   + +  HTDS GT   N  +S+ RA  +  YL   G+ ++R +   G+
Sbjct: 277 EAAEILKRYPDLRVEVAGHTDSRGTDAYNQKLSERRAKAVYDYLTSNGIDASRLVGPIGY 336

Query: 158 AYKYPIDTN------DTKVGRQNNQRIEIQI 182
               PI  N      D   GR  N+R E+ +
Sbjct: 337 GESRPIAPNANPDGSDNPEGRAKNRRTELNV 367


>gi|311697206|gb|ADQ00078.1| secreted protein containing outer membrane protein, OmpA/MotB,
           C-terminal domain [marine bacterium HP15]
          Length = 366

 Score =  106 bits (265), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 40/146 (27%), Positives = 66/146 (45%), Gaps = 1/146 (0%)

Query: 37  DIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPML 96
           D         LDK  D     L D+      +   I   + V    + +  ++ +F P +
Sbjct: 209 DTDGDGVIDDLDKCPDTPMGALVDSDGCPKELTKDIKETLYVE-FDLDKTEVKPQFYPEI 267

Query: 97  QLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRG 156
             +A +L ++P++ I ++ HTDS G+   N  +S+ RAD +   LI R    +  IS  G
Sbjct: 268 GELAKVLKQYPTSTILLEGHTDSTGSASYNQQLSKSRADAVMKVLIDRFSIPSTRISTTG 327

Query: 157 FAYKYPIDTNDTKVGRQNNQRIEIQI 182
                PI +N T  GR  N+R+E  +
Sbjct: 328 MGESQPIASNATVEGRAQNRRVEAIV 353


>gi|306820125|ref|ZP_07453773.1| chemotaxis protein MotB [Eubacterium yurii subsp. margaretiae ATCC
           43715]
 gi|304551903|gb|EFM39846.1| chemotaxis protein MotB [Eubacterium yurii subsp. margaretiae ATCC
           43715]
          Length = 250

 Score =  106 bits (265), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 30/178 (16%), Positives = 70/178 (39%), Gaps = 7/178 (3%)

Query: 19  GLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPV 78
              ++ +K       + +   +  F     + ++  +    +  I +S   + +      
Sbjct: 67  SSENKIEKGSVFEGQSSSVAESNNFEKMEKQIKEYLEENKLEKQISISNEEEGLVLRFQD 126

Query: 79  H-VSFVSEVFLEKKFLPMLQLIATILNK--FPSTVIAIQSHTDSIGT----LKNNLLISQ 131
             +       L+ +   +L+ +  IL    F    ++++ HTD++       ++N  +S 
Sbjct: 127 SSLFDQGSATLKPQSYNVLKYVGGILKSKNFKDKFVSVEGHTDNVPISTSTHQSNWELSS 186

Query: 132 ERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGNIK 189
            RA  +  YLI+      + +S  G+   +P+  NDT      N+R++I I    + K
Sbjct: 187 NRASNVVRYLIENQGIDPKRLSTAGYGEYHPVAPNDTPANMAKNRRVDIMILRTKDSK 244


>gi|332662636|ref|YP_004445424.1| OmpA/MotB domain-containing protein [Haliscomenobacter hydrossis
           DSM 1100]
 gi|332331450|gb|AEE48551.1| OmpA/MotB domain protein [Haliscomenobacter hydrossis DSM 1100]
          Length = 550

 Score =  106 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 39/180 (21%), Positives = 68/180 (37%), Gaps = 12/180 (6%)

Query: 17  GCGLASRE---KKKVFLHKSND-------TDIVNKRFGSSLDKAEDEFQMQLQDTGIVVS 66
           GC     +    K                 D  N      LDK    F +   +    + 
Sbjct: 372 GCPDKDNDGVLDKDDACPDIAGLKQFNGCPDTDNDGIEDRLDKCPTTFGLSSNNGCPEIK 431

Query: 67  RIGDMIT-CYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKN 125
                +    +       +   L    L +L  +A I+N++P  ++ +  HTD++G    
Sbjct: 432 AEDKAVLAFAMSNVNFETNSAKLLASSLEVLDKVAEIMNRYPDFMLYMDGHTDNVGEEAT 491

Query: 126 NLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPR 185
           NL +S+ R     +YL  +   S   I  +GF    P+  N T  GR+ N+R+E ++ P+
Sbjct: 492 NLRLSESRVLACSAYLQTK-GISAANIRTQGFGESKPLADNKTAAGRRQNRRVEFRVEPK 550


>gi|326319300|ref|YP_004236972.1| OmpA/MotB domain-containing protein [Acidovorax avenae subsp.
           avenae ATCC 19860]
 gi|323376136|gb|ADX48405.1| OmpA/MotB domain protein [Acidovorax avenae subsp. avenae ATCC
           19860]
          Length = 296

 Score =  106 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 34/151 (22%), Positives = 65/151 (43%), Gaps = 8/151 (5%)

Query: 40  NKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLI 99
                + +   E + +       I   +    +   +   +   ++  L  +  P L  +
Sbjct: 151 AADNAARVRALEAQLRD------IEAQQTERGLLVTLGDVLFAFNKAELSAQAGPRLDKL 204

Query: 100 ATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAY 159
           A  L +FP   + I+ HTDS+G    N  +S+ RA  +    + +   +   I+ RG+  
Sbjct: 205 ANFLRQFPDRKLIIEGHTDSVGGDAYNQSLSERRAQAV-QSALVQRGVAPDRITARGYGK 263

Query: 160 KYPIDTNDTKVGRQNNQRIEIQIF-PRGNIK 189
            YP+  N +  GR  N+R+EI I   +GN++
Sbjct: 264 TYPVADNSSPEGRAMNRRVEIVIADDKGNLR 294


>gi|89889933|ref|ZP_01201444.1| putative outer membrane protein, ompA family [Flavobacteria
           bacterium BBFL7]
 gi|89518206|gb|EAS20862.1| putative outer membrane protein, ompA family [Flavobacteria
           bacterium BBFL7]
          Length = 457

 Score =  106 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 41/167 (24%), Positives = 65/167 (38%), Gaps = 1/167 (0%)

Query: 18  CGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIP 77
           C                D D V        D                     + +  Y  
Sbjct: 292 CKTVKGPASNNGCPADRDNDGVIDADDKCPDTPGIASLAGCPKPAAPTVEEQEQLNQYAK 351

Query: 78  VHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVI 137
             +    +  ++ +   +L  I  IL K+P+   +I  HTDS+G+ K N  +S  RA+ +
Sbjct: 352 TILFDTGKATIKAESAKVLSDITAILKKYPTAKFSIDGHTDSVGSAKLNQRLSDSRANEV 411

Query: 138 KSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           K+YL+  G+   R  SV G+    P+  N TK GR  N+R+EI +  
Sbjct: 412 KNYLVANGIDEFRLSSV-GYGEARPVADNKTKTGRAQNRRVEINLVN 457


>gi|51244080|ref|YP_063964.1| outer membrane protein F [Desulfotalea psychrophila LSv54]
 gi|50875117|emb|CAG34957.1| probable outer membrane protein F [Desulfotalea psychrophila LSv54]
          Length = 216

 Score =  106 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 38/160 (23%), Positives = 70/160 (43%), Gaps = 8/160 (5%)

Query: 28  VFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVV-SRIGDMITCYIPVHVSFVSEV 86
                +    I   + G  +D+ E + +  +  +      R  D++T        F +  
Sbjct: 61  GAGIGATVGGIAGNQIGRYMDQQEQDLRNAVAASNAASVRRDQDVLTATFKGETFFDTNS 120

Query: 87  -FLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRG 145
             ++      +  +AT+LNK+P+T I +  HTDS+G    N  +S+ RA  +K+ LI + 
Sbjct: 121 FTIKPGGWAEVNRVATVLNKYPNTNIKVAGHTDSLGNEAYNQQLSERRARAVKNALI-QY 179

Query: 146 VSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPR 185
             +   I   G+    PI +++       N+R+EI I P 
Sbjct: 180 GVNGNRIRAIGYGESLPISSSN-----AQNRRVEIVITPN 214


>gi|289548706|ref|YP_003473694.1| OmpA/MotB domain protein [Thermocrinis albus DSM 14484]
 gi|289182323|gb|ADC89567.1| OmpA/MotB domain protein [Thermocrinis albus DSM 14484]
          Length = 243

 Score =  106 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 43/155 (27%), Positives = 73/155 (47%), Gaps = 10/155 (6%)

Query: 40  NKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV-SEVFLEKKFLPMLQL 98
            ++    + + E   +    +  + V+     I   +   + F      ++ +F P+L  
Sbjct: 85  GQKILKQIMELEKTLKTIGLEGKLKVAYEAIGIRLILQERLLFDSGSADIKPQFYPILDK 144

Query: 99  IATILNKFPSTVIAIQSHTD----SIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISV 154
           IA +LN  P+  + ++ HTD    S G   +N  +S  RA  +  Y I +GVS +R +  
Sbjct: 145 IAELLNSIPN-PVEVEGHTDNIPISTGRFPSNWELSTARASSVVRYFIAKGVSPDR-LKA 202

Query: 155 RGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGNIK 189
            G+A   PI +N T  GR+ N+R+EI I    NIK
Sbjct: 203 SGYADTRPIASNATPEGREQNRRVEIVII---NIK 234


>gi|225375333|ref|ZP_03752554.1| hypothetical protein ROSEINA2194_00958 [Roseburia inulinivorans DSM
           16841]
 gi|225212822|gb|EEG95176.1| hypothetical protein ROSEINA2194_00958 [Roseburia inulinivorans DSM
           16841]
          Length = 270

 Score =  106 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 32/168 (19%), Positives = 62/168 (36%), Gaps = 6/168 (3%)

Query: 21  ASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHV 80
            + +  +         +          ++ +D          + +    + +   +   V
Sbjct: 94  TTDDTSESSDVAEEYKEEALAESEQMAEQVQDLVAQYGIQDQVEIDFNAEYVLLNLNGAV 153

Query: 81  SFV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGT-----LKNNLLISQERA 134
            F   +  ++ +  P++  I  IL  +   +I I+ HTD+I        +NN ++S  RA
Sbjct: 154 LFDSGKSEIKSEAYPLMDKIGKILQSYQQNMIEIEGHTDNIPFTHSSKYENNDVLSMYRA 213

Query: 135 DVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
             +  Y+          I   G     PI  N T  GR  N+R+EI+I
Sbjct: 214 LYVADYMRNITTIDPSHIKSSGRGEYVPIADNSTPEGRARNRRVEIKI 261


>gi|298207224|ref|YP_003715403.1| Thrombospondin type 3 repeat:OmpA/MotB [Croceibacter atlanticus
           HTCC2559]
 gi|83849860|gb|EAP87728.1| Thrombospondin type 3 repeat:OmpA/MotB [Croceibacter atlanticus
           HTCC2559]
          Length = 478

 Score =  106 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 38/188 (20%), Positives = 76/188 (40%), Gaps = 14/188 (7%)

Query: 8   SMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSL-----------DKAEDEFQM 56
           ++  +  ++GC  A  +  K       +        G              D    +   
Sbjct: 287 TVAGIQALNGCPDADGDGIKDSEDNCPNEAGPASNNGCPFEDKDGDGVLDKDDQCPDVAG 346

Query: 57  QLQDTGIVVSRIG--DMITCYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQ 114
            + + G     +   + +  Y    +  +++  +  +    LQ IA I++++P+    I+
Sbjct: 347 TVANNGCPEVTVEVMNELNEYSRTILFDLNKSTIRSESFETLQNIADIMSEYPTAKFHIE 406

Query: 115 SHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQN 174
            HTDS G+   N  +S+ERA  +    +     +   ++  G+    PI TN T  GRQ 
Sbjct: 407 GHTDSQGSEAYNEKLSRERAASV-RTYLTTKGVAANKLTSEGYGELRPIATNKTAAGRQQ 465

Query: 175 NQRIEIQI 182
           N+R+EI++
Sbjct: 466 NRRVEIKL 473


>gi|172061391|ref|YP_001809043.1| OmpA/MotB domain-containing protein [Burkholderia ambifaria MC40-6]
 gi|171993908|gb|ACB64827.1| OmpA/MotB domain protein [Burkholderia ambifaria MC40-6]
          Length = 215

 Score =  106 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 41/207 (19%), Positives = 74/207 (35%), Gaps = 27/207 (13%)

Query: 2   IK---ELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSL----------- 47
           +K    L +       ++GC         V                              
Sbjct: 3   MKIATRLSVFALAGALLAGCATQQGNNAAVGTGTGAALGAGIGALAGGGKGAAIGAGVGA 62

Query: 48  ----------DKAEDEFQMQLQDTGIVVSRIGDM-ITCYIPVHVSFVSE-VFLEKKFLPM 95
                        +++       TG  V+   D  +   +P  V+F +    +   F P+
Sbjct: 63  LVGGVTGYNWQAIKNKLAPSAAQTGTQVTEQPDGSLKLNVPSSVTFATNQYAITPAFTPL 122

Query: 96  LQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVR 155
           L  +AT LN+ P    ++  +TDS G+ + N  +SQ RA  + +  + +   +   +S +
Sbjct: 123 LNDLATTLNQNPQLTGSVIGYTDSTGSAQLNQTLSQNRAQSVVN-ALAQRGVAGGRLSAQ 181

Query: 156 GFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           G     PI  N T+ GR  N+R+EI +
Sbjct: 182 GMGPSNPIADNATEAGRAQNRRVEIYL 208


>gi|315498712|ref|YP_004087516.1| ompa/motb domain protein [Asticcacaulis excentricus CB 48]
 gi|315416724|gb|ADU13365.1| OmpA/MotB domain protein [Asticcacaulis excentricus CB 48]
          Length = 187

 Score =  106 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 36/181 (19%), Positives = 64/181 (35%), Gaps = 3/181 (1%)

Query: 5   LGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIV 64
           L +++ +M +++ C        K+            +         E   +         
Sbjct: 9   LLVAIPLMLSMTACASHKYVDDKITATNGRIDQQETRLTQLDQTTQEALTRATAAGKLAE 68

Query: 65  VSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATILN-KFPSTVIAIQSHTDSIGTL 123
                  +            +  L +    +L  +A  L     +  + IQ  TDS GT 
Sbjct: 69  GKFNY-SVVLSDDSIKFDTDKAVLSEAGKQVLADLAERLKRDNKNVYLEIQGFTDSTGTD 127

Query: 124 KNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
             N  +   RAD +K +L  +GV+ NR  S+  +  + PI  N T  GR  N+R+ I + 
Sbjct: 128 DINYRLGNARADSVKRFLNSQGVALNRMASIS-YGAEQPIAPNSTAQGRAANRRVVIVVL 186

Query: 184 P 184
            
Sbjct: 187 S 187


>gi|327480142|gb|AEA83452.1| putative outer membrane protein [Pseudomonas stutzeri DSM 4166]
          Length = 209

 Score =  106 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 47/187 (25%), Positives = 79/187 (42%), Gaps = 8/187 (4%)

Query: 4   ELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGI 63
           +    +  M  I+GC     +K            +  K   + LD+ E + +  L D+  
Sbjct: 5   KSASLILCMIVIAGCSSKGEKK-----PSEAAAPVAPKVDYAWLDEYEPKLRDALVDSRF 59

Query: 64  VVSRIGDMITCYIPVHVSFVSEV--FLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIG 121
            V R  +++    PV  SF  +    L    L  +  +A ++ K   T + I  H DS G
Sbjct: 60  EVERRDNVLVVTAPVDSSFNPDRPGMLLPVTLGPITRVAKLVEKDEKTAVVILGHADSTG 119

Query: 122 TLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQ 181
               N  IS+ERA  + +     G   +R + +RG     P   ND+K GR  N+R+E+ 
Sbjct: 120 ADDVNRTISRERASAVAAIFRLSGFKHDR-LRIRGLGSDMPRAANDSKEGRAMNRRVEMV 178

Query: 182 IFPRGNI 188
           + P+  +
Sbjct: 179 LAPQTTM 185


>gi|296137072|ref|YP_003644314.1| OmpA/MotB domain protein [Thiomonas intermedia K12]
 gi|294341249|emb|CAZ89650.1| putative OmpA family protein [Thiomonas sp. 3As]
 gi|295797194|gb|ADG31984.1| OmpA/MotB domain protein [Thiomonas intermedia K12]
          Length = 226

 Score =  106 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 40/172 (23%), Positives = 81/172 (47%), Gaps = 5/172 (2%)

Query: 15  ISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQ--DTGIVVSR-IGDM 71
           ++  G   +      +  +    +    +   L+K + + Q Q Q   TG+ V++   + 
Sbjct: 50  LTAGGNTGKSAATGAVAGAAVGALGGYLWNQHLEKQKQDLQAQAQASGTGVQVTQTQDNR 109

Query: 72  ITCYIP-VHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLIS 130
           +   +P           L  +  P+L+ +AT LN+ PS  + +   TD+ GT   N  +S
Sbjct: 110 LKMNVPADAGFATGSAQLNPRMYPILESLATGLNQNPSETVQVFGFTDNTGTDAINYPLS 169

Query: 131 QERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           + RA  +K++L+ R   + + ++ +G   + P+ +N T  GR  N+R+EI +
Sbjct: 170 ENRALTVKNFLVSR-GVAPQRVTTQGLGPQNPVASNATAQGRAANRRVEIYV 220


>gi|110638407|ref|YP_678616.1| outer membrane protein [Cytophaga hutchinsonii ATCC 33406]
 gi|110281088|gb|ABG59274.1| possible outer membrane protein [Cytophaga hutchinsonii ATCC 33406]
          Length = 509

 Score =  106 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 30/140 (21%), Positives = 58/140 (41%), Gaps = 1/140 (0%)

Query: 44  GSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATIL 103
            S +   E     +     +V+  +    +  +           L K+    L  +  ++
Sbjct: 369 QSEVYDLEKAVAYETIKKDMVLEPLKLNASFRLNNLFFDFDSASLTKESELELDRVIEMM 428

Query: 104 NKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPI 163
               +  + I +HTD +G+   N  +SQ RA+ +  YL   G+ + R +  +G+    P 
Sbjct: 429 KTNATMQVEISAHTDDMGSDAYNQKLSQLRAESVVKYLTLHGIITTRLV-AKGYGESVPS 487

Query: 164 DTNDTKVGRQNNQRIEIQIF 183
             NDT+  R  N+R+E +I 
Sbjct: 488 VPNDTEENRAKNRRVEFKII 507


>gi|170703075|ref|ZP_02893898.1| OmpA/MotB domain protein [Burkholderia ambifaria IOP40-10]
 gi|170132016|gb|EDT00521.1| OmpA/MotB domain protein [Burkholderia ambifaria IOP40-10]
          Length = 215

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 47/207 (22%), Positives = 79/207 (38%), Gaps = 27/207 (13%)

Query: 2   IK---ELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSL----------- 47
           +K    L +       ++GC         V                              
Sbjct: 3   MKIATRLSVFALAGALLAGCATQQGNNAAVGTGTGAALGAGIGALAGGGKGAAIGAGVGA 62

Query: 48  ----------DKAEDEFQMQLQDTGIVVSRIGDM-ITCYIPVHVSFVSE-VFLEKKFLPM 95
                        +++       TG  V+   D  +   +P  V+F +    +   F P+
Sbjct: 63  LVGGVTGYNWQAIKNKLAPSAAQTGTQVTEQPDGSLKLNVPSSVTFATNQYAITPAFTPL 122

Query: 96  LQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVR 155
           L  +AT LN+ P    ++  +TDS G+ + N  +SQ RA  + + L+QRGV+  R +S +
Sbjct: 123 LNDLATTLNQNPQLTASVVGYTDSTGSAQLNQTLSQNRAQSVVNALVQRGVAGGR-LSAQ 181

Query: 156 GFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           G     PI  N T+ GR  N+R+EI +
Sbjct: 182 GMGASNPIADNATEAGRAQNRRVEIYL 208


>gi|124009612|ref|ZP_01694285.1| thrombospondin type 3 repeat:OmpA/MotB [Microscilla marina ATCC
           23134]
 gi|123984753|gb|EAY24733.1| thrombospondin type 3 repeat:OmpA/MotB [Microscilla marina ATCC
           23134]
          Length = 493

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 42/172 (24%), Positives = 75/172 (43%), Gaps = 4/172 (2%)

Query: 17  GCGLASRE---KKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMIT 73
           GC     +    KK    K       N       D   D+        G+  +R    + 
Sbjct: 323 GCPDTDGDGIIDKKDDCPKKAGLAEFNGCPDRDKDGVPDKVDNCPDVPGVKDNRGCPEVL 382

Query: 74  CYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQER 133
                 +    +  +     P+L  ++ +L K+ ST I ++ HTD+ G    NL +S++R
Sbjct: 383 ERASKVLFAPGKAIINPVSFPVLNELSELLKKYASTKIYLEGHTDNQGDDDANLKLSKDR 442

Query: 134 ADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPR 185
           A  +  YLI++G++ +R  S  GF    PI  N T  GR+ N+R+++++  +
Sbjct: 443 AQAVADYLIKKGIAKSRIEST-GFGETKPIADNKTAAGRKKNRRVDMKLTNQ 493


>gi|298372337|ref|ZP_06982327.1| OmpA domain protein [Bacteroidetes oral taxon 274 str. F0058]
 gi|298275241|gb|EFI16792.1| OmpA domain protein [Bacteroidetes oral taxon 274 str. F0058]
          Length = 700

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 30/167 (17%), Positives = 61/167 (36%), Gaps = 2/167 (1%)

Query: 18  CGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCY-I 76
           C    +E + +        D          D+      ++       + +    +    +
Sbjct: 527 CPNTPKEVRGLVDENGCPKDTDGDGILDYKDECPTIKGVKENQGCPPIKKEVLKVFKQAL 586

Query: 77  PVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADV 136
                   +  ++     +L+LI  I+   P   + I  HTDS G    N+ +S++RA  
Sbjct: 587 HGIQFDTGKATIKPVSRGVLKLIVDIMRNNPDYNLIIAGHTDSQGNDALNMTLSEKRAAA 646

Query: 137 IKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
           +    ++      R +  +G+    P+ TN T  GR  N+R+E  + 
Sbjct: 647 V-RKYLEDRGIDKRRLQSKGYGETLPVATNKTAKGRAQNRRVEFTVV 692


>gi|269103244|ref|ZP_06155941.1| Flagellar motor rotation protein MotB [Photobacterium damselae
           subsp. damselae CIP 102761]
 gi|268163142|gb|EEZ41638.1| Flagellar motor rotation protein MotB [Photobacterium damselae
           subsp. damselae CIP 102761]
          Length = 314

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 38/173 (21%), Positives = 72/173 (41%), Gaps = 6/173 (3%)

Query: 16  SGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCY 75
           +G     +  KK    + +     +              + ++++  + +   G  +   
Sbjct: 119 AGTLTGGQADKKNKTQQQDQDQNASDSLKQLEKVLNKAIEREIEEGNVEIENFGQQLVIR 178

Query: 76  IPVHVSFV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGT----LKNNLLIS 130
           I    +F     FL+ KF P+++ +A+++   P T + I  HTD         ++N  IS
Sbjct: 179 IKEQGAFPEGSAFLQPKFRPLVRQVASLVKDVPGT-VRISGHTDDRPVESELYRSNWDIS 237

Query: 131 QERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
            +RA  +   + +        + V G A   PI +NDT  GR+ N+R+EI I 
Sbjct: 238 AQRAVSVAQEMAKVTGFDQHRMQVVGLADTAPIASNDTAEGRKRNRRVEISIM 290


>gi|86141593|ref|ZP_01060139.1| Outer membrane protein and related peptidoglycan-associated
           (lipo)protein [Leeuwenhoekiella blandensis MED217]
 gi|85832152|gb|EAQ50607.1| Outer membrane protein and related peptidoglycan-associated
           (lipo)protein [Leeuwenhoekiella blandensis MED217]
          Length = 224

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 32/151 (21%), Positives = 68/151 (45%), Gaps = 6/151 (3%)

Query: 41  KRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVH---VSFVSEVFLEKKFLPMLQ 97
              G  +DK     + ++   G  V R+ D I      +       ++  +       L 
Sbjct: 66  NVIGKKMDKQAQRIEEEIP--GAEVERVDDGIVVNFDENSGVYFATNKYNINSASQETLN 123

Query: 98  LIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGF 157
            ++ ++ ++P T + +  HTDS G+   N+ +S+ RA  + +YL+ +   ++   + + +
Sbjct: 124 GLSRVMQEYPQTNVLVVGHTDSTGSADYNMTLSKNRAQAVTNYLVSQ-GIASGRFTTQWY 182

Query: 158 AYKYPIDTNDTKVGRQNNQRIEIQIFPRGNI 188
             + P  TN+T  GR  N+R+ + I P   +
Sbjct: 183 GEEQPKYTNETAEGRSKNRRVTLAIVPNQEM 213


>gi|24375803|ref|NP_719846.1| OmpA family protein [Shewanella oneidensis MR-1]
 gi|24350753|gb|AAN57290.1|AE015865_4 OmpA family protein [Shewanella oneidensis MR-1]
          Length = 201

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 32/183 (17%), Positives = 78/183 (42%), Gaps = 5/183 (2%)

Query: 4   ELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGI 63
           +  + +  +T ++GC +  R+   +    +     ++ + G  + +A +      +  G 
Sbjct: 2   KTSILLLSVTLLAGCSI--RDTVNIDEMTTTQASDLSDKDGDGVIEARERCNETAKGAGT 59

Query: 64  VVSRIGDMITCYIP---VHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSI 120
                G + +         +   +  ++  ++ P ++ +A  L ++P+T + I+ HT   
Sbjct: 60  DNYGCGQIKSINERKEINVLFPNNSAYIAPEYYPQIEEVAIFLRQYPTTKVTIEGHTSRT 119

Query: 121 GTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEI 180
           GT + N  +SQERA+ + + L +R       ++  G+    PI    T      N+R+  
Sbjct: 120 GTDETNKELSQERANAVTAVLAERFGIDRSRLTAIGYGSSRPIVLEQTPEAEIRNRRVVA 179

Query: 181 QIF 183
           ++ 
Sbjct: 180 EVT 182


>gi|149195189|ref|ZP_01872279.1| OmpA domain protein [Caminibacter mediatlanticus TB-2]
 gi|149134622|gb|EDM23108.1| OmpA domain protein [Caminibacter mediatlanticus TB-2]
          Length = 383

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 34/146 (23%), Positives = 65/146 (44%), Gaps = 8/146 (5%)

Query: 37  DIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPML 96
           D         LDK  +  +      G  V + G  IT    ++    +   ++ +++P +
Sbjct: 244 DSDGDGVADYLDKCPNTPK------GFKVDQNGCAITYNFEIN-FDTNSAKIKPEYMPKI 296

Query: 97  QLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRG 156
           +  A  L   P     IQ +TD+ G+   N+++S++RA  +    + +   +   I+  G
Sbjct: 297 EKFAEFLKNHPDVKAEIQGYTDNRGSATYNMILSEKRAKAVYE-ALLKLGVNKDQITFVG 355

Query: 157 FAYKYPIDTNDTKVGRQNNQRIEIQI 182
           +    PI +NDT  GR  N+R+  +I
Sbjct: 356 YGEANPIASNDTPEGRAKNRRVVAKI 381


>gi|326389648|ref|ZP_08211214.1| OmpA/MotB domain protein [Thermoanaerobacter ethanolicus JW 200]
 gi|325994363|gb|EGD52789.1| OmpA/MotB domain protein [Thermoanaerobacter ethanolicus JW 200]
          Length = 237

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 36/206 (17%), Positives = 72/206 (34%), Gaps = 23/206 (11%)

Query: 1   MIKELGLSMFIMTTIS----------GCGLASREKKKVFLHKSNDTD---IVNKRFGSSL 47
           MI  L +   +M TIS             L+       ++            N    +SL
Sbjct: 22  MITLLLIFFIVMYTISTINATKFAQIASSLSKTFTGTDYVIGQYSGSSFVQGNSGDKNSL 81

Query: 48  DKAEDEFQMQLQDTG----IVVSRIGDMITCYIPVHVSFV-SEVFLEKKFLPMLQLIATI 102
            + E +    +++      +        +   +   + F      +  +   +L  I  +
Sbjct: 82  GEIEKQLNGFIKENNLQGMVTSYIDERGLVISMQDSLLFDLGSADVHPEEKDVLIKIGNM 141

Query: 103 LNKFPSTVIAIQSHTDSIGTL----KNNLLISQERADVIKSYLIQRGVSSNRFISVRGFA 158
           L   P+  I ++  TD +        +N  +S  RA  +   L+       + IS  G+ 
Sbjct: 142 LKTLPN-HIRVEGFTDDLPIHNSKFDSNWELSVIRATNVVKILVNEVGIEPQRISAVGYG 200

Query: 159 YKYPIDTNDTKVGRQNNQRIEIQIFP 184
              P+  ND++  R+ N+R++I I  
Sbjct: 201 EYRPVVPNDSEEHRRLNRRVDIVIMN 226


>gi|254428955|ref|ZP_05042662.1| Thrombospondin type 3 repeat family [Alcanivorax sp. DG881]
 gi|196195124|gb|EDX90083.1| Thrombospondin type 3 repeat family [Alcanivorax sp. DG881]
          Length = 384

 Score =  105 bits (263), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 43/198 (21%), Positives = 76/198 (38%), Gaps = 31/198 (15%)

Query: 22  SREKKKVFLHKSNDTDIVNKRFGSSLDK-AEDEFQMQLQDTGIVVSRIGDMITCYIPV-- 78
           S EK++    ++  +D          D+ A      Q+  TG  +    D I   +    
Sbjct: 185 SSEKEEPAPVENVVSDSDGDGVPDERDQCANTPAGAQVDATGCELDDDNDSIVNSMDECP 244

Query: 79  --------------------------HVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIA 112
                                           +  + +   P L+ +A  + ++PS  + 
Sbjct: 245 NTPAGALVDDKGCQKYLDKDVKETLYVEFGHDKAEVRQTSYPSLENLAEGMRQYPSANLV 304

Query: 113 IQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGR 172
           ++ HTDS G+   N  +SQ+RAD +K+ L+     S   I+  G+  + PI  N T  GR
Sbjct: 305 LEGHTDSTGSAAYNKKLSQQRADAVKTVLVDHYNVSADRITTVGYGEEKPIADNKTSEGR 364

Query: 173 QNNQRIEIQIFPRGNIKK 190
             N+R+E  I  +   K+
Sbjct: 365 AENRRVE-TIM-KATTKE 380


>gi|124004460|ref|ZP_01689305.1| OmpA family protein [Microscilla marina ATCC 23134]
 gi|123990032|gb|EAY29546.1| OmpA family protein [Microscilla marina ATCC 23134]
          Length = 350

 Score =  105 bits (263), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 30/122 (24%), Positives = 54/122 (44%)

Query: 64  VVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTL 123
            +  +       +       ++          L  +  +L ++P+ VI I  HTD+IGT 
Sbjct: 229 SIISVETGEVYRLDNVSFDFNKATFRPFSKVELDKLVKLLKQYPAIVILITGHTDNIGTD 288

Query: 124 KNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
             N  +SQ RA  + +YL+ +G      I   G     P+ +N+T  GR  N+R+E ++ 
Sbjct: 289 TKNFDLSQRRAQTVANYLLTKGGVDPDRIRTEGMGETQPVMSNNTNTGRALNRRVEFRVL 348

Query: 184 PR 185
            +
Sbjct: 349 KK 350


>gi|95929277|ref|ZP_01312021.1| OmpA/MotB [Desulfuromonas acetoxidans DSM 684]
 gi|95134775|gb|EAT16430.1| OmpA/MotB [Desulfuromonas acetoxidans DSM 684]
          Length = 217

 Score =  105 bits (263), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 47/212 (22%), Positives = 83/212 (39%), Gaps = 32/212 (15%)

Query: 4   ELGLSMFIMTTISGCGLASREKKKVFLHKSND--------TDIVNKRFGS---------- 45
            + + + +M  ++GC       +K     +                   S          
Sbjct: 6   RMCVVVAVMVYLAGCSQPMNRTQKGAGIGAATGALAGALIGQAAGGDTESTLIGAGVGAA 65

Query: 46  -----------SLDKAEDEFQMQLQD-TGIVVSRIGDMITCYIP-VHVSFVSEVFLEKKF 92
                       +D+ E   +  L    G+ + R G+++       +   V    L    
Sbjct: 66  VGAGTGAGIGYYMDQQEQAMRNALASVEGVKIDRDGNILYVTFRSDNQFDVGSFTLRAGA 125

Query: 93  LPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFI 152
              +  +A IL ++  T I +  HTDS G+ + NL +S+ RA  +++ L+  GV S R I
Sbjct: 126 QQDVARLAAILTEYHKTTILVAGHTDSTGSEEYNLGLSERRAMAVRNILVASGVISTR-I 184

Query: 153 SVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           +  GF    PI  N T+ GRQ N+R+ ++I P
Sbjct: 185 TTVGFGESAPIADNSTEYGRQLNRRVALKITP 216


>gi|110833683|ref|YP_692542.1| outer membrane protein OprF [Alcanivorax borkumensis SK2]
 gi|110646794|emb|CAL16270.1| outer membrane protein OprF [Alcanivorax borkumensis SK2]
          Length = 384

 Score =  105 bits (263), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 41/206 (19%), Positives = 77/206 (37%), Gaps = 34/206 (16%)

Query: 14  TISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDK-AEDEFQMQLQDTGIVVSRIGDMI 72
            + G       +++    ++  TD          D+ A      Q+  TG  +    D I
Sbjct: 180 FLIGGSS---NEQEPAPIENVVTDSDGDGVPDDRDQCANTPAGAQVDATGCELDDDNDSI 236

Query: 73  TCYIPV----------------------------HVSFVSEVFLEKKFLPMLQLIATILN 104
              +                                    +  + +   P L+ +A  + 
Sbjct: 237 VNSMDDCPNTPAGALVDDKGCQKYLEKDVKETLYVEFGHDKTEVRQTSYPSLENLAEDMR 296

Query: 105 KFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPID 164
           ++PS  + ++ HTDS G+   N  +SQ+RAD +K+ L+ +   S   I+  G+  + PI 
Sbjct: 297 QYPSANLVLEGHTDSTGSAAYNKKLSQQRADAVKAVLVDKFGVSADRITTVGYGEEKPIS 356

Query: 165 TNDTKVGRQNNQRIEIQIFPRGNIKK 190
            N T  GR  N+R+E  +  +   K+
Sbjct: 357 DNKTSEGRAENRRVETIL--KATTKE 380


>gi|296134255|ref|YP_003641502.1| OmpA/MotB domain protein [Thermincola sp. JR]
 gi|296032833|gb|ADG83601.1| OmpA/MotB domain protein [Thermincola potens JR]
          Length = 296

 Score =  105 bits (263), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 28/158 (17%), Positives = 64/158 (40%), Gaps = 10/158 (6%)

Query: 35  DTDIVNKRFGSSLDKAEDEFQMQLQD----TGIVVSRIGDMITCYIPVHVSF-VSEVFLE 89
            +    K+    + KA+++    ++       +VV+     +   +   + F +    + 
Sbjct: 78  QSAGAQKKEMEEMKKAKEQLDAYIKGQNLGGKVVVAYEERGLVISLKETMFFAIGSAAIN 137

Query: 90  KKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLK----NNLLISQERADVIKSYLIQRG 145
            +    L  I  +L   P+  + I+ HT ++        +N  +S  RA  +  +LI R 
Sbjct: 138 PQAQETLIKIGQVLKNMPN-NLRIEGHTCNLPIRTANFPSNWELSTARATNVVKFLIDRV 196

Query: 146 VSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
               + +S  G+    P+  N ++  R  N+R++I + 
Sbjct: 197 GFDPKRLSATGYGEYRPLVPNTSEANRAMNRRVDIVVL 234


>gi|212638649|ref|YP_002315169.1| flagellar motor protein MotB [Anoxybacillus flavithermus WK1]
 gi|212560129|gb|ACJ33184.1| Flagellar motor protein B [Anoxybacillus flavithermus WK1]
          Length = 251

 Score =  105 bits (263), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 35/160 (21%), Positives = 67/160 (41%), Gaps = 9/160 (5%)

Query: 39  VNKRFGSSLDKAEDEFQMQLQ----DTGIVVSRIGDMITCYIPVHVSFV-SEVFLEKKFL 93
           ++K     L K + +F   ++       + V+   + +   I   V F      ++ ++ 
Sbjct: 92  ISKEEYEELKKIQSKFNEYVKTNQLSGELSVAMTEEGLLVTIANDVLFDSGSADIKPQYR 151

Query: 94  PMLQLIATILNKFPSTVIAIQSHTDSIGT----LKNNLLISQERADVIKSYLIQRGVSSN 149
            + + I+ +L   P   I I  HTD++        +N  +S  RA      L++      
Sbjct: 152 NVAKKISNLLVMNPPRNIVISGHTDNVPINNAKFASNWELSVMRAVNFMKLLLENTKLDP 211

Query: 150 RFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGNIK 189
           +  S +G+    PI +N T  GR  N+R+EI I P+   +
Sbjct: 212 QLFSAKGYGEFKPIASNATPEGRAKNRRVEILIMPQEPTQ 251


>gi|115352534|ref|YP_774373.1| OmpA/MotB domain-containing protein [Burkholderia ambifaria AMMD]
 gi|115282522|gb|ABI88039.1| OmpA/MotB domain protein [Burkholderia ambifaria AMMD]
          Length = 232

 Score =  105 bits (263), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 41/207 (19%), Positives = 74/207 (35%), Gaps = 27/207 (13%)

Query: 2   IK---ELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSL----------- 47
           +K    L +       ++GC         V                              
Sbjct: 20  MKIATRLSVFALAGALLAGCATQQGNNAAVGTGTGAALGAGIGALAGGGKGAAIGAGVGA 79

Query: 48  ----------DKAEDEFQMQLQDTGIVVSRIGDM-ITCYIPVHVSFVSE-VFLEKKFLPM 95
                        +++       TG  V+   D  +   +P  V+F +    +   F P+
Sbjct: 80  LVGGVTGYNWQAIKNKLAPSAAQTGTQVTEQPDGSLKLNVPSSVTFATNQYAITPAFTPL 139

Query: 96  LQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVR 155
           L  +AT LN+ P    ++  +TDS G+ + N  +SQ RA  + +  + +   +   +S +
Sbjct: 140 LNDLATTLNQNPQLTGSVIGYTDSTGSAQLNQTLSQNRAQSVVN-ALAQRGVAGGRLSAQ 198

Query: 156 GFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           G     PI  N T+ GR  N+R+EI +
Sbjct: 199 GMGPSNPIADNATEAGRAQNRRVEIYL 225


>gi|167835831|ref|ZP_02462714.1| ompA family protein [Burkholderia thailandensis MSMB43]
          Length = 215

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 46/202 (22%), Positives = 77/202 (38%), Gaps = 24/202 (11%)

Query: 4   ELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSL---------------- 47
            L +       ++GC         V                                   
Sbjct: 8   RLSVFALAGALLAGCATQQGTNTAVGTGTGAALGAGIGALAGGGKGAAIGAGVGALVGGV 67

Query: 48  -----DKAEDEFQMQLQDTGIVVSRIGDM-ITCYIPVHVSFVSE-VFLEKKFLPMLQLIA 100
                   +++     Q TG  V+   D  +   +P  V+F +    +   F P+L  +A
Sbjct: 68  TGYNWQAIKNKLAPSAQQTGTQVTEQPDGSLKLNVPSSVTFATNQYAVTPAFTPLLNDLA 127

Query: 101 TILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYK 160
           T LN+ P    ++  +TDS G+   N  +SQ RA  + + L QR V+++R +S +G    
Sbjct: 128 TTLNQNPQITASVVGYTDSTGSAAYNQTLSQNRAQSVVNALSQRSVAASR-LSAQGMGAS 186

Query: 161 YPIDTNDTKVGRQNNQRIEIQI 182
            PI  N T+ GR  N+R+EI +
Sbjct: 187 NPIADNATEAGRAQNRRVEIYL 208


>gi|239815674|ref|YP_002944584.1| peptidoglycan-associated lipoprotein [Variovorax paradoxus S110]
 gi|239802251|gb|ACS19318.1| peptidoglycan-associated lipoprotein [Variovorax paradoxus S110]
          Length = 172

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 33/181 (18%), Positives = 67/181 (37%), Gaps = 12/181 (6%)

Query: 1   MIKELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQD 60
           M+K    S+ I+  I+GC   ++        +S  T    +   S++     +       
Sbjct: 1   MLKRTIYSLAIVALIAGCSSGTKLNDTPVTDRSG-TAGGQQGSASAVAPVTIDPNAGTAQ 59

Query: 61  TGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSI 120
             + + RI                   ++ +F  ++   A  L   P   ++I+ HTD  
Sbjct: 60  GPVGIERI----------VYFDYDSYTVKPEFQSLIDGHARFLKANPQRRVSIEGHTDDR 109

Query: 121 GTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEI 180
           G  + NL + Q+R++ ++   +     S+  I    F  + P      +     N+R EI
Sbjct: 110 GGREYNLALGQKRSEAVRR-ALTLLGVSDAQIEAVSFGKEKPAVQGSGEEAWAQNRRAEI 168

Query: 181 Q 181
           +
Sbjct: 169 R 169


>gi|313902670|ref|ZP_07836069.1| OmpA/MotB domain protein [Thermaerobacter subterraneus DSM 13965]
 gi|313467108|gb|EFR62623.1| OmpA/MotB domain protein [Thermaerobacter subterraneus DSM 13965]
          Length = 364

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 30/153 (19%), Positives = 58/153 (37%), Gaps = 6/153 (3%)

Query: 36  TDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV-SEVFLEKKFLP 94
           +    +R    +++  +  +                +       V F      L  +   
Sbjct: 193 SAEERERMEGLVERVNEALREAGLGGRASARLTERGVAIIFDDQVFFDLGRAELRPEGRD 252

Query: 95  MLQLIATILNKFPSTVIAIQSHTDS----IGTLKNNLLISQERADVIKSYLIQRGVSSNR 150
           +L+ +A IL + P T I ++ HTD+     G   +N  +S  RA  +  YL ++     R
Sbjct: 253 LLRRLAPILAQVPGT-ILVEGHTDNLPIRSGRYPSNWELSTARATTVVRYLAEQAGLDPR 311

Query: 151 FISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
            ++  G+    P   N +   R  N+R+EI + 
Sbjct: 312 RLAAAGYGEWRPRYPNTSAANRARNRRVEIVLL 344


>gi|254181403|ref|ZP_04888000.1| ompA family protein [Burkholderia pseudomallei 1655]
 gi|184211941|gb|EDU08984.1| ompA family protein [Burkholderia pseudomallei 1655]
          Length = 215

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 40/202 (19%), Positives = 72/202 (35%), Gaps = 24/202 (11%)

Query: 4   ELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSL---------------- 47
            L +       ++GC         V                                   
Sbjct: 8   RLSVFALAGALLAGCATQQGTNTAVGTGTGAALGAGIGALAGGGKGAAIGAGVGALVGGV 67

Query: 48  -----DKAEDEFQMQLQDTGIVVSRIGDM-ITCYIPVHVSF-VSEVFLEKKFLPMLQLIA 100
                   +++     Q TG  V+   D  +   +P  V+F   +  +   F  +L  +A
Sbjct: 68  TGYNWQAIKNKLAPSAQQTGTQVTEQPDGSLKLNVPSSVTFATDQYAITPAFTLLLNDLA 127

Query: 101 TILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYK 160
           T LN+ P    ++  +TDS G+  +N  +SQ RA  + +  + +   +   +S +G    
Sbjct: 128 TTLNQNPQITASVVGYTDSTGSAAHNQTLSQNRAQSVVN-ALAQRGVAANRLSAQGMGAS 186

Query: 161 YPIDTNDTKVGRQNNQRIEIQI 182
            PI  N T+ GR  N+R+EI +
Sbjct: 187 NPIADNATEAGRAQNRRVEIYL 208


>gi|197117764|ref|YP_002138191.1| OmpA family outer membrane protein [Geobacter bemidjiensis Bem]
 gi|197087124|gb|ACH38395.1| OmpA family outer membrane protein [Geobacter bemidjiensis Bem]
          Length = 468

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 29/150 (19%), Positives = 62/150 (41%), Gaps = 1/150 (0%)

Query: 33  SNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKF 92
           +                     +  L+      +         +      + +  +  ++
Sbjct: 190 AAAPAETVATPVEQPAAVTPAPEPPLEVPAAEPTPDHYKYCITLHGE-FDIDKAIIRPEY 248

Query: 93  LPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFI 152
              +  +   + K+P+T   I+ HTD++G+  +N  +SQ RA+ + +YL+++       +
Sbjct: 249 KEEIAQVGNFMKKYPTTTAVIEGHTDNVGSYNHNQDLSQRRAEAVVNYLVEQYGIERSRL 308

Query: 153 SVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           S +G+ +  PI  N T  G+Q N+RIE  I
Sbjct: 309 SAKGYGFTRPIADNATDEGKQKNRRIEAII 338



 Score = 94.7 bits (234), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 29/143 (20%), Positives = 64/143 (44%), Gaps = 1/143 (0%)

Query: 41  KRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHV-SFVSEVFLEKKFLPMLQLI 99
               +   K ++     + D    V ++       + + +     +  ++ ++   +  +
Sbjct: 320 ADNATDEGKQKNRRIEAIIDCAFDVQQVTPPDRLCMALVLDFDAGKADVKSQYRNEIAKV 379

Query: 100 ATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAY 159
           A  + ++ +T   I+ HTD+ G+ + N+ +SQ+RA  + +YL+         +S +G+  
Sbjct: 380 ADYMKRYNTTTAVIEGHTDNTGSPEKNMKLSQQRAQNVVNYLVDNFGIERSRLSAKGYGA 439

Query: 160 KYPIDTNDTKVGRQNNQRIEIQI 182
              I  N+T  GRQ N+RI   I
Sbjct: 440 TRRISYNNTPEGRQKNRRINAVI 462


>gi|52079917|ref|YP_078708.1| flagellar motor protein MotB [Bacillus licheniformis ATCC 14580]
 gi|52785288|ref|YP_091117.1| flagellar motor protein MotB [Bacillus licheniformis ATCC 14580]
 gi|52003128|gb|AAU23070.1| motility protein B [Bacillus licheniformis ATCC 14580]
 gi|52347790|gb|AAU40424.1| MotB [Bacillus licheniformis ATCC 14580]
          Length = 259

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 38/177 (21%), Positives = 78/177 (44%), Gaps = 9/177 (5%)

Query: 20  LASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQ----DTGIVVSRIGDMITCY 75
            ++ E  K      + ++   ++   SL K +++    ++       +      + +   
Sbjct: 76  TSTTEDGKSPDQAKDLSEAQKEKDKQSLKKIQEQVNRFIKEKNLQKQVNTKLTDEGLLLS 135

Query: 76  IPVHVSFV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTL----KNNLLIS 130
           I  ++ F   +  + ++ +P+ + ++ +L   P   I I  HTD++       K+N  +S
Sbjct: 136 IEDNIFFDSGKAEIRQQDIPLAKEVSDLLVLNPPRNIVISGHTDNVPIRNSQFKSNWHLS 195

Query: 131 QERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGN 187
             RA      LI+      +  S +G+    PI +NDT+ GR+ N+R+EI I P G 
Sbjct: 196 VMRAVNFMGLLIENPKLDAKIFSAKGYGEFKPIASNDTEEGRRKNRRVEILILPIGQ 252


>gi|39995916|ref|NP_951867.1| OmpA domain-containing protein [Geobacter sulfurreducens PCA]
 gi|39982680|gb|AAR34140.1| OmpA domain protein [Geobacter sulfurreducens PCA]
 gi|298504930|gb|ADI83653.1| OmpA domain porin [Geobacter sulfurreducens KN400]
          Length = 466

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 32/102 (31%), Positives = 55/102 (53%)

Query: 81  SFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSY 140
             + +  +  ++   ++ +A  L ++PST   I+ HTD++G    N+ +SQ RA+ + +Y
Sbjct: 233 FDIDKADVRPQYHDEVKRVADFLKEYPSTTAVIEGHTDNVGDDAYNMRLSQRRAESVVNY 292

Query: 141 LIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           L+         +S RGF    PI  N T+ G+Q N+RIE  I
Sbjct: 293 LVDNFGIDRTRLSARGFGKTRPIADNSTEAGKQRNRRIEAII 334



 Score = 96.6 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 30/146 (20%), Positives = 65/146 (44%), Gaps = 1/146 (0%)

Query: 37  DIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPML 96
              +   G   ++  +       +   V++ + D +   + V      +  ++ ++   +
Sbjct: 316 ADNSTEAGKQRNRRIEAIIDCALEDPKVIAALPDRLCIALKVQ-FDTDKWDIKPQYRGEI 374

Query: 97  QLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRG 156
             +   + + P+T   I+ HTD +GT  +N+ +S  RA+ + +YL++        +S +G
Sbjct: 375 AKVGDFMTRNPTTTAIIEGHTDRVGTADHNMKLSLRRAEAVVNYLVEHFGIERSRLSAKG 434

Query: 157 FAYKYPIDTNDTKVGRQNNQRIEIQI 182
           + +  PI  N T  GR  N+RI   I
Sbjct: 435 YGFSRPIAYNSTAEGRALNRRINAII 460


>gi|237740698|ref|ZP_04571179.1| outer membrane porin F [Fusobacterium sp. 2_1_31]
 gi|229422715|gb|EEO37762.1| outer membrane porin F [Fusobacterium sp. 2_1_31]
          Length = 340

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 37/169 (21%), Positives = 80/169 (47%), Gaps = 5/169 (2%)

Query: 17  GCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVV--SRIGDMITC 74
           G G  + + K + +             G + +      +   +   +    S   + +  
Sbjct: 171 GSGTYTDKSKNLVIENDGKGKAKITFNGQTTEVDAKPLEKPGKLEMVPPVPSIEANSLLI 230

Query: 75  YIPVHVSFV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQER 133
                + F   +  +  +   +L+ +AT+L +       I  +TDS G+ ++N ++S++R
Sbjct: 231 TSDSGILFDVDKYDVRPEDKEVLKNLATVLKEMNVKNFEIDGYTDSDGSDEHNQVLSEKR 290

Query: 134 ADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           A+ +K++L+ +GV++   I+ +G+    P+ +NDT  GRQ N+R+EI I
Sbjct: 291 ANSVKNFLVSQGVTAE--ITTKGYGESKPVASNDTAEGRQKNRRVEIII 337


>gi|329902399|ref|ZP_08273103.1| Outer membrane lipoprotein omp16 precursor [Oxalobacteraceae
           bacterium IMCC9480]
 gi|327548814|gb|EGF33448.1| Outer membrane lipoprotein omp16 precursor [Oxalobacteraceae
           bacterium IMCC9480]
          Length = 224

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 39/149 (26%), Positives = 70/149 (46%), Gaps = 3/149 (2%)

Query: 41  KRFGSSLDKAEDEFQMQLQDTGIVVSRI-GDMITCYIPVHVSFVSE-VFLEKKFLPMLQL 98
             + + ++  +   +   + TG+ V++   + +   IP  +SF +    ++  F P+L  
Sbjct: 77  NVWSTRMENQKQAMEQATRGTGVQVTQTADNRLKLAIPSDISFDTNRSDIKPDFRPVLDR 136

Query: 99  IATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFA 158
               LN   STV+ I  HTD+ G+   N  +S +RA   + YLI R   +    ++ G  
Sbjct: 137 FGNSLNDNASTVVTIIGHTDNTGSAAINDPLSVDRAGRTRDYLISR-GVAPYRFTIEGRG 195

Query: 159 YKYPIDTNDTKVGRQNNQRIEIQIFPRGN 187
              PI +N+   GR  N+R+EI +  R  
Sbjct: 196 ENDPIASNNDSTGRARNRRVEIFVAERQQ 224


>gi|326403344|ref|YP_004283425.1| hypothetical protein ACMV_11960 [Acidiphilium multivorum AIU301]
 gi|325050205|dbj|BAJ80543.1| hypothetical protein ACMV_11960 [Acidiphilium multivorum AIU301]
          Length = 215

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 38/142 (26%), Positives = 67/142 (47%), Gaps = 3/142 (2%)

Query: 43  FGSSLDKAEDEFQMQLQDTGIVVSRI-GDMITCYIP-VHVSFVSEVFLEKKFLPMLQLIA 100
           +   L+  +   Q   Q TG+ VS+   + +   +P           L  +  P+L  + 
Sbjct: 67  WNQHLEAQKQALQRTAQGTGVQVSQTADNRLKLNVPADAGFATGSATLNPRLYPILDQLG 126

Query: 101 TILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYK 160
             L + P+  + I  +TDS G+   N  +S  RA  +K+YL+ R   S + I+ RG   +
Sbjct: 127 QGLQQNPTETVQIIGYTDSTGSNAINYPLSDNRAASVKTYLVSR-GISGQRIATRGMGPQ 185

Query: 161 YPIDTNDTKVGRQNNQRIEIQI 182
            P+ +N T  GR  N+R++I +
Sbjct: 186 DPVASNATAAGRAANRRVDIYV 207


>gi|162448339|ref|YP_001610706.1| outer membrane porin precursor [Sorangium cellulosum 'So ce 56']
 gi|161158921|emb|CAN90226.1| outer membrane porin precursor [Sorangium cellulosum 'So ce 56']
          Length = 608

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 37/178 (20%), Positives = 71/178 (39%), Gaps = 6/178 (3%)

Query: 17  GC----GLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMI 72
            C    GL + +          D D +     +  ++     +   Q+   V  R+ +  
Sbjct: 431 ACPDLPGLVTTDPATNGCPGDTDGDGIRDDKDACPNEKGKPNEDPTQNGCPVAVRVTETE 490

Query: 73  TCYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPST-VIAIQSHTDSIGTLKNNLLISQ 131
              +        +  +      +L  +A +L   P    I +Q HTD  GT + N  +SQ
Sbjct: 491 IVILQQVQFDTGKATIRPVSNELLDEVAGVLKDHPEILKIEVQGHTDDRGTRQFNTKLSQ 550

Query: 132 ERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGNIK 189
            RA+ +   L++R   + + +  +G+    PI  N T+ GRQ N+R++  I  +   +
Sbjct: 551 ARAESVLKALVER-GIAAQRLQAKGYGPDVPIAENKTEAGRQKNRRVQFNIIEKEKKQ 607


>gi|307265590|ref|ZP_07547144.1| OmpA/MotB domain protein [Thermoanaerobacter wiegelii Rt8.B1]
 gi|306919388|gb|EFN49608.1| OmpA/MotB domain protein [Thermoanaerobacter wiegelii Rt8.B1]
          Length = 237

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 36/206 (17%), Positives = 72/206 (34%), Gaps = 23/206 (11%)

Query: 1   MIKELGLSMFIMTTIS----------GCGLASREKKKVFLHKSNDTD---IVNKRFGSSL 47
           MI  L +   +M TIS             L+       ++            N    +SL
Sbjct: 22  MITLLLIFFIVMYTISTINATKFAQIASSLSKTFTGTDYVIGQYSGSSFVQGNSGDKNSL 81

Query: 48  DKAEDEFQMQLQDTG----IVVSRIGDMITCYIPVHVSFV-SEVFLEKKFLPMLQLIATI 102
            + E +    +++      +        +   +   + F      +  +   +L  I  +
Sbjct: 82  GEIEKQLNGFIKENNLQGMVTSYIDERGLVISMQDSLLFDLGSADVHPEEKDVLIKIGNM 141

Query: 103 LNKFPSTVIAIQSHTDSIGTL----KNNLLISQERADVIKSYLIQRGVSSNRFISVRGFA 158
           L   P+  I ++  TD +        +N  +S  RA  +   L+       + IS  G+ 
Sbjct: 142 LKTLPN-HIRVEGFTDDLPIHNSKFDSNWELSVIRATNVVKILVNEVGIEPQRISAVGYG 200

Query: 159 YKYPIDTNDTKVGRQNNQRIEIQIFP 184
              P+  ND++  R+ N+R++I I  
Sbjct: 201 EYRPVVPNDSEEHRRLNRRVDIVIMN 226


>gi|310778794|ref|YP_003967127.1| OmpA/MotB domain protein [Ilyobacter polytropus DSM 2926]
 gi|309748117|gb|ADO82779.1| OmpA/MotB domain protein [Ilyobacter polytropus DSM 2926]
          Length = 208

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 52/207 (25%), Positives = 95/207 (45%), Gaps = 27/207 (13%)

Query: 2   IKELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIV--NKRFGSSLDKAEDEFQMQ-- 57
           +K++ + +  +  +SGC  A  E   +   + N   I   N   GS +D+ +        
Sbjct: 1   MKKIVVMLAALAALSGCSSADEETAMLNKMEKNLNKIEENNATTGSMIDQYKTRILDAKT 60

Query: 58  ---------------------LQDTGIVVSRIGDMITCYIP-VHVSFVSEVFLEKKFLPM 95
                                 +  G++V R  D +T  +P   V   ++  +++ F P+
Sbjct: 61  NVANLEKDINAIDSFINPETVFEKNGVIVKRERDQLTLIMPTDVVFDFNKSEIKEDFKPL 120

Query: 96  LQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVR 155
           L  +   L  +    + I  HTD+IG+   NL +SQ+RA+  K YL+ +G+++ R I+  
Sbjct: 121 LDSLYEALTIYKGLSVKIDGHTDNIGSYDYNLKLSQKRAESAKEYLVSKGLNAGRIIT-E 179

Query: 156 GFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           G ++  P  +N T+ GR  N+RIE+ I
Sbjct: 180 GHSFSTPAASNATQAGRDKNRRIEVVI 206


>gi|209694505|ref|YP_002262433.1| flagellar motor protein MotB [Aliivibrio salmonicida LFI1238]
 gi|208008456|emb|CAQ78622.1| sodium-driven polar flagellar protein MotB [Aliivibrio salmonicida
           LFI1238]
          Length = 309

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 35/174 (20%), Positives = 74/174 (42%), Gaps = 7/174 (4%)

Query: 15  ISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITC 74
           ++G   +S   +        ++   N+      +  +   + ++ +  + V  +G  +  
Sbjct: 123 LTGGESSSTSTQTNA-QSDAESQSQNQSQQELEETIKKALEREIAEGAVEVENLGQQLVI 181

Query: 75  YIPVHVSFV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGT----LKNNLLI 129
            I    +F     FL+ KF P+++ I  ++   P   I +  HTD+        ++N  +
Sbjct: 182 RIREKGAFPAGSAFLQPKFRPLIRQIGELVKDVPGI-IRVSGHTDNQPLESELYRSNWDL 240

Query: 130 SQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
           S +RA  +   +++    ++  + VRG A   P+  N T   R  N+R+EI I 
Sbjct: 241 SAQRAVSVGHEMLRVKGFNSDRLRVRGMASTEPLGPNKTAAQRARNRRVEISIM 294


>gi|83643650|ref|YP_432085.1| outer membrane protein and related peptidoglycan-associated
           (lipo)protein [Hahella chejuensis KCTC 2396]
 gi|83631693|gb|ABC27660.1| Outer membrane protein and related peptidoglycan-associated
           (lipo)protein [Hahella chejuensis KCTC 2396]
          Length = 464

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 36/178 (20%), Positives = 68/178 (38%), Gaps = 15/178 (8%)

Query: 16  SGCGLASREKKKVFLHKSNDTDIVNKRF-----GSSLDKAEDEFQMQLQDT-----GIVV 65
           +GC +   +      ++ +              G  LD   D     L        G  V
Sbjct: 275 TGCPVVGDDDADGVPNEKDQCPNSPAAAKVDSRGCPLDTDRDGITDGLDACPDTPYGAKV 334

Query: 66  SRIGDMITCYIPVHV-----SFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSI 120
              G  I     V +        +   +  +F+  ++ +A  + ++P T   ++ HTD  
Sbjct: 335 DNRGCRIQLSETVTITLNVTFPTNSAAITDEFVSEVEKLAEFMRQYPDTKAVVEGHTDDR 394

Query: 121 GTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRI 178
           G    N  +S++RA  ++  +++R   +   IS  G+    PI  N+T  GR  N+R+
Sbjct: 395 GQDAYNQKLSEKRASAVRQMVVERFGIAGERISSVGYGETRPIGDNNTADGRSANRRV 452


>gi|148652191|ref|YP_001279284.1| OmpA/MotB domain-containing protein [Psychrobacter sp. PRwf-1]
 gi|148571275|gb|ABQ93334.1| OmpA/MotB domain protein [Psychrobacter sp. PRwf-1]
          Length = 403

 Score =  105 bits (261), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 31/179 (17%), Positives = 69/179 (38%), Gaps = 1/179 (0%)

Query: 11  IMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGD 70
           +   +     A+ E   V + +++     +          +      + + G  V    D
Sbjct: 214 LAPAVVAPPQATVEPTPVIVVEADQDSDNDGVIDRLDQCPDTPVNTVVDENGCPVQVQID 273

Query: 71  MITCYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGT-LKNNLLI 129
                         +  +++++ P +  +A  + ++P++  +I+ H    G   + N  +
Sbjct: 274 DELKMELRVFFDNDKSVIKEQYKPEIAKVAEKMREYPNSSASIEGHASKTGPSARYNQRL 333

Query: 130 SQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGNI 188
           S+ RA  +K+ L      +   +S  G+ Y  PI  NDT+ GR  N+R+   I     +
Sbjct: 334 SEARAIAVKTMLTNEFGVAPNRLSTVGYGYDRPIAPNDTEEGRAMNRRVYAVITGNKTM 392


>gi|226952116|ref|ZP_03822580.1| peptidoglycan-associated lipoprotein precursor [Acinetobacter sp.
           ATCC 27244]
 gi|294648350|ref|ZP_06725858.1| peptidoglycan-associated lipoprotein [Acinetobacter haemolyticus
           ATCC 19194]
 gi|226837144|gb|EEH69527.1| peptidoglycan-associated lipoprotein precursor [Acinetobacter sp.
           ATCC 27244]
 gi|292825762|gb|EFF84457.1| peptidoglycan-associated lipoprotein [Acinetobacter haemolyticus
           ATCC 19194]
          Length = 187

 Score =  105 bits (261), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 32/180 (17%), Positives = 65/180 (36%), Gaps = 6/180 (3%)

Query: 2   IKELGLSMFIMTTI-SGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQD 60
           +K L L +   T + +GC      +K      + +T          L +        L  
Sbjct: 3   MKYLSLPLIAATLVFTGCAS----RKPATDITAGNTPTGTTVSTEGLSEDAALNAQNLAG 58

Query: 61  TGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSI 120
                    +       V         L  +    LQ  A  L    ++ +A+  HTD  
Sbjct: 59  ASAKGVTAANKAFLAKRVVHFDYDSSELSNEDYQTLQAHAQFLVANANSRVALTGHTDER 118

Query: 121 GTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEI 180
           GT + N+ + + RA  ++S+L+     + + +    +  + P++    +   + N+R+EI
Sbjct: 119 GTREYNMALGERRAKAVESFLVTN-GVNPQQLEAVSYGKEAPVNPGHNEAAWKENRRVEI 177


>gi|124267239|ref|YP_001021243.1| outer membrane protein [Methylibium petroleiphilum PM1]
 gi|124260014|gb|ABM95008.1| outer membrane protein [Methylibium petroleiphilum PM1]
          Length = 235

 Score =  105 bits (261), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 37/166 (22%), Positives = 70/166 (42%), Gaps = 3/166 (1%)

Query: 19  GLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDM-ITCYIP 77
           G + +         +    +    +   +++     +   Q TG+ V+R  D  +   +P
Sbjct: 57  GDSKKGAATGAAIGALGGAVAGNVWSKKMEEKRRAMEQSTQGTGVDVTRTADNQLKLNVP 116

Query: 78  VHV-SFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADV 136
             +     +  ++ +   +L   A  L   P+  + +  HTDS G+   N  +S +RA  
Sbjct: 117 SDISFDTGKSAIKPELRTVLDSFANGLANDPALQVRVIGHTDSTGSDAINNPLSVDRAQS 176

Query: 137 IKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           ++ YL  RG+   R I   G     PI  N ++ GR  N+R+EI +
Sbjct: 177 VRDYLAGRGILPTR-IETSGRGSHEPIADNTSEAGRAKNRRVEILL 221


>gi|254292855|ref|YP_003058878.1| OmpA/MotB domain protein [Hirschia baltica ATCC 49814]
 gi|254041386|gb|ACT58181.1| OmpA/MotB domain protein [Hirschia baltica ATCC 49814]
          Length = 222

 Score =  105 bits (261), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 48/220 (21%), Positives = 92/220 (41%), Gaps = 37/220 (16%)

Query: 1   MIKELGLSMFIM-TTISGCGLASREKKK--------------------VFLHKSNDTDIV 39
           M   + L+       ++GC       ++                      L  ++  +  
Sbjct: 1   MKNIIALAALSTTILVAGCQTTDPYSRETKTSNTAKGAAIGALGGAVLGALTNTSSGEQA 60

Query: 40  NKR--------------FGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VS 84
            K                G  +D+ E + + +L +TG+ V+R+GD I   +P  ++F   
Sbjct: 61  AKNAMIGAGIGAIAGGASGRYMDQQEKKLRERLDETGVGVTRVGDTIQLVMPGDITFATG 120

Query: 85  EVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQR 144
              +  +F  +LQ +  +L +F  TV+ I  HTD++G+ + N  +SQ RA+ + + L+Q 
Sbjct: 121 RAEINNQFDYVLQDVGLVLQEFDKTVVFIDGHTDTVGSYQKNDELSQARANNVAARLMQE 180

Query: 145 GVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           G+   R + V G+            V    N+R+EI++ P
Sbjct: 181 GILGGRLV-VTGYGESRLKVPTGDGVNEPLNRRVEIRLEP 219


>gi|171320878|ref|ZP_02909877.1| OmpA/MotB domain protein [Burkholderia ambifaria MEX-5]
 gi|171093863|gb|EDT38995.1| OmpA/MotB domain protein [Burkholderia ambifaria MEX-5]
          Length = 214

 Score =  105 bits (261), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 41/207 (19%), Positives = 73/207 (35%), Gaps = 27/207 (13%)

Query: 2   IK---ELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSL----------- 47
           +K    L +       ++GC         V                              
Sbjct: 3   MKIATRLSVFALAGALLAGCATQQGNNAAVGTGTGAALGAGIGALAGGGKGAAIGAGVGA 62

Query: 48  ----------DKAEDEFQMQLQDTGIVVSRIGDM-ITCYIPVHVSFVSE-VFLEKKFLPM 95
                        +++       TG  V+   D  +   +P  V+F +    +   F P+
Sbjct: 63  LVGGVTGYNWQAIKNKLAPSAAQTGTQVTEQPDGSLKLNVPSSVTFATNQYAITPAFTPL 122

Query: 96  LQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVR 155
           L  +AT LN+ P    ++  +TDS G+ + N  +SQ RA  + +  + +   +   +S +
Sbjct: 123 LNDLATTLNQNPQLTGSVVGYTDSTGSAQLNQTLSQNRAQSVVN-ALGQRGVAGGRLSAQ 181

Query: 156 GFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           G     PI  N T  GR  N+R+EI +
Sbjct: 182 GMGASNPIADNATDAGRAQNRRVEIYL 208


>gi|332664040|ref|YP_004446828.1| OmpA/MotB domain-containing protein [Haliscomenobacter hydrossis
           DSM 1100]
 gi|332332854|gb|AEE49955.1| OmpA/MotB domain protein [Haliscomenobacter hydrossis DSM 1100]
          Length = 651

 Score =  105 bits (261), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 33/120 (27%), Positives = 61/120 (50%), Gaps = 1/120 (0%)

Query: 64  VVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTL 123
            +    D     +       +   L ++  P L  +A +LN+ P+  I I  HTD++GT 
Sbjct: 533 DLVANKDQAPVVLRNVFFETASAALRQESGPELDHLADLLNQNPNLRIQINGHTDNVGTD 592

Query: 124 KNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
            +NL +S++RA  + +YL+ +   +   ++ +GF    PI  N+T+ GR+ N+R E  + 
Sbjct: 593 ADNLRLSEQRAKAVYTYLVGK-GIAAERLAYKGFGETQPIADNNTEEGRKVNRRTEFVVL 651


>gi|77361278|ref|YP_340853.1| flagellar motor protein MotB [Pseudoalteromonas haloplanktis
           TAC125]
 gi|76876189|emb|CAI87411.1| sodium-driven polar flagellar protein [Pseudoalteromonas
           haloplanktis TAC125]
          Length = 306

 Score =  105 bits (261), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 47/174 (27%), Positives = 75/174 (43%), Gaps = 7/174 (4%)

Query: 22  SREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVS 81
           SR   K    +   +    ++    + K   + + Q+ D  I +  +G  I   I  + S
Sbjct: 128 SRSTSKEQASEQAISAADQQQTNDLVKKIAQQLEKQIIDGAIELESLGQQIIIRIRENGS 187

Query: 82  FV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTD----SIGTLKNNLLISQERADV 136
           F     FL+ KF P++Q I  +L   P   I +  HTD    S     NN  +S +RA  
Sbjct: 188 FPSGSAFLQPKFKPIIQEIGVLLKDVPG-EITVSGHTDDFQVSNELYINNWDLSSKRAVA 246

Query: 137 IKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGNIKK 190
           + S L +        + V G A   P+  ND+   R+ N+R+EI I  +G  K+
Sbjct: 247 VASELQKVVGFDKNRMMVVGRAETRPLVPNDSNEDRRRNRRVEISIL-QGKAKE 299


>gi|332977451|gb|EGK14226.1| outer membrane protein [Psychrobacter sp. 1501(2011)]
          Length = 383

 Score =  105 bits (261), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 36/191 (18%), Positives = 73/191 (38%), Gaps = 9/191 (4%)

Query: 7   LSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQ-DTGIVV 65
           + +  +  + G  LA        + +     +V     S  D   D           +VV
Sbjct: 182 MGLAGLEVVLGGHLAPAVVAPATMVEPTPVFVVEADQDSDGDGVIDRLDQCPNTPANVVV 241

Query: 66  SRIGDMITCYIPV-------HVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTD 118
              G  +   I               +  +++++ P +  +A  + ++P++  +I+ H  
Sbjct: 242 DETGCPVQVQIDDELKMELRVFFDNDKSVIKEQYKPEIAKVAEKMREYPNSSASIEGHAS 301

Query: 119 SIGT-LKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQR 177
             G   + N  +S+ RA  +K+ L      +   +S  G+ Y  PI  NDT+ GR  N+R
Sbjct: 302 KTGPSARYNQRLSEARAIAVKTMLTNEFGVAPNRLSTVGYGYDRPIAPNDTEEGRAMNRR 361

Query: 178 IEIQIFPRGNI 188
           +   I    ++
Sbjct: 362 VYAVITGNKSM 372


>gi|329895993|ref|ZP_08271251.1| Flagellar motor rotation protein MotB [gamma proteobacterium
           IMCC3088]
 gi|328922074|gb|EGG29437.1| Flagellar motor rotation protein MotB [gamma proteobacterium
           IMCC3088]
          Length = 354

 Score =  105 bits (261), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 42/174 (24%), Positives = 71/174 (40%), Gaps = 8/174 (4%)

Query: 20  LASREKKKVFLHKSNDTDIVNKRFG-SSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPV 78
            +  +  +    ++N         G S L++       ++  + + V    D I   +  
Sbjct: 182 SSPSDSAESAQSQANAPAPPEDDIGDSDLEQIRQNLAPEISRSLVNVEMDQDQIKITLAD 241

Query: 79  HVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERAD-- 135
             +F      L  +FL +L  +   ++     V+ +  HTDSI    +    S       
Sbjct: 242 QGAFVSGSADLRPEFLQLLNRVGDSISDT-DGVVTVSGHTDSIPMAFSMRFKSNWDLSAA 300

Query: 136 ---VIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRG 186
               +  YLI +G   +  +SV+G+A   PI TNDT  GR  N+RIEI I  +G
Sbjct: 301 RSASVADYLITQGYLGDIEVSVQGYADTVPIATNDTAEGRAKNRRIEIMIDKKG 354


>gi|197124706|ref|YP_002136657.1| OmpA/MotB domain protein [Anaeromyxobacter sp. K]
 gi|196174555|gb|ACG75528.1| OmpA/MotB domain protein [Anaeromyxobacter sp. K]
          Length = 206

 Score =  105 bits (261), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 44/206 (21%), Positives = 76/206 (36%), Gaps = 30/206 (14%)

Query: 1   MIK---ELGLSMFIMTTISGCGLASREK--------------------KKVFLHKSNDTD 37
           M K    L  ++  +   +GC  A +                      KK  L  +    
Sbjct: 1   MNKTSLRLTAAVTAVLLFAGCQTAGKRTAIGAGAGGLAGAGVGALIGGKKGALIGAGVGA 60

Query: 38  IVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV-SEVFLEKKFLPML 96
           +     G  LDK   E +           R  + +   +   + F      L+ + +  L
Sbjct: 61  LAGGSVGLYLDKQHKELEKI-----AETKRTENGLLVEMKGDILFDSGSSALKPEAISKL 115

Query: 97  QLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRG 156
           + +  +L K+    I I+ +TD+ G+   N  +S  RAD +K  L+ R     + I+  G
Sbjct: 116 EQMGDVLAKYGDDRIRIEGYTDATGSKSMNEELSLRRADAVKRVLVGR-GVQEKQITALG 174

Query: 157 FAYKYPIDTNDTKVGRQNNQRIEIQI 182
                P+  N T  GR  N+R+E+ I
Sbjct: 175 MGPVRPVADNGTASGRAQNRRVELHI 200


>gi|148259686|ref|YP_001233813.1| OmpA/MotB domain-containing protein [Acidiphilium cryptum JF-5]
 gi|146401367|gb|ABQ29894.1| OmpA/MotB domain protein [Acidiphilium cryptum JF-5]
          Length = 227

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 38/142 (26%), Positives = 67/142 (47%), Gaps = 3/142 (2%)

Query: 43  FGSSLDKAEDEFQMQLQDTGIVVSRI-GDMITCYIP-VHVSFVSEVFLEKKFLPMLQLIA 100
           +   L+  +   Q   Q TG+ VS+   + +   +P           L  +  P+L  + 
Sbjct: 79  WNQHLEAQKQALQRTAQGTGVQVSQTADNRLKLNVPADAGFATGSATLNPRLYPILDQLG 138

Query: 101 TILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYK 160
             L + P+  + I  +TDS G+   N  +S  RA  +K+YL+ R   S + I+ RG   +
Sbjct: 139 QGLQQNPTETVQIIGYTDSTGSNAINYPLSDNRAASVKTYLVSR-GISGQRIATRGMGPQ 197

Query: 161 YPIDTNDTKVGRQNNQRIEIQI 182
            P+ +N T  GR  N+R++I +
Sbjct: 198 DPVASNATAAGRAANRRVDIYV 219


>gi|325272915|ref|ZP_08139241.1| OmpA/MotB domain protein [Pseudomonas sp. TJI-51]
 gi|324101950|gb|EGB99470.1| OmpA/MotB domain protein [Pseudomonas sp. TJI-51]
          Length = 145

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 43/129 (33%), Positives = 70/129 (54%), Gaps = 2/129 (1%)

Query: 57  QLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQS 115
           Q+ +TG+ V R GD I   +P +++F      +   F   L  +A+   +F    I +  
Sbjct: 1   QMANTGVEVQRQGDQIKLIMPGNITFATDSANIAPSFYQPLNNLASSFKQFNQNTIEVVG 60

Query: 116 HTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNN 175
            TDS G+ ++N+ +SQ RA  + +YL  +GV S+R +SVRG     PI +N    GR  N
Sbjct: 61  FTDSTGSRQHNMDLSQRRAQAVSTYLTSQGVDSSR-LSVRGMGPDQPIASNADANGRAQN 119

Query: 176 QRIEIQIFP 184
           +R+E+ + P
Sbjct: 120 RRVEVNLKP 128


>gi|226940371|ref|YP_002795445.1| Outer membrane protein A [Laribacter hongkongensis HLHK9]
 gi|226715298|gb|ACO74436.1| Outer membrane protein A [Laribacter hongkongensis HLHK9]
          Length = 226

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 47/185 (25%), Positives = 81/185 (43%), Gaps = 7/185 (3%)

Query: 6   GLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQ-----D 60
            L       I     + +++ K  L  +    +     G  +D+   +FQ QL       
Sbjct: 39  ILGTLGGAAIGAAVSSKKDRSKGALIGAIGGGLAGAGIGQYMDRQARDFQRQLATQIRDG 98

Query: 61  TGIVVSRIGDMITCYIPVHV-SFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDS 119
              VV R  + I   +        +   L+  F+P +  I+ I+N++  T + I  HTDS
Sbjct: 99  QIFVVKRADNSILVTMTSQTAFDTNSASLKPGFMPTINTISRIVNQYGKTTLDITGHTDS 158

Query: 120 IGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIE 179
            G  + N+ +SQ RA  +++ L+ R     + +S  G     P  +N ++ GRQ N+R+E
Sbjct: 159 TGNDRINVPLSQNRAAAVQNALLSR-NVHPQRLSAYGMGASQPRASNASEAGRQLNRRVE 217

Query: 180 IQIFP 184
           I I P
Sbjct: 218 ILIEP 222


>gi|89100891|ref|ZP_01173740.1| flagellar motor protein [Bacillus sp. NRRL B-14911]
 gi|89084378|gb|EAR63530.1| flagellar motor protein [Bacillus sp. NRRL B-14911]
          Length = 269

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 42/176 (23%), Positives = 69/176 (39%), Gaps = 9/176 (5%)

Query: 19  GLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGI----VVSRIGDMITC 74
             A+   ++       +  I        L + E++ +  +Q+ G+      S   + +  
Sbjct: 93  ASAAGTLEEGQNDMEAEGKIQKLTDKQELKEVEEKVKTYIQNNGLTDKLETSLTDEGLLV 152

Query: 75  YIPVHVSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGT----LKNNLLI 129
            I  +V F      +    L +   I  +L   P   I I  HTD++       ++N  +
Sbjct: 153 TIRDNVFFASGSAEVRSGELTIADEIGELLVMDPPRNIIISGHTDNMPIKNSEFESNWEL 212

Query: 130 SQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPR 185
           S  RA      L+       R  S +GF    P  +NDTK GR  N+R+EI I PR
Sbjct: 213 SVMRAVNFMKILLHNKDLDARAFSAKGFGEFQPAASNDTKEGRDKNRRVEILILPR 268


>gi|119897129|ref|YP_932342.1| outer membrane protein [Azoarcus sp. BH72]
 gi|119669542|emb|CAL93455.1| conserved hypothetical outer membrane protein [Azoarcus sp. BH72]
          Length = 224

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 48/218 (22%), Positives = 87/218 (39%), Gaps = 38/218 (17%)

Query: 2   IKELGLSMFIMTTIS----GCGLASREKK----------------------KVFLHKSND 35
           +K + +S+  ++ ++    GC   S  ++                      K    ++  
Sbjct: 1   MKRIVISLSCLSLVAAGLGGCAGMSDTQRHTGTGAAIGAAAGAVLGAATSGKGNRGEATA 60

Query: 36  TDIVNKR---------FGSSLDKAEDEFQMQLQDTGIVVSRI-GDMITCYIPVHV-SFVS 84
                           +   +   + E +     TG+ VS+   + +   IP  V     
Sbjct: 61  IGAAAGAAIGAGGGYLWSQRMQAQKAEMERATAGTGVSVSQTADNRLKLDIPSDVSFDTG 120

Query: 85  EVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQR 144
              ++ +  P+L   A  LN+   T ++I  HTDS G+   N  +S  RA   + YL+ R
Sbjct: 121 RYDIKPEMRPVLDRFANTLNQHTVTTVSIIGHTDSTGSDAVNNPLSVNRAAATRDYLVAR 180

Query: 145 GVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           GV+ +R I++ G   + PI  N T  GR  N+R+EI +
Sbjct: 181 GVAGSR-IAIDGRGAREPIADNGTVAGRAQNRRVEIFV 217


>gi|149194324|ref|ZP_01871421.1| Thrombospondin type 3 repeat:OmpA/MotB [Caminibacter mediatlanticus
           TB-2]
 gi|149135499|gb|EDM23978.1| Thrombospondin type 3 repeat:OmpA/MotB [Caminibacter mediatlanticus
           TB-2]
          Length = 209

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 46/204 (22%), Positives = 82/204 (40%), Gaps = 27/204 (13%)

Query: 2   IKELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQ------ 55
           +K+    + I     GC         V L  +    ++     ++  K + +        
Sbjct: 1   MKKYLFFIGISLFFIGCADKPLATNVVDLAGNK--KVIGWDDKNNTQKCKPKVVVKEIVK 58

Query: 56  ----MQLQDTGI--------------VVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQ 97
                     G+               V   G  I   + ++  F ++  ++K + P ++
Sbjct: 59  YKELKDSDGDGVPDIKDKCPNTPKNLTVDHNGCPIITTLRINFDF-NKWNVKKIYYPQIK 117

Query: 98  LIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGF 157
            +A IL   P+  I +  HTD+IG+ K NL +SQ+RA+ +K  L+     +   I  RG+
Sbjct: 118 KVAEILKANPNLKIEVAGHTDNIGSAKYNLKLSQKRAEAVKKILVNVYHINPNRIVARGY 177

Query: 158 AYKYPIDTNDTKVGRQNNQRIEIQ 181
             KYP+  N T   R  N+R+EI 
Sbjct: 178 GEKYPLVPNTTSTNRALNRRVEII 201


>gi|153002898|ref|YP_001377223.1| OmpA/MotB domain-containing protein [Anaeromyxobacter sp. Fw109-5]
 gi|152026471|gb|ABS24239.1| OmpA/MotB domain protein [Anaeromyxobacter sp. Fw109-5]
          Length = 510

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 41/163 (25%), Positives = 66/163 (40%), Gaps = 3/163 (1%)

Query: 22  SREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHV- 80
             E+    L      D          DK   E      +    V    +     +   V 
Sbjct: 345 PSEQGLAELKGCAAKDGDGDGVPDHQDKCPAEAGSADNEGCPRVVVEKEAKKVELREKVQ 404

Query: 81  SFVSEVFLEKKFLPMLQLIATILNKFPS-TVIAIQSHTDSIGTLKNNLLISQERADVIKS 139
               +  ++ +   +L  IA +L +    T + I+ H+DS G    N  +SQ RAD +  
Sbjct: 405 FDTGKATIKPESAGLLDEIAKVLAEHAEITRVVIEGHSDSSGGAALNKRLSQARADAVLK 464

Query: 140 YLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
            L++R   +   +S +GF    PI +NDT  GR+ N+R+EI I
Sbjct: 465 ALVER-GIAKERLSAKGFGPSRPIASNDTPEGREANRRVEISI 506


>gi|332799185|ref|YP_004460684.1| OmpA/MotB domain-containing protein [Tepidanaerobacter sp. Re1]
 gi|332696920|gb|AEE91377.1| OmpA/MotB domain protein [Tepidanaerobacter sp. Re1]
          Length = 226

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 34/166 (20%), Positives = 68/166 (40%), Gaps = 9/166 (5%)

Query: 30  LHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDT---GIVVSRIGDMITCYIPVHVSFV-SE 85
                 + +++       +  E++ Q  + +    G+ V+     +       V F   +
Sbjct: 56  EAGDAGSFLISAEEQREFELLEEKIQKIIDEDNIGGVQVNLDERGLVVRFVEGVLFDSGK 115

Query: 86  VFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKN----NLLISQERADVIKSYL 141
             +      +L  +A +L +     I I+ HTD++    +    N  +S  RA  +  Y+
Sbjct: 116 ADIRNDAKEILDKLAPLLIE-SHRQIRIEGHTDNLPIHTSEFPSNWELSTARAVNVVKYM 174

Query: 142 IQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGN 187
           I+R   S   IS  G++   PI  ND++  R  N+R++I I    +
Sbjct: 175 IERHNLSPYIISAAGYSEYRPIAPNDSEKNRALNRRVDIIILKSAS 220


>gi|330817987|ref|YP_004361692.1| OmpA family protein [Burkholderia gladioli BSR3]
 gi|327370380|gb|AEA61736.1| OmpA family protein [Burkholderia gladioli BSR3]
          Length = 216

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 38/202 (18%), Positives = 70/202 (34%), Gaps = 24/202 (11%)

Query: 4   ELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSL---------------- 47
            L +       ++GC         V                                   
Sbjct: 8   RLSVFALAGALLAGCASPQGNNTAVGTGAGAALGAGIGALAGGGKGAAIGAGVGALVGGV 67

Query: 48  -----DKAEDEFQMQLQDTGIVVSRIGDM-ITCYIPVHVSF-VSEVFLEKKFLPMLQLIA 100
                   ++      Q TG  V+   D  +   +P  V+F   +  +   F P+L  +A
Sbjct: 68  TGYNWQAIKNRLAPSAQKTGTQVTEQPDGSLKLNVPSSVTFATDQYAITPAFAPLLNDLA 127

Query: 101 TILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYK 160
           + LN+ P    ++  +TDS G+  +N  +SQ RA  +    + +   +   +  +G    
Sbjct: 128 STLNQNPQITASVVGYTDSTGSAAHNQTLSQNRAQSVV-TALVQRGVAGGRLGAQGMGAS 186

Query: 161 YPIDTNDTKVGRQNNQRIEIQI 182
            P+  N T+ GR  N+R+EI +
Sbjct: 187 NPVADNATEAGRAQNRRVEIYL 208


>gi|313675126|ref|YP_004053122.1| ompa/motb domain protein [Marivirga tractuosa DSM 4126]
 gi|312941824|gb|ADR21014.1| OmpA/MotB domain protein [Marivirga tractuosa DSM 4126]
          Length = 699

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 34/159 (21%), Positives = 72/159 (45%), Gaps = 1/159 (0%)

Query: 25  KKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVS 84
             + +   S +  I N+    ++++   E +   +   + +  +       +       +
Sbjct: 534 SDRGYAFNSTEIGISNEGKLQTINEETGEIEEDSKGVELKLQPLAKDANLTLKDIYFESN 593

Query: 85  EVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQR 144
              L +     L  +  ++  +PS  I I +HTD +G+   N  +SQERA+ + SY+   
Sbjct: 594 SSALFESSFEELDRVIKLMKSYPSMKIEIAAHTDDVGSAAYNTRLSQERANSVISYITGN 653

Query: 145 GVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
            ++  R IS +G+    P+  ND++  R  N+R+E++I 
Sbjct: 654 SIAEGRLIS-KGYGESKPVVANDSEENRAKNRRVELKIL 691


>gi|238028341|ref|YP_002912572.1| OmpA family protein [Burkholderia glumae BGR1]
 gi|237877535|gb|ACR29868.1| OmpA family protein [Burkholderia glumae BGR1]
          Length = 219

 Score =  104 bits (260), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 47/202 (23%), Positives = 78/202 (38%), Gaps = 24/202 (11%)

Query: 4   ELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSL---------------- 47
            L +       ++GC         V                                   
Sbjct: 8   RLSVFAIAGALLAGCATPQGNNTAVGTGAGAALGAGIGALAGGGKGAAIGAGIGALAGGV 67

Query: 48  -----DKAEDEFQMQLQDTGIVVSRIGDM-ITCYIPVHVSF-VSEVFLEKKFLPMLQLIA 100
                   ++      Q TG  V+   D  +   +P  V+F   +  +   F P+L  +A
Sbjct: 68  AGYNWQAIKNRLAPSAQSTGTQVTEQPDGSLKLNVPSSVTFATDQYAITPAFAPLLNELA 127

Query: 101 TILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYK 160
           T LN+ P    ++  +TDS G+  +NL +SQ RA  + + L+QRGV+ +R +S +G    
Sbjct: 128 TSLNQNPQITASVVGYTDSTGSAAHNLTLSQNRAQSVVTALVQRGVAGSR-LSAQGMGAS 186

Query: 161 YPIDTNDTKVGRQNNQRIEIQI 182
            P+  N T  GR  N+R+EI +
Sbjct: 187 NPVADNATDAGRAQNRRVEIYL 208


>gi|297538999|ref|YP_003674768.1| peptidoglycan-associated lipoprotein [Methylotenera sp. 301]
 gi|297258346|gb|ADI30191.1| peptidoglycan-associated lipoprotein [Methylotenera sp. 301]
          Length = 180

 Score =  104 bits (260), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 29/181 (16%), Positives = 66/181 (36%), Gaps = 6/181 (3%)

Query: 2   IKELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDT 61
           +K++ + + +   IS C  +  ++    + K      V     +  +           + 
Sbjct: 1   MKKILVPLLLAGMISACAGSHVKEAPSNVAK----MPVASPKQAEPESPPPAVTSSAPEN 56

Query: 62  GIVVSRIGD-MITCYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSI 120
            I V+ + D               +  ++ ++  +L+  A  L   P   I I+ + D  
Sbjct: 57  KIEVNPLTDPNNILSKRSVYFDFDKYVVKPEYRTLLEAHAKYLLSHPEKSIRIEGNADDR 116

Query: 121 GTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEI 180
           G+ + NL + Q+RA  +   L       ++ I    +  + P  T + +     N+R +I
Sbjct: 117 GSREYNLALGQKRAVAV-KSLANLLGVPDKQIETISYGEEKPKATGEDETSWAENRRADI 175

Query: 181 Q 181
            
Sbjct: 176 V 176


>gi|239827803|ref|YP_002950427.1| flagellar motor protein MotB [Geobacillus sp. WCH70]
 gi|239808096|gb|ACS25161.1| OmpA/MotB domain protein [Geobacillus sp. WCH70]
          Length = 251

 Score =  104 bits (260), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 35/174 (20%), Positives = 68/174 (39%), Gaps = 5/174 (2%)

Query: 22  SREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVS 81
           S  K++    + N      +   +  +K +     +  +  +  S   + +   I   + 
Sbjct: 77  SPSKQEHKQQQKNSNKEDKEELHAVQEKIDTYIAEKHLNGKLQTSLTDEGLAITILNDIL 136

Query: 82  FV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIG----TLKNNLLISQERADV 136
           F      +  K   + + I+ +L   P   I I  HTD++        +N  +S  RA  
Sbjct: 137 FDSGSAEVRPKDRKLAKEISQLLVMNPPRNIIISGHTDNVPIHNAQFASNWELSVMRAIN 196

Query: 137 IKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGNIKK 190
               L++      R+ S +G+    P+  N+T  GR  N+R+EI I P+    +
Sbjct: 197 FMKILLENPELDPRWFSAKGYGEFKPVAPNNTPEGRMKNRRVEILILPKTEASR 250


>gi|104780902|ref|YP_607400.1| outer membrane protein OprF [Pseudomonas entomophila L48]
 gi|95109889|emb|CAK14594.1| outer membrane protein OprF [Pseudomonas entomophila L48]
          Length = 346

 Score =  104 bits (260), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 34/175 (19%), Positives = 65/175 (37%), Gaps = 10/175 (5%)

Query: 17  GCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYI 76
           G     +            +D  N     ++DK  D          + V   G      +
Sbjct: 178 GGSGGQKAAPAPAPVAEVCSDSDNDGVCDNVDKCPD------TPANVTVDADGCPAVAEV 231

Query: 77  P----VHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQE 132
                       +  ++      ++ +A  + ++P T   ++ HTDS+G    N  +S+ 
Sbjct: 232 VRVELDVKFDFDKSVVKPNSYADIKNLADFMKQYPQTTTTVEGHTDSVGPDAYNQKLSER 291

Query: 133 RADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGN 187
           RA  +K  L Q+    +  +S  G+    P+  N T+ GR  N+R+E Q+  +  
Sbjct: 292 RAKAVKDVLTQQYGVESGRVSSVGYGETRPVADNATEAGRAVNRRVEAQVEAQAK 346


>gi|20807043|ref|NP_622214.1| flagellar motor protein [Thermoanaerobacter tengcongensis MB4]
 gi|254479612|ref|ZP_05092920.1| OmpA family protein [Carboxydibrachium pacificum DSM 12653]
 gi|20515530|gb|AAM23818.1| Flagellar motor protein [Thermoanaerobacter tengcongensis MB4]
 gi|214034455|gb|EEB75221.1| OmpA family protein [Carboxydibrachium pacificum DSM 12653]
          Length = 237

 Score =  104 bits (260), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 27/155 (17%), Positives = 53/155 (34%), Gaps = 6/155 (3%)

Query: 35  DTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV-SEVFLEKKFL 93
                    G    + +   +       +   R    +   +   + F      +  +  
Sbjct: 73  GNAENKDNLGEVQAQLQAFIKESNLQGMVSTYRDERGLVVSLQDTLLFDLGSADVHPEEK 132

Query: 94  PMLQLIATILNKFPSTVIAIQSHTDSIGTLKN----NLLISQERADVIKSYLIQRGVSSN 149
            +L  I  +L   P+  I ++  TD +         N  +S  RA  +   L+       
Sbjct: 133 EVLIKIGKMLKNLPNY-IRVEGFTDDLPIHNQKFDSNWELSVIRATTVVKILVNEVGIEP 191

Query: 150 RFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           + IS  G+    PI  ND++  R+ N+R++I I  
Sbjct: 192 QRISAVGYGEYRPIVPNDSEEHRRLNRRVDIVIMN 226


>gi|119472095|ref|ZP_01614326.1| flagellar motor protein MotB [Alteromonadales bacterium TW-7]
 gi|119445115|gb|EAW26408.1| flagellar motor protein MotB [Alteromonadales bacterium TW-7]
          Length = 306

 Score =  104 bits (260), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 46/174 (26%), Positives = 74/174 (42%), Gaps = 7/174 (4%)

Query: 22  SREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVS 81
           SR   +    +   +    ++    + K   + + Q+ D  I +  +G  I   I  + S
Sbjct: 128 SRSTSQEQSSEQAISAADQEQTNELVKKIAQQLERQIIDGAIELESLGQQIIIRIRENGS 187

Query: 82  FV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTD----SIGTLKNNLLISQERADV 136
           F     FL+ KF P++Q I  +L   P   I +  HTD    S     NN  +S +RA  
Sbjct: 188 FPSGSAFLQPKFKPIIQDIGELLKDVPG-EITVSGHTDDFQVSNELYVNNWDLSSKRAVA 246

Query: 137 IKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGNIKK 190
           + S L          + V G A   P+  N+T   R+ N+R+EI I  +G  K+
Sbjct: 247 VASELQTVQGFDKTRMMVVGRAETRPLVPNETNEDRRRNRRVEISIL-QGKAKE 299


>gi|332519230|ref|ZP_08395697.1| OmpA/MotB domain protein [Lacinutrix algicola 5H-3-7-4]
 gi|332045078|gb|EGI81271.1| OmpA/MotB domain protein [Lacinutrix algicola 5H-3-7-4]
          Length = 235

 Score =  104 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 42/216 (19%), Positives = 83/216 (38%), Gaps = 36/216 (16%)

Query: 6   GLSMFIMTTISGCGLA--SREKKKVFLHKSNDTDIVNKRFG------------------- 44
            L++ ++ ++S C     +  K+K  +  +    I+    G                   
Sbjct: 12  ILTVMVVLSMSSCSSVKNANNKQKGGVIGATGGAILGAIIGNNVGKGGNGELGAVIGGVV 71

Query: 45  ---------SSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVH---VSFVSEVFLEKKF 92
                    S +DK   + + ++   G  V R+ D I      +       ++  +    
Sbjct: 72  GGGAGVLIGSKMDKQAQKIEEEIP--GAEVERVDDGIVVTFDENSGVYFDTAKYNINAAS 129

Query: 93  LPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFI 152
              L  +  +  ++P T I +  HTDS+G+  +N+ +S+ RA  + +  +     SN  +
Sbjct: 130 QATLSKLIGVFREYPDTNILVVGHTDSVGSEDSNMTLSKNRAYAVTN-YLTNQGISNARV 188

Query: 153 SVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGNI 188
           +   F    P + N TK GR  N+R+ I I P   +
Sbjct: 189 TTNWFGEGQPTNDNSTKEGRAKNRRVNIAIVPNQKM 224


>gi|153002489|ref|YP_001368170.1| OmpA/MotB domain-containing protein [Shewanella baltica OS185]
 gi|217975056|ref|YP_002359807.1| OmpA/MotB domain-containing protein [Shewanella baltica OS223]
 gi|151367107|gb|ABS10107.1| OmpA/MotB domain protein [Shewanella baltica OS185]
 gi|217500191|gb|ACK48384.1| OmpA/MotB domain protein [Shewanella baltica OS223]
          Length = 202

 Score =  104 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 34/183 (18%), Positives = 78/183 (42%), Gaps = 5/183 (2%)

Query: 4   ELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGI 63
           +  +    +T ++GC +  R+   +    +     ++ + G  + +A +      Q  G 
Sbjct: 2   KTIIFFLSVTILAGCSM--RDTVNIDEMTTTQAYDLSDKDGDGVIEARERCNDTAQGAGT 59

Query: 64  VVSRIGDMITCYIP---VHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSI 120
                G +           +      ++  ++ P ++ +A  L ++P+T + I+ HT   
Sbjct: 60  DNYGCGKIKAINERKELSILFPNDSAYIAPEYYPQIEEVAVFLQQYPTTKVTIEGHTSRT 119

Query: 121 GTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEI 180
           GT + NL++SQERAD + + L +R       ++ +G+    P+    T      N+R+  
Sbjct: 120 GTDERNLVLSQERADAVTAVLAERFGIDRNRLTAKGYGSSNPVVLERTPEAEIRNRRVVA 179

Query: 181 QIF 183
           ++ 
Sbjct: 180 EVT 182


>gi|256419485|ref|YP_003120138.1| OmpA/MotB domain protein [Chitinophaga pinensis DSM 2588]
 gi|256034393|gb|ACU57937.1| OmpA/MotB domain protein [Chitinophaga pinensis DSM 2588]
          Length = 225

 Score =  104 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 45/219 (20%), Positives = 90/219 (41%), Gaps = 34/219 (15%)

Query: 2   IKEL---GLSMFIMTTISGCGLASREKKKV----------------FLHKSNDTDIVNKR 42
           +K +      +    T+  C    +                         + +T +    
Sbjct: 1   MKRINPIVAILLSAITLFACNTVKQMDNTQKGAAIGVAGGAATGAIIGKAAGNTALGAII 60

Query: 43  -----------FGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEK 90
                       G  +DK   E + ++ +    V R+G+ I       V F   +  L  
Sbjct: 61  GAAVGGGAGVLIGKKMDKQAQEIKTEVPN--ATVERVGEGINVTFASGVLFGFDKSDLTG 118

Query: 91  KFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNR 150
           +    ++ +ATILNK+P T + ++ HTD+ GT   N+ +S+ RA+ + +YL  +GV+++R
Sbjct: 119 QAQQNIKDLATILNKYPDTYVRVEGHTDTTGTDSYNMGLSERRANAVATYLKSQGVAASR 178

Query: 151 FISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGNIK 189
            +    +  + P+  N++   +  N+R+E  IF    +K
Sbjct: 179 -VQTFWYGARQPVVPNNSDANKAKNRRVEFSIFANEKMK 216


>gi|158320524|ref|YP_001513031.1| OmpA/MotB domain-containing protein [Alkaliphilus oremlandii
           OhILAs]
 gi|158140723|gb|ABW19035.1| OmpA/MotB domain protein [Alkaliphilus oremlandii OhILAs]
          Length = 254

 Score =  104 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 34/144 (23%), Positives = 58/144 (40%), Gaps = 8/144 (5%)

Query: 48  DKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILN-- 104
           +  E   Q    +T ++VS+    +      +V F   +  L+ +   +LQ IA  L   
Sbjct: 101 ETLESYLQEYDLETEVLVSQESRGLMLRFQDNVLFDPGKAELKPRSKEILQDIAEFLRSP 160

Query: 105 KFPSTVIAIQSHTDS-----IGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAY 159
           +     I ++ HTD+           N  +S  RA  +  Y I+         S+ G+  
Sbjct: 161 ELKDKDIRVEGHTDTVKVNPTSIYPTNWELSTGRASNVVRYFIEEIDMDPERFSIAGYGE 220

Query: 160 KYPIDTNDTKVGRQNNQRIEIQIF 183
             PI  NDT   +  N+R++I I 
Sbjct: 221 YQPIAPNDTVENKSKNRRVDIVIL 244


>gi|325473514|gb|EGC76707.1| OmpA family protein [Treponema denticola F0402]
          Length = 422

 Score =  104 bits (259), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 36/145 (24%), Positives = 62/145 (42%)

Query: 41  KRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIA 100
           K+  ++ ++   +    L      + +  + +T  I       +   L +     L+ I 
Sbjct: 278 KKIDTAAEEEIKKSVEDLNLENTTIEKTDEGLTISIENIQFLPNSAILRESEKEKLKKIG 337

Query: 101 TILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYK 160
            IL KFP     I  HT   GT +    +S+ERA  + +YLI  GV     +  RGF  +
Sbjct: 338 EILLKFPDREFLISGHTALAGTEEERQKLSEERAAAVANYLIDLGVQKREHVYTRGFGAR 397

Query: 161 YPIDTNDTKVGRQNNQRIEIQIFPR 185
            P+  N++      N+R+EI I  +
Sbjct: 398 RPVAANNSPENMAKNRRVEITILDK 422


>gi|134296618|ref|YP_001120353.1| OmpA/MotB domain-containing protein [Burkholderia vietnamiensis G4]
 gi|134139775|gb|ABO55518.1| OmpA/MotB domain protein [Burkholderia vietnamiensis G4]
          Length = 213

 Score =  104 bits (259), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 48/207 (23%), Positives = 79/207 (38%), Gaps = 27/207 (13%)

Query: 2   IK---ELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSL----------- 47
           +K    L +       ++GC         V                              
Sbjct: 3   MKIATRLSVFALAGALLAGCATQQGNNTAVGTGTGAALGAGIGALAGGGKGAAIGAGVGA 62

Query: 48  ----------DKAEDEFQMQLQDTGIVVSRIGDM-ITCYIPVHVSFVSE-VFLEKKFLPM 95
                        +++       TG  V+   D  +   +P  V+F +    +   F P+
Sbjct: 63  LVGGVTGYNWQAIKNKLAPSAAKTGTQVTEQPDGSLKLNVPSSVTFATNQYAITPAFTPL 122

Query: 96  LQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVR 155
           L  +AT LN+ P    +I  +TDS G+ + N  +SQ RA  + + L+QRGV+  R +S +
Sbjct: 123 LNDLATTLNQNPQVTASIVGYTDSTGSAQLNQTLSQNRAQSVVNALVQRGVAGGR-LSAQ 181

Query: 156 GFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           G     PI  N T+ GR  N+R+EI +
Sbjct: 182 GMGASNPIADNATEAGRAQNRRVEIYL 208


>gi|167038133|ref|YP_001665711.1| OmpA/MotB domain-containing protein [Thermoanaerobacter
           pseudethanolicus ATCC 33223]
 gi|167039156|ref|YP_001662141.1| OmpA/MotB domain-containing protein [Thermoanaerobacter sp. X514]
 gi|256750878|ref|ZP_05491762.1| OmpA/MotB domain protein [Thermoanaerobacter ethanolicus CCSD1]
 gi|300913254|ref|ZP_07130571.1| OmpA/MotB domain protein [Thermoanaerobacter sp. X561]
 gi|307723732|ref|YP_003903483.1| OmpA/MotB domain-containing protein [Thermoanaerobacter sp. X513]
 gi|320116543|ref|YP_004186702.1| OmpA/MotB domain-containing protein [Thermoanaerobacter brockii
           subsp. finnii Ako-1]
 gi|166853396|gb|ABY91805.1| OmpA/MotB domain protein [Thermoanaerobacter sp. X514]
 gi|166856967|gb|ABY95375.1| OmpA/MotB domain protein [Thermoanaerobacter pseudethanolicus ATCC
           33223]
 gi|256750213|gb|EEU63233.1| OmpA/MotB domain protein [Thermoanaerobacter ethanolicus CCSD1]
 gi|300889939|gb|EFK85084.1| OmpA/MotB domain protein [Thermoanaerobacter sp. X561]
 gi|307580793|gb|ADN54192.1| OmpA/MotB domain protein [Thermoanaerobacter sp. X513]
 gi|319929634|gb|ADV80319.1| OmpA/MotB domain protein [Thermoanaerobacter brockii subsp. finnii
           Ako-1]
          Length = 238

 Score =  104 bits (259), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 29/206 (14%), Positives = 64/206 (31%), Gaps = 28/206 (13%)

Query: 6   GLSMFIMTTISGCGLASREKKKVFLHKSN----------------------DTDIVNKRF 43
            +S+ ++  I    +++    K     S+                               
Sbjct: 23  MMSLLLVFFIVLYSISTVNATKFAQIASSLSKTFTGTDYVLFQYNGSSFMDGNSGDKSSL 82

Query: 44  GSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV-SEVFLEKKFLPMLQLIATI 102
           G    + +   +       +        +   +   + F      +  +   +L  I  +
Sbjct: 83  GEIEKQLKGFIKENNLQGAVTSYIDERGLVISLQDSLLFDLGSADVRPEEKEVLIKIGDM 142

Query: 103 LNKFPSTVIAIQSHTDSIGTLKN----NLLISQERADVIKSYLIQRGVSSNRFISVRGFA 158
           L   P+  I ++  TD +    N    N  +S  RA  +   L+         IS  G+ 
Sbjct: 143 LKSLPN-HIRVEGFTDDLPIHNNKFDSNWELSVIRATNVVKILVNEVGIEPARISAVGYG 201

Query: 159 YKYPIDTNDTKVGRQNNQRIEIQIFP 184
              P+  N+++  R+ N+R++I I  
Sbjct: 202 EYRPVVPNNSEENRRLNRRVDIVIMN 227


>gi|260061425|ref|YP_003194505.1| Thrombospondin type 3 repeat:OmpA/MotB [Robiginitalea biformata
           HTCC2501]
 gi|88785557|gb|EAR16726.1| Thrombospondin type 3 repeat:OmpA/MotB [Robiginitalea biformata
           HTCC2501]
          Length = 446

 Score =  104 bits (259), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 40/185 (21%), Positives = 77/185 (41%), Gaps = 14/185 (7%)

Query: 14  TISGCGLASRE---KKKVFLHKSNDTD---------IVNKRFGSSLDKAEDEFQMQLQDT 61
            +SGC  A  +    K                              D+  D       + 
Sbjct: 263 ALSGCPDADGDGVADKDDECPSEAGPAENNGCPWPDTDGDGVLDKDDECPDTAGTVANNG 322

Query: 62  GIVVSRI-GDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSI 120
              V+      +  Y    +    +  L+ +   +   I  IL+++P++   ++ HTDS+
Sbjct: 323 CPEVTEEVQAQLNEYARTILFDTGKASLKPESTRVFVDIIRILDQYPNSRFTVEGHTDSV 382

Query: 121 GTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEI 180
           G+   N  +S+ERA+ ++ +LI  G+ ++R +   G+  + PI TN+T+ GR  N+R+EI
Sbjct: 383 GSNSLNQKLSEERANSVRDFLINEGIDASR-LEAVGYGEERPIATNNTRAGRTQNRRVEI 441

Query: 181 QIFPR 185
            +   
Sbjct: 442 NLIKE 446


>gi|319790576|ref|YP_004152209.1| OmpA/MotB domain protein [Thermovibrio ammonificans HB-1]
 gi|317115078|gb|ADU97568.1| OmpA/MotB domain protein [Thermovibrio ammonificans HB-1]
          Length = 251

 Score =  104 bits (259), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 54/245 (22%), Positives = 88/245 (35%), Gaps = 59/245 (24%)

Query: 1   MIKELGLSMFIMTTISGC-------------------------------------GLASR 23
           M + L L+      + GC                                     G +  
Sbjct: 1   MKRILTLTTAGALLLGGCATTQQQQAQTAPKKEVNKVAAGAAIGAVVGGAIGALTGPSGS 60

Query: 24  EKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIV------------------- 64
            K +  L  +    ++    G  L +  +     L    +                    
Sbjct: 61  NKGERALIGAAAGAVLGGAIGYILQQQAEALGRDLGVQPVDHTNPAVKPQAPVISDKRPK 120

Query: 65  -VSRIGDMITCYIPVHVSFV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGT 122
            V +    +   +   V F  +   L+ + +  LQ IA  L + P T + +  +TD+ G+
Sbjct: 121 AVVKEPGRVKVVLKDSVLFGLNSAELKPEAVKELQRIAQTLKENPKTTVVVVGYTDNTGS 180

Query: 123 LKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           LK NL +S+ERA+ +K  L++ GV   R + V G   K PI  NDT   R  N+R+EI I
Sbjct: 181 LKYNLKLSKERAEAVKKVLVEAGVRPERIL-VFGCGPKNPIAPNDTPQHRALNRRVEILI 239

Query: 183 FPRGN 187
           +P G 
Sbjct: 240 YPEGE 244


>gi|253701505|ref|YP_003022694.1| OmpA/MotB domain protein [Geobacter sp. M21]
 gi|251776355|gb|ACT18936.1| OmpA/MotB domain protein [Geobacter sp. M21]
          Length = 466

 Score =  104 bits (259), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 27/102 (26%), Positives = 56/102 (54%)

Query: 81  SFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSY 140
             + +  +  ++   +  +   + K+P+T   I+ HTD++G+  +N  +SQ RA+ + ++
Sbjct: 235 FDIDKAIIRPEYKEEIAQVGNFMKKYPTTTAVIEGHTDNVGSYNHNQDLSQRRAEAVVNH 294

Query: 141 LIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           L+++       +S +G+ +  PI  N T  G+Q N+RIE  I
Sbjct: 295 LVEQYGIERSRLSAKGYGFTRPIADNATDEGKQKNRRIEAII 336



 Score = 95.5 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 28/143 (19%), Positives = 65/143 (45%), Gaps = 1/143 (0%)

Query: 41  KRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHV-SFVSEVFLEKKFLPMLQLI 99
               +   K ++     + D    V ++       + + +     +  +++++   +  +
Sbjct: 318 ADNATDEGKQKNRRIEAIIDCAFDVQQVTPPDRLCMSLVLDFDPGKAEVKQQYRNEIAKV 377

Query: 100 ATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAY 159
           A  + ++ +T   I+ HTD+ G+ + N+ +SQ+RA  + ++L+         +S +G+  
Sbjct: 378 ADYMKRYNTTTAVIEGHTDNTGSPEKNMKLSQQRAQNVVNHLVDNFGIERSRLSAKGYGA 437

Query: 160 KYPIDTNDTKVGRQNNQRIEIQI 182
              I  N+T  GRQ N+RI   I
Sbjct: 438 TRRISYNNTPEGRQKNRRINAVI 460


>gi|310817527|ref|YP_003949885.1| OmpA domain-containing protein [Stigmatella aurantiaca DW4/3-1]
 gi|309390599|gb|ADO68058.1| OmpA domain protein [Stigmatella aurantiaca DW4/3-1]
          Length = 1779

 Score =  104 bits (259), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 41/168 (24%), Positives = 72/168 (42%), Gaps = 8/168 (4%)

Query: 17   GCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYI 76
            GC     ++    L  S+      +      D+             + V   G  I   +
Sbjct: 1614 GCPDPDNDQD-GILDGSDKCPNEPEVINGREDE-----DGCPDQGEVNVRVEGKKILI-L 1666

Query: 77   PVHVSFVSEVFLEKKFLPMLQLIATILNKFPS-TVIAIQSHTDSIGTLKNNLLISQERAD 135
                   ++  +  +   +L+ +A +L   P  T I ++ HTDS G+   NL +S  RA 
Sbjct: 1667 QKVYFATNKDIILDRSFSLLKQVAAVLRANPQLTKIRVEGHTDSQGSDAFNLDLSDRRAK 1726

Query: 136  VIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
             +++YLI++   +   +   G+    P+DTNDT  GR+NN+R+E  I 
Sbjct: 1727 SVRTYLIEKEGIAADRLEAVGYGETKPVDTNDTVAGRENNRRVEFIIV 1774


>gi|115379068|ref|ZP_01466194.1| hypothetical protein STIAU_2752 [Stigmatella aurantiaca DW4/3-1]
 gi|115363928|gb|EAU63037.1| hypothetical protein STIAU_2752 [Stigmatella aurantiaca DW4/3-1]
          Length = 831

 Score =  104 bits (259), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 41/168 (24%), Positives = 72/168 (42%), Gaps = 8/168 (4%)

Query: 17  GCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYI 76
           GC     ++    L  S+      +      D+             + V   G  I   +
Sbjct: 666 GCPDPDNDQD-GILDGSDKCPNEPEVINGREDE-----DGCPDQGEVNVRVEGKKILI-L 718

Query: 77  PVHVSFVSEVFLEKKFLPMLQLIATILNKFPS-TVIAIQSHTDSIGTLKNNLLISQERAD 135
                  ++  +  +   +L+ +A +L   P  T I ++ HTDS G+   NL +S  RA 
Sbjct: 719 QKVYFATNKDIILDRSFSLLKQVAAVLRANPQLTKIRVEGHTDSQGSDAFNLDLSDRRAK 778

Query: 136 VIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
            +++YLI++   +   +   G+    P+DTNDT  GR+NN+R+E  I 
Sbjct: 779 SVRTYLIEKEGIAADRLEAVGYGETKPVDTNDTVAGRENNRRVEFIIV 826


>gi|330830900|ref|YP_004393852.1| sodium-driven polar flagellar protein [Aeromonas veronii B565]
 gi|328806036|gb|AEB51235.1| Sodium-driven polar flagellar protein [Aeromonas veronii B565]
          Length = 283

 Score =  104 bits (259), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 42/172 (24%), Positives = 77/172 (44%), Gaps = 6/172 (3%)

Query: 17  GCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYI 76
             G    + K+     + D     ++  +      ++ + Q+QD  I +  +G  I   I
Sbjct: 97  AGGQDKSDGKQTGGDTAQDAKKAQEQSNTLAKALAEQMKDQIQDGAIEIEALGQQIIIRI 156

Query: 77  PVHVSFV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTL----KNNLLISQ 131
               SF     FL+ +F P+++ +AT+L   P   I I  HTD++ T     ++N  +S 
Sbjct: 157 REKASFPAGSAFLQPQFWPVIRKVATLLKDVPG-EITISGHTDNVATEDELFQSNWELSS 215

Query: 132 ERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
           +RA  +   +++        + V+G A   P+  N T   R+ N+R+EI I 
Sbjct: 216 QRAVAVAHQMLKVPGFDQGRLVVQGMADSQPLVPNTTPENRRMNRRVEIAIM 267


>gi|110638537|ref|YP_678746.1| outer membrane protein [Cytophaga hutchinsonii ATCC 33406]
 gi|110281218|gb|ABG59404.1| outer membrane protein [Cytophaga hutchinsonii ATCC 33406]
          Length = 510

 Score =  104 bits (259), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 31/112 (27%), Positives = 52/112 (46%), Gaps = 1/112 (0%)

Query: 74  CYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQER 133
             +       S+  L  +    L  +  +L + P   I I+ HTD+ G    N+++SQ R
Sbjct: 400 IKLNHIYFETSKYDLLPESYYELDKVVKLLRENPKMKIEIEGHTDNQGNADKNMILSQNR 459

Query: 134 ADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPR 185
           A  +  Y+I +   +   I+ +GF    P+  NDT   RQ N+R+E  I  +
Sbjct: 460 AKSVMDYIISK-GITADRITSKGFGITKPMVDNDTPENRQLNRRVEFTILQK 510


>gi|86160609|ref|YP_467394.1| OmpA/MotB family outer membrane protein [Anaeromyxobacter
           dehalogenans 2CP-C]
 gi|85777120|gb|ABC83957.1| outer membrane protein, OmpA/MotB family [Anaeromyxobacter
           dehalogenans 2CP-C]
          Length = 248

 Score =  104 bits (259), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 45/206 (21%), Positives = 76/206 (36%), Gaps = 30/206 (14%)

Query: 1   MIK---ELGLSMFIMTTISGCGLASREK--------------------KKVFLHKSNDTD 37
           M K    L  ++  +   +GC  A +                      KK  L  +    
Sbjct: 43  MNKTSLRLTAAVTAVLLFAGCQTAGKRTAIGAGAGGLAGAGVGALLGGKKGALIGAGVGA 102

Query: 38  IVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV-SEVFLEKKFLPML 96
           +     G  LDK   E +           R  + +   +   + F      L+ + +  L
Sbjct: 103 LAGGSVGLYLDKQHKELEKI-----AETKRTENGLLVEMKGDILFDSGSSALKPEAIGKL 157

Query: 97  QLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRG 156
           + +  IL K+    I I+ +TDS G+   N  +S  RAD +K  L+ R     + I+  G
Sbjct: 158 EQMGDILAKYGDDRIRIEGYTDSTGSKSMNEELSLRRADAVKRVLVGR-GVQEKQITALG 216

Query: 157 FAYKYPIDTNDTKVGRQNNQRIEIQI 182
                P+  N +  GR  N+R+E+ I
Sbjct: 217 MGPVRPVADNGSATGRAQNRRVELHI 242


>gi|295095728|emb|CBK84818.1| Outer membrane protein and related peptidoglycan-associated
           (lipo)proteins [Enterobacter cloacae subsp. cloacae NCTC
           9394]
          Length = 568

 Score =  103 bits (258), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 30/117 (25%), Positives = 56/117 (47%)

Query: 71  MITCYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLIS 130
            I     + +    +  L+     +L      +   P  +I +  HTDS G  ++N ++S
Sbjct: 429 KIVRLDSMSLFDTGKWALKPASTKLLVNSLVGIKAKPGWLIVVAGHTDSTGDDQSNQVLS 488

Query: 131 QERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGN 187
            +RA+ ++ ++   G       +V+G+    P+ TNDT  GR  N+R+EI + P+ N
Sbjct: 489 LKRAESVRDWMRDTGDVPESCFAVQGYGESRPVATNDTAEGRALNRRVEISLVPQAN 545


>gi|120437695|ref|YP_863381.1| thrombospondin repeat-containing OmpA/MotB family outer membrane
           protein [Gramella forsetii KT0803]
 gi|117579845|emb|CAL68314.1| OmpA/MotB family outer membrane protein containing thrombospondin 3
           repeats [Gramella forsetii KT0803]
          Length = 472

 Score =  103 bits (258), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 37/173 (21%), Positives = 75/173 (43%), Gaps = 15/173 (8%)

Query: 17  GCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYI 76
           GC  A  +   V     +  +       +   +   E   +L +    V           
Sbjct: 308 GCPWADTDGDGVLDKDDDCPEEAGPAASNGCPEPTAEVISELNEYSKTV----------- 356

Query: 77  PVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADV 136
              +  +++  +  +    LQ I  I++++ +T+  I+ HTDS G+   N+ +S+ERA  
Sbjct: 357 ---LFDLNKATIRPESEEALQSIHDIMHEYSTTIFHIEGHTDSSGSDSYNMKLSKERAAS 413

Query: 137 IKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGNIK 189
           + +  +++     + ++  G+    PI TN T  GRQ+N+R+EI +     +K
Sbjct: 414 V-ATWLEQNGIPAKRLTSEGYGETQPIATNSTAKGRQDNRRVEISLDKDKEMK 465


>gi|322436615|ref|YP_004218827.1| OmpA/MotB domain protein [Acidobacterium sp. MP5ACTX9]
 gi|321164342|gb|ADW70047.1| OmpA/MotB domain protein [Acidobacterium sp. MP5ACTX9]
          Length = 531

 Score =  103 bits (258), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 28/151 (18%), Positives = 66/151 (43%), Gaps = 2/151 (1%)

Query: 32  KSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKK 91
           ++N       +   S ++  +  + QL +  +  +     +   +   +    +  L+  
Sbjct: 367 EANQRADAANKRAESAEQMRERLRAQLNE-VLQTTETSRGVIVNLSDALFDTGKYTLKTN 425

Query: 92  FLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRF 151
               L  +A IL  +P   + ++ +TD +G+   N  +S+ RA+  + +++++       
Sbjct: 426 TQVSLARVAGILQSYPGLKVQVEGYTDIVGSDALNQRLSENRANTTRDFMVKQ-GVPTDS 484

Query: 152 ISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           IS  G+    P+  N T  GR  N+R+E+ +
Sbjct: 485 ISAAGYGKADPVADNGTAAGRAQNRRVELVV 515


>gi|220932514|ref|YP_002509422.1| OmpA/MotB domain protein [Halothermothrix orenii H 168]
 gi|219993824|gb|ACL70427.1| OmpA/MotB domain protein [Halothermothrix orenii H 168]
          Length = 245

 Score =  103 bits (258), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 32/151 (21%), Positives = 60/151 (39%), Gaps = 6/151 (3%)

Query: 39  VNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV-SEVFLEKKFLPMLQ 97
            N+ F   + +     + +     + +      +   +   V +   +  ++     +L 
Sbjct: 86  SNQVFEKVMGQINRYVEKEKLSDRVKMELTKRGLVVRLTGQVLYDIGKAEIKPGGKRLLD 145

Query: 98  LIATILNKFPSTVIAIQSHTDSIGTLKNN----LLISQERADVIKSYLIQRGVSSNRFIS 153
            IA I+ K P+  IA++ HTD+             +S  RA  +  Y I+R       +S
Sbjct: 146 EIAGIIEKIPN-EIAVEGHTDNWPIHNEQFPSNWELSTTRATNVIKYFIERHGIDPSRLS 204

Query: 154 VRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
             G++   P+  NDT   R  N+R+EI I  
Sbjct: 205 AAGYSEYRPLYPNDTVEHRAKNRRVEIVILN 235


>gi|332534966|ref|ZP_08410784.1| flagellar motor rotation protein MotB [Pseudoalteromonas
           haloplanktis ANT/505]
 gi|332035584|gb|EGI72076.1| flagellar motor rotation protein MotB [Pseudoalteromonas
           haloplanktis ANT/505]
          Length = 306

 Score =  103 bits (258), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 46/174 (26%), Positives = 74/174 (42%), Gaps = 7/174 (4%)

Query: 22  SREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVS 81
           SR   +    +   +    ++    + K   + + Q+ D  I +  +G  I   I  + S
Sbjct: 128 SRSTSQEQSSEQATSAADQEQTNELVKKIAQQLEKQIIDGAIELESLGQQIIIRIRENGS 187

Query: 82  FV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTD----SIGTLKNNLLISQERADV 136
           F     FL+ KF P++Q I  +L   P   I +  HTD    S     NN  +S +RA  
Sbjct: 188 FPSGSAFLQPKFKPIIQDIGVLLKDVPG-EITVSGHTDDFQVSNELYINNWDLSSKRAVA 246

Query: 137 IKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGNIKK 190
           + S L          + V G A   P+  ND+   R+ N+R+EI I  +G  K+
Sbjct: 247 VASELQTVQGFDKNRMMVVGRADTRPLVPNDSNEDRRRNRRVEISIL-QGKAKE 299


>gi|332704881|ref|ZP_08424969.1| peptidoglycan-associated lipoprotein [Desulfovibrio africanus str.
           Walvis Bay]
 gi|332555030|gb|EGJ52074.1| peptidoglycan-associated lipoprotein [Desulfovibrio africanus str.
           Walvis Bay]
          Length = 198

 Score =  103 bits (258), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 28/195 (14%), Positives = 64/195 (32%), Gaps = 14/195 (7%)

Query: 1   MIKELGLSMFIMTTISG--CGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQL 58
           M ++  + +F++  ++G  C              +   ++ +              +   
Sbjct: 4   MTRKTIVVLFVLALLAGFGCAKKQVSSTPDQTSAAAQGEMTDGTPTDDEAARRAAEEEAY 63

Query: 59  QDTGIVVSRIGDMITCYIPV-----------HVSFVSEVFLEKKFLPMLQLIATILNKFP 107
           + + +   + G      +                      L+ K   +LQ  A  L   P
Sbjct: 64  RRSELQDDQTGQTEQERLQAEQQAKQNINELVFFAYDSYELDSKAREVLQRKAQALKLMP 123

Query: 108 STVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTND 167
            T + I+   D  GT + NL + + RA       +     +   I++  +    P+D  +
Sbjct: 124 DTRVTIKGFCDERGTEEYNLALGERRARASFD-FLVLMGVNPNRINIVSYGEDNPLDPAN 182

Query: 168 TKVGRQNNQRIEIQI 182
           ++     N+R E +I
Sbjct: 183 SEAAYAKNRRCEFEI 197


>gi|325105621|ref|YP_004275275.1| OmpA/MotB domain protein [Pedobacter saltans DSM 12145]
 gi|324974469|gb|ADY53453.1| OmpA/MotB domain protein [Pedobacter saltans DSM 12145]
          Length = 230

 Score =  103 bits (258), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 50/165 (30%), Positives = 71/165 (43%), Gaps = 4/165 (2%)

Query: 20  LASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVH 79
             +       +             G  +DK   E +  +   G  V   G+ I       
Sbjct: 55  SKAGNTAVGAIIGGALGGTAGALIGKKMDKQAKEIEAAIP--GAEVIPAGEGIIVKFDSG 112

Query: 80  VSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIK 138
           + F  ++  L       +  +A  LNK+P T I +  HTD+IGT   N  +S ERA+ + 
Sbjct: 113 LLFDFNKATLSATAKQNIDNLAASLNKYPDTDILVVGHTDAIGTDAVNNKLSLERANSVV 172

Query: 139 SYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
           SY I +GVSS R  S  G     PI +NDT  GR  N+R+EI I 
Sbjct: 173 SYAISKGVSSGRLKS-SGKGKTEPIASNDTDAGRAQNRRVEIVIV 216


>gi|88799579|ref|ZP_01115155.1| Flagellar motor protein [Reinekea sp. MED297]
 gi|88777664|gb|EAR08863.1| Flagellar motor protein [Reinekea sp. MED297]
          Length = 319

 Score =  103 bits (258), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 32/151 (21%), Positives = 63/151 (41%), Gaps = 5/151 (3%)

Query: 36  TDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPM 95
           +D   +       +       ++ +  + +  + + I   +          ++  +FLP+
Sbjct: 133 SDEAMQELEDEAARIAQALSDEIAEGMLQIETVNETIIIRVKEQSFTGGSDYVADEFLPV 192

Query: 96  LQLIATILNKFPSTVIAIQSHTDSIG----TLKNNLLISQERADVIKSYLIQRGVSSNRF 151
           L  +  +L   P   I ++ HTD++       +NN L+S  RA  +  YL      +   
Sbjct: 193 LDKVRELLVTTPG-DIWVEGHTDNVPIATSQFRNNWLLSAARALSVAEYLFIAPEMAEER 251

Query: 152 ISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
            ++ G     PI +N+T  GR  N+R+EI I
Sbjct: 252 FTIVGHGSTKPIASNETPEGRAQNRRVEIII 282


>gi|295399258|ref|ZP_06809240.1| OmpA/MotB domain protein [Geobacillus thermoglucosidasius C56-YS93]
 gi|312110141|ref|YP_003988457.1| OmpA/MotB domain protein [Geobacillus sp. Y4.1MC1]
 gi|294978724|gb|EFG54320.1| OmpA/MotB domain protein [Geobacillus thermoglucosidasius C56-YS93]
 gi|311215242|gb|ADP73846.1| OmpA/MotB domain protein [Geobacillus sp. Y4.1MC1]
          Length = 254

 Score =  103 bits (258), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 33/177 (18%), Positives = 65/177 (36%), Gaps = 5/177 (2%)

Query: 19  GLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPV 78
               ++  +   +K        +      +K +     +  +  +  S   + +   I  
Sbjct: 77  SQPKQQNDQQNDNKKKIDKQEKEELHEVQEKIDTYIVNERLNGKLKTSLTEEGLAITILN 136

Query: 79  HVSFV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIG----TLKNNLLISQER 133
            + F      +  +   + + I+ +L   P   I I  HTD++        +N  +S  R
Sbjct: 137 DILFDSGSAEVRPQDRQLAKEISQMLVMNPPRNIIISGHTDNVPIHNAQFSSNWELSVMR 196

Query: 134 ADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGNIKK 190
           A      L++      R  S +G+    P+ +NDT  GR  N+R+EI I P     +
Sbjct: 197 AVNFMKLLLENPKLDPRLFSAKGYGEFKPVASNDTPEGRMKNRRVEILILPNSQASQ 253


>gi|257092877|ref|YP_003166518.1| OmpA/MotB domain-containing protein [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
 gi|257045401|gb|ACV34589.1| OmpA/MotB domain protein [Candidatus Accumulibacter phosphatis
           clade IIA str. UW-1]
          Length = 189

 Score =  103 bits (258), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 33/191 (17%), Positives = 67/191 (35%), Gaps = 15/191 (7%)

Query: 1   MIKELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQD 60
           M   +   + ++ ++S C   S  K++V    +            +  +   + Q ++Q 
Sbjct: 1   MNARIVFPLLLVASLSACVSQSTYKQEVQQVDTLSVQ------NKAYAQLTQQLQTEIQA 54

Query: 61  TGIVVSRIGDMITCYI-PVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDS 119
             + + ++   +T  +    V       +  K    +  I   L       I ++ +TD+
Sbjct: 55  DQVKIKQLEGRLTVTLVDEIVFSSGSAEMNMKGRATIDKIVGTLQNAAGKRIVVEGYTDN 114

Query: 120 IG-------TLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGR 172
                        N  +S  RA  +    +Q        +   GF    P+  NDT  GR
Sbjct: 115 TPIGPGLRSRYPTNWELSTARACDVVR-YLQAAGIDPVRLEAAGFGEYQPVAANDTPAGR 173

Query: 173 QNNQRIEIQIF 183
             N+RI+I + 
Sbjct: 174 SQNRRIDIVLM 184


>gi|322417908|ref|YP_004197131.1| OmpA/MotB domain-containing protein [Geobacter sp. M18]
 gi|320124295|gb|ADW11855.1| OmpA/MotB domain protein [Geobacter sp. M18]
          Length = 169

 Score =  103 bits (258), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 36/183 (19%), Positives = 75/183 (40%), Gaps = 16/183 (8%)

Query: 1   MIKELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQD 60
           M+K+  ++  +  T++G   A  +  K              + G+ L     + +    +
Sbjct: 1   MLKKAAIAAVLSMTVAGVAYAGLDAVKGLGKDLGKEAAATAKEGA-LSAVTKKLKKVQNE 59

Query: 61  TGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSI 120
            G                      +  ++      +  IA I+  +P   + +  HTD++
Sbjct: 60  KGP---------------IKFKTGKAEVDPACDRTMTAIAAIMTDYPGFHVQVDGHTDNV 104

Query: 121 GTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEI 180
           G  + N+ +SQ+RAD +  YL ++     + +S +GF    PI +N TK G+  N+R++ 
Sbjct: 105 GKPEANMKLSQDRADAVVKYLAEKKGVDAKRLSAKGFGDTQPIASNKTKAGQAKNRRVDF 164

Query: 181 QIF 183
            + 
Sbjct: 165 TVT 167


>gi|298372486|ref|ZP_06982476.1| OmpA family protein [Bacteroidetes oral taxon 274 str. F0058]
 gi|298275390|gb|EFI16941.1| OmpA family protein [Bacteroidetes oral taxon 274 str. F0058]
          Length = 567

 Score =  103 bits (258), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 32/120 (26%), Positives = 55/120 (45%), Gaps = 1/120 (0%)

Query: 63  IVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGT 122
           + +  I    +  +       ++  L  +    L   A  L + P+  I I  HTDS G+
Sbjct: 448 VYMQPIKTGTSFVVKNIYFNTNDTSLTAESNKELDKQAKFLKENPNVNITIVGHTDSRGS 507

Query: 123 LKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
            + NL +S+ RA  +   LI R   +   +   G     P+ +N+T+ GR  N+RIEI++
Sbjct: 508 DEYNLKLSEGRAVSVMRALIDR-GIAPERLKAEGRGETQPVASNETEEGRAENRRIEIEV 566


>gi|206891094|ref|YP_002249885.1| peptidoglycan-associated lipoprotein [Thermodesulfovibrio
           yellowstonii DSM 11347]
 gi|206743032|gb|ACI22089.1| peptidoglycan-associated lipoprotein [Thermodesulfovibrio
           yellowstonii DSM 11347]
          Length = 182

 Score =  103 bits (258), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 46/186 (24%), Positives = 81/186 (43%), Gaps = 6/186 (3%)

Query: 2   IKELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDT 61
           IK + L++F +  I  C     E+K         T IV K  G+ ++K +   + +   T
Sbjct: 3   IKIILLAIFCLFLIIACA----ERKIYMPDGKETTGIVKKEEGNEIEKTKPS-EEETSFT 57

Query: 62  GIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIG 121
              ++ +   +   I        +  + +  LP L+ +A+ L K+P   + I+ H D  G
Sbjct: 58  TSQMAELIKKLQEEIGDIHFDYDKYDVRQDDLPTLKKVASYLQKYPKLRVIIEGHCDERG 117

Query: 122 TLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQ 181
           T + N  + Q+RAD  K YLI  G+ S+R   +  +  + P+ T   +   Q N+R    
Sbjct: 118 TNEYNFALGQKRADSAKQYLITLGIISSRIDIIS-YGEEKPLCTEQNESCWQKNRRAHFV 176

Query: 182 IFPRGN 187
               G 
Sbjct: 177 FIEEGK 182


>gi|77165507|ref|YP_344032.1| OmpA/MotB [Nitrosococcus oceani ATCC 19707]
 gi|76883821|gb|ABA58502.1| OmpA/MotB [Nitrosococcus oceani ATCC 19707]
          Length = 286

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 36/156 (23%), Positives = 60/156 (38%), Gaps = 7/156 (4%)

Query: 32  KSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKK 91
           ++       K      DK E           +   +        +   +  V    L   
Sbjct: 129 EARQAKEQAKMAEIRADKLEKRLAE------LNAEKTERGYVLTLGDILFEVDSAELTSG 182

Query: 92  FLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRF 151
            +  L  + T L ++P   + ++ HTDS G+   N+ +SQ RAD +    +     +   
Sbjct: 183 GMQNLFRLVTFLKEYPDREVVVEGHTDSTGSAVYNMELSQRRADSVY-LFLVNNGIAPDR 241

Query: 152 ISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGN 187
           I   G+   YP+  N+T  GRQ N+R+EI I   G 
Sbjct: 242 IVAHGYGQGYPVAPNNTTAGRQKNRRVEIVILGAGK 277


>gi|182682319|ref|YP_001830479.1| OmpA/MotB domain-containing protein [Xylella fastidiosa M23]
 gi|182632429|gb|ACB93205.1| OmpA/MotB domain protein [Xylella fastidiosa M23]
 gi|307578598|gb|ADN62567.1| OmpA/MotB domain-containing protein [Xylella fastidiosa subsp.
           fastidiosa GB514]
          Length = 375

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 35/145 (24%), Positives = 61/145 (42%)

Query: 38  IVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQ 97
                 G  ++  +D+         I        ++  +        +  L    + +L+
Sbjct: 229 AELDSDGDGVNDCDDKCPNSQPGQTIGPDGCPVPVSIDLKGVNFDFDKSKLRPDAVAVLK 288

Query: 98  LIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGF 157
               IL ++P   + +  HTDS G    N  +S+ RA V+  YL   G+ ++R I   G+
Sbjct: 289 EATEILRRYPDLHVEVAGHTDSTGPAAYNKKLSERRAKVVYDYLRNNGIDASRLIGPVGY 348

Query: 158 AYKYPIDTNDTKVGRQNNQRIEIQI 182
              +PIDTN T  GR  N+R E+ +
Sbjct: 349 GETHPIDTNKTPAGRAKNRRTELNV 373


>gi|220919426|ref|YP_002494730.1| OmpA/MotB domain protein [Anaeromyxobacter dehalogenans 2CP-1]
 gi|219957280|gb|ACL67664.1| OmpA/MotB domain protein [Anaeromyxobacter dehalogenans 2CP-1]
          Length = 206

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 44/206 (21%), Positives = 76/206 (36%), Gaps = 30/206 (14%)

Query: 1   MIK---ELGLSMFIMTTISGCGLASREK--------------------KKVFLHKSNDTD 37
           M K    L  ++  +   +GC  A +                      KK  L  +    
Sbjct: 1   MNKTSLRLTAAVTAVLLFAGCQTAGKRTAIGAGAGGLAGAGVGALLGGKKGALIGAGVGA 60

Query: 38  IVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV-SEVFLEKKFLPML 96
           +     G  LDK   E +           R  + +   +   + F      L+ + +  L
Sbjct: 61  LAGGSVGLYLDKQHKELEKI-----AETKRTENGLLVEMKGDILFDSGSSALKPEAISKL 115

Query: 97  QLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRG 156
           + +  +L K+    I I+ +TD+ G+   N  +S  RAD +K  L+ R     + I+  G
Sbjct: 116 EQMGDVLAKYGDDRIRIEGYTDATGSKSMNEELSLRRADAVKRVLVGR-GVQEKQITALG 174

Query: 157 FAYKYPIDTNDTKVGRQNNQRIEIQI 182
                P+  N T  GR  N+R+E+ I
Sbjct: 175 MGPVRPVADNGTSAGRAQNRRVELHI 200


>gi|15836945|ref|NP_297633.1| outer membrane protein [Xylella fastidiosa 9a5c]
 gi|9105169|gb|AAF83153.1|AE003886_12 outer membrane protein [Xylella fastidiosa 9a5c]
          Length = 389

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 35/145 (24%), Positives = 61/145 (42%)

Query: 38  IVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQ 97
                 G  ++  +D+         I        ++  +        +  L    + +L+
Sbjct: 243 AELDSDGDGVNDCDDKCPNSQPGQTIGPDGCPVPVSIDLKGVNFDFDKSKLRPDAVAVLK 302

Query: 98  LIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGF 157
               IL ++P   + +  HTDS G    N  +S+ RA V+  YL   G+ ++R I   G+
Sbjct: 303 EATEILRRYPDLHVEVAGHTDSTGPAAYNKKLSERRAKVVYDYLRNNGIDASRLIGPVGY 362

Query: 158 AYKYPIDTNDTKVGRQNNQRIEIQI 182
              +PIDTN T  GR  N+R E+ +
Sbjct: 363 GETHPIDTNKTPAGRAKNRRTELNV 387


>gi|28199584|ref|NP_779898.1| outer membrane protein [Xylella fastidiosa Temecula1]
 gi|28057699|gb|AAO29547.1| outer membrane protein [Xylella fastidiosa Temecula1]
          Length = 389

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 35/145 (24%), Positives = 61/145 (42%)

Query: 38  IVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQ 97
                 G  ++  +D+         I        ++  +        +  L    + +L+
Sbjct: 243 AELDSDGDGVNDCDDKCPNSQPGQTIGPDGCPVPVSIDLKGVNFDFDKSKLRPDAVAVLK 302

Query: 98  LIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGF 157
               IL ++P   + +  HTDS G    N  +S+ RA V+  YL   G+ ++R I   G+
Sbjct: 303 EATEILRRYPDLHVEVAGHTDSTGPAAYNKKLSERRAKVVYDYLRNNGIDASRLIGPVGY 362

Query: 158 AYKYPIDTNDTKVGRQNNQRIEIQI 182
              +PIDTN T  GR  N+R E+ +
Sbjct: 363 GETHPIDTNKTPAGRAKNRRTELNV 387


>gi|71276570|ref|ZP_00652844.1| OmpA/MotB [Xylella fastidiosa Dixon]
 gi|71901217|ref|ZP_00683319.1| OmpA/MotB [Xylella fastidiosa Ann-1]
 gi|170730957|ref|YP_001776390.1| outer membrane protein [Xylella fastidiosa M12]
 gi|71162641|gb|EAO12369.1| OmpA/MotB [Xylella fastidiosa Dixon]
 gi|71729028|gb|EAO31157.1| OmpA/MotB [Xylella fastidiosa Ann-1]
 gi|167965750|gb|ACA12760.1| outer membrane protein [Xylella fastidiosa M12]
          Length = 375

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 35/145 (24%), Positives = 61/145 (42%)

Query: 38  IVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQ 97
                 G  ++  +D+         I        ++  +        +  L    + +L+
Sbjct: 229 AELDSDGDGVNDCDDKCPNSQPGQTIGPDGCPVPVSIDLKGVNFDFDKSKLRPDAVAVLK 288

Query: 98  LIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGF 157
               IL ++P   + +  HTDS G    N  +S+ RA V+  YL   G+ ++R I   G+
Sbjct: 289 EATEILRRYPDLHVEVAGHTDSTGPAAYNKKLSERRAKVVYDYLRNNGIDASRLIGPVGY 348

Query: 158 AYKYPIDTNDTKVGRQNNQRIEIQI 182
              +PIDTN T  GR  N+R E+ +
Sbjct: 349 GETHPIDTNKTPAGRAKNRRTELNV 373


>gi|71898965|ref|ZP_00681131.1| OmpA/MotB [Xylella fastidiosa Ann-1]
 gi|71731211|gb|EAO33276.1| OmpA/MotB [Xylella fastidiosa Ann-1]
          Length = 375

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 35/145 (24%), Positives = 61/145 (42%)

Query: 38  IVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQ 97
                 G  ++  +D+         I        ++  +        +  L    + +L+
Sbjct: 229 AELDSDGDGVNDCDDKCPNSQPGQTIGPDGCPVPVSIDLKGVNFDFDKSKLRPDAVAVLK 288

Query: 98  LIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGF 157
               IL ++P   + +  HTDS G    N  +S+ RA V+  YL   G+ ++R I   G+
Sbjct: 289 EATEILRRYPDLHVEVAGHTDSTGPAAYNKKLSERRAKVVYDYLRNNGIDASRLIGPVGY 348

Query: 158 AYKYPIDTNDTKVGRQNNQRIEIQI 182
              +PIDTN T  GR  N+R E+ +
Sbjct: 349 GETHPIDTNKTPAGRAKNRRTELNV 373


>gi|70729258|ref|YP_258995.1| outer membrane protein OprF [Pseudomonas fluorescens Pf-5]
 gi|68343557|gb|AAY91163.1| outer membrane protein OprF [Pseudomonas fluorescens Pf-5]
 gi|154759407|gb|ABS85198.1| major outer membrane porin [Pseudomonas fluorescens]
          Length = 325

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 23/102 (22%), Positives = 47/102 (46%)

Query: 78  VHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVI 137
                  +  ++      ++ +A  + ++P T   ++ HTDS+G    N  +S+ RA+ +
Sbjct: 216 DVKFDFDKSVVKPNSYADIKNLADFMKQYPQTTTVVEGHTDSVGPDAYNQKLSERRANAV 275

Query: 138 KSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIE 179
           K  L+ +       +   G+    P+  N T+ GR  N+R+E
Sbjct: 276 KQVLVNQYGVGANRVQSVGYGESRPVADNATEAGRAVNRRVE 317


>gi|4580966|gb|AAD24553.1|AF117961_1 OprF [Pseudomonas chlororaphis subsp. aureofaciens]
          Length = 325

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 24/110 (21%), Positives = 50/110 (45%)

Query: 78  VHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVI 137
                  +  ++      ++ +A  + ++P T   ++ HTDS+G    N  +S+ RA+ +
Sbjct: 216 DVKFDFDKSVVKPNSYADIKNLADFMKQYPQTTTVVEGHTDSVGPDAYNQKLSERRANAV 275

Query: 138 KSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGN 187
           K  L  +    +  +   G+    P+  N T+ GR  N+R+E Q+  +  
Sbjct: 276 KQVLTSQYGVESSRVQSVGYGESRPVADNATEAGRAVNRRVEAQVEAQAK 325


>gi|16078432|ref|NP_389251.1| flagellar motor protein MotB [Bacillus subtilis subsp. subtilis
           str. 168]
 gi|221309232|ref|ZP_03591079.1| flagellar motor protein MotB [Bacillus subtilis subsp. subtilis
           str. 168]
 gi|221313560|ref|ZP_03595365.1| flagellar motor protein MotB [Bacillus subtilis subsp. subtilis
           str. NCIB 3610]
 gi|221318482|ref|ZP_03599776.1| flagellar motor protein MotB [Bacillus subtilis subsp. subtilis
           str. JH642]
 gi|221322755|ref|ZP_03604049.1| flagellar motor protein MotB [Bacillus subtilis subsp. subtilis
           str. SMY]
 gi|321315123|ref|YP_004207410.1| flagellar motor protein MotB [Bacillus subtilis BSn5]
 gi|127250|sp|P28612|MOTB_BACSU RecName: Full=Motility protein B; AltName: Full=Chemotaxis protein
           MotB
 gi|143208|gb|AAA22603.1| motility protein B [Bacillus subtilis]
 gi|2633739|emb|CAB13241.1| motility protein B; MotB component of the stator flagellum complex
           [Bacillus subtilis subsp. subtilis str. 168]
 gi|320021397|gb|ADV96383.1| flagellar motor protein MotB [Bacillus subtilis BSn5]
          Length = 261

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 33/155 (21%), Positives = 65/155 (41%), Gaps = 5/155 (3%)

Query: 37  DIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV-SEVFLEKKFLPM 95
               +   +   + E   + +  +  +      + +   I   + F   +  + K+ +P+
Sbjct: 100 AADQEELENVKSQVEKFIKDKKLEHQLETKMTSEGLLITIKDSIFFDSGKATIRKEDVPL 159

Query: 96  LQLIATILNKFPSTVIAIQSHTDSIGT----LKNNLLISQERADVIKSYLIQRGVSSNRF 151
            + I+ +L   P   I I  HTD++       ++N  +S  RA      LI+      + 
Sbjct: 160 AKEISNLLVINPPRNIIISGHTDNMPIKNSEFQSNWHLSVMRAVNFMGLLIENPKLDAKV 219

Query: 152 ISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRG 186
            S +G+    P+ +N T  GR  N+R+E+ I PRG
Sbjct: 220 FSAKGYGEYKPVASNKTAEGRSKNRRVEVLILPRG 254


>gi|124007829|ref|ZP_01692531.1| outer membrane protein [Microscilla marina ATCC 23134]
 gi|123986775|gb|EAY26556.1| outer membrane protein [Microscilla marina ATCC 23134]
          Length = 715

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 29/112 (25%), Positives = 55/112 (49%), Gaps = 1/112 (0%)

Query: 74  CYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQER 133
             +      V +  L+      L  +   +  +P+  I +  HTD+ G+   NL +S++R
Sbjct: 605 IRLNNLFFDVGKSALKSSSFAELNRLVNSMKNYPNMTIEVSGHTDAQGSPAKNLQLSKDR 664

Query: 134 ADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPR 185
           A+ + +YL  +G+ ++R    +G+    P+ TN T  GR  N+R+E  I  +
Sbjct: 665 ANAVLNYLKSKGIPASRM-QAKGYGQTKPLATNGTAQGRARNRRVEFMILKK 715


>gi|254433641|ref|ZP_05047149.1| OmpA family protein [Nitrosococcus oceani AFC27]
 gi|207089974|gb|EDZ67245.1| OmpA family protein [Nitrosococcus oceani AFC27]
          Length = 293

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 36/156 (23%), Positives = 60/156 (38%), Gaps = 7/156 (4%)

Query: 32  KSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKK 91
           ++       K      DK E           +   +        +   +  V    L   
Sbjct: 136 EARQAKEQAKMAEIRADKLEKRLAE------LNAEKTERGYVLTLGDILFEVDSAELTSG 189

Query: 92  FLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRF 151
            +  L  + T L ++P   + ++ HTDS G+   N+ +SQ RAD +    +     +   
Sbjct: 190 GMQNLFRLVTFLKEYPDREVVVEGHTDSTGSAVYNMELSQRRADSVY-LFLVNNGIAPDR 248

Query: 152 ISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGN 187
           I   G+   YP+  N+T  GRQ N+R+EI I   G 
Sbjct: 249 IVAHGYGQGYPVAPNNTTAGRQKNRRVEIVILGAGK 284


>gi|152969879|ref|YP_001334988.1| putative outer membrane protein [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|150954728|gb|ABR76758.1| putative outer membrane protein [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
          Length = 568

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 33/121 (27%), Positives = 58/121 (47%)

Query: 65  VSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLK 124
           V R+   +     + +    +  L+      L      +   P  +I +  HTDS+G  K
Sbjct: 423 VQRVAPNVIRLDSMSLFDTGKWVLKPGSTKRLVNSLMDIKARPGWLIVVAGHTDSVGEEK 482

Query: 125 NNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
            N L+S +RA+ ++ ++   G   +   +V+G+    PI TNDT  GR  N+R+EI + P
Sbjct: 483 ANQLLSLKRAESVRDWMRDTGDVPDSCFAVQGYGESRPIATNDTPEGRALNRRVEISLVP 542

Query: 185 R 185
           +
Sbjct: 543 Q 543


>gi|42526179|ref|NP_971277.1| OmpA family protein [Treponema denticola ATCC 35405]
 gi|41816291|gb|AAS11158.1| OmpA family protein [Treponema denticola ATCC 35405]
          Length = 422

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 36/145 (24%), Positives = 62/145 (42%)

Query: 41  KRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIA 100
           K+   + ++   +    L      + +  + +T  I       +   L +     L+ I 
Sbjct: 278 KKIDKAAEEEIKKSVEDLNLENTTIEKTDEGLTISIENIQFLPNSAILRESEKEKLKKIG 337

Query: 101 TILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYK 160
            IL KFP     I  HT   GT +    +S+ERA  + +YLI+ GV     +  RGF  +
Sbjct: 338 EILLKFPDREFLISGHTALAGTEEERQALSEERAAAVANYLIELGVQKREHVYTRGFGAR 397

Query: 161 YPIDTNDTKVGRQNNQRIEIQIFPR 185
            P+  N++      N+R+EI I  +
Sbjct: 398 RPVAANNSPENMAKNRRVEITILDK 422


>gi|261252277|ref|ZP_05944850.1| Flagellar motor rotation protein MotB [Vibrio orientalis CIP
           102891]
 gi|260935668|gb|EEX91657.1| Flagellar motor rotation protein MotB [Vibrio orientalis CIP
           102891]
          Length = 313

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 36/169 (21%), Positives = 74/169 (43%), Gaps = 6/169 (3%)

Query: 20  LASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVH 79
                +      +   +  +++   + ++  +   + +++   I V  +G  I   I   
Sbjct: 132 STQNNQNSESDSQQQQSAEMSQELETLMESIKKALEREIEQGAIEVENLGQQIDIRIREK 191

Query: 80  VSFV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGT----LKNNLLISQERA 134
            +F     FL+ KF P+++ IA ++   P   I +  HTD+        ++N  +S +RA
Sbjct: 192 GAFPEGSAFLQPKFRPLVRQIADLVKDVPG-RIRVSGHTDNQRIDSELYRSNWDLSAQRA 250

Query: 135 DVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
             +   + +    ++  + VRG A   P+  NDT+  R  N+R+EI I 
Sbjct: 251 VSVAQEMEKVRGFNHERLRVRGMADTEPLGPNDTEAQRSRNRRVEISIM 299


>gi|325274538|ref|ZP_08140599.1| OmpF family protein [Pseudomonas sp. TJI-51]
 gi|324100318|gb|EGB98103.1| OmpF family protein [Pseudomonas sp. TJI-51]
          Length = 345

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 33/175 (18%), Positives = 64/175 (36%), Gaps = 10/175 (5%)

Query: 17  GCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYI 76
           G                  +D  N     ++DK  D          + V   G      +
Sbjct: 177 GGSPKQTAAPAPAPVAEVCSDSDNDGVCDNVDKCPD------TPANVTVDADGCPAVAEV 230

Query: 77  P----VHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQE 132
                       +  ++      ++ +A  + ++P T   ++ HTDS+G    N  +S+ 
Sbjct: 231 VRVELDVKFDFDKSVVKPNSYGDIKNLADFMKQYPQTTTVVEGHTDSVGPDAYNQKLSER 290

Query: 133 RADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGN 187
           RA+ +K  L Q+    +  +   G+    P+  N T+ GR  N+R+E Q+  +  
Sbjct: 291 RANAVKQVLTQQYGVESSRVDSVGYGETRPVADNATEEGRAINRRVEAQVEAQAK 345


>gi|56461234|ref|YP_156515.1| flagellar motor protein MotB [Idiomarina loihiensis L2TR]
 gi|56180244|gb|AAV82966.1| Flagellar motor protein [Idiomarina loihiensis L2TR]
          Length = 312

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 34/167 (20%), Positives = 75/167 (44%), Gaps = 6/167 (3%)

Query: 22  SREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVS 81
           S         ++ +T+ + +     + + E + + +++   I + + G  I   I    S
Sbjct: 133 SDSADDQKEAEAENTEAMTQVSKELMRRIERQLENEIKAGTIELEQHGQQIIIRIREQGS 192

Query: 82  FV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSI----GTLKNNLLISQERADV 136
           F     FL+ +F P++Q +A  L   P   + I  H+D+         ++  +S +RA  
Sbjct: 193 FPEGSAFLQPQFRPIIQQVAGALKDIPG-EVTISGHSDNEKLVSEIYSSDWDLSSKRAVA 251

Query: 137 IKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
           +   +++    S   + V G++   P+  N+++  R+ N+R+EI I 
Sbjct: 252 VAEEMLKVDDFSEDRLVVMGYSDTKPLVPNNSEENRKRNRRVEISIM 298


>gi|58581292|ref|YP_200308.1| outer membrane protein P6 precursor [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|58425886|gb|AAW74923.1| outer membrane protein P6 precursor [Xanthomonas oryzae pv. oryzae
           KACC10331]
          Length = 181

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 33/188 (17%), Positives = 72/188 (38%), Gaps = 19/188 (10%)

Query: 1   MIKE---LGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQ 57
           M K    L +S+  +  ++GC    +E      + +  + +      S L          
Sbjct: 10  MNKSTRVLLVSLLSVAVLAGCSKKVKETPPPATNTTAGSSVPTGPSTSGL---------- 59

Query: 58  LQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHT 117
                     +         V    + +  L+ +F  ++   A  L   PS+ I +Q + 
Sbjct: 60  -----YGPGDLDTDACLRQRVVYFDLDQDSLKPEFQAIMACHAKYLRDRPSSRITLQGNA 114

Query: 118 DSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQR 177
           D  G+ + N+ + + R + + S L   G S+++ ++V  +  + P+ T   +     N+R
Sbjct: 115 DERGSREYNMGLGERRGNAVSSSLQAAGGSASQ-LTVVSYGEERPVCTESNESCWSQNRR 173

Query: 178 IEIQIFPR 185
           +EI    +
Sbjct: 174 VEIVYTAQ 181


>gi|113968724|ref|YP_732517.1| OmpA/MotB domain-containing protein [Shewanella sp. MR-4]
 gi|113883408|gb|ABI37460.1| OmpA/MotB domain protein [Shewanella sp. MR-4]
          Length = 202

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 36/185 (19%), Positives = 77/185 (41%), Gaps = 6/185 (3%)

Query: 2   IKELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDT 61
           +K L L M +   ++GC +  R+   +    +     ++ + G  + +A +      +  
Sbjct: 1   MKTLILFMSVAL-LAGCSM--RDTVNIEEMTTTQAYDLSDKDGDGVIEARERCNDTAKGA 57

Query: 62  GIVVSRIGDMITCYIP---VHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTD 118
           G      G +           +      ++  ++ P ++ IA  L ++P+T + I+ HT 
Sbjct: 58  GTDNYGCGQVKAINERKEINVLFPNDSAYIAPEYYPQIEEIAMFLRQYPTTKVTIEGHTS 117

Query: 119 SIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRI 178
             GT + N ++SQERAD + + L  R       ++  G+    P+    T      N+R+
Sbjct: 118 RTGTDERNAVLSQERADAVTAVLADRFSIDRSRLTAIGYGSSRPLVLEHTPDAETRNRRV 177

Query: 179 EIQIF 183
             ++ 
Sbjct: 178 VAEVT 182


>gi|21243867|ref|NP_643449.1| outer membrane protein P6 [Xanthomonas axonopodis pv. citri str.
           306]
 gi|21109468|gb|AAM37985.1| outer membrane protein P6 precursor [Xanthomonas axonopodis pv.
           citri str. 306]
          Length = 181

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 33/188 (17%), Positives = 71/188 (37%), Gaps = 19/188 (10%)

Query: 1   MIKE---LGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQ 57
           M K    L +S+  +  ++GC    +E        +  + +      S L          
Sbjct: 10  MNKSTRVLLVSLLSVAVLAGCSKKVKETPPPATDTTAGSSVPTGPSTSGL---------- 59

Query: 58  LQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHT 117
                     +         V    + +  L+ +F  ++   A  L   PS+ I +Q + 
Sbjct: 60  -----YGPGDLDADACLRQRVVYFDLDQDSLKPEFQAIMACHAKYLRDRPSSRITLQGNA 114

Query: 118 DSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQR 177
           D  G+ + N+ + + R + + S L   G S+++ ++V  +  + P+ T   +     N+R
Sbjct: 115 DERGSREYNMGLGERRGNAVSSSLQAAGGSASQ-LTVVSYGEERPVCTESNESCWSQNRR 173

Query: 178 IEIQIFPR 185
           +EI    +
Sbjct: 174 VEIVYTAQ 181


>gi|330014716|ref|ZP_08307964.1| OmpA family protein [Klebsiella sp. MS 92-3]
 gi|328532776|gb|EGF59559.1| OmpA family protein [Klebsiella sp. MS 92-3]
          Length = 568

 Score =  103 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 33/121 (27%), Positives = 58/121 (47%)

Query: 65  VSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLK 124
           V R+   +     + +    +  L+      L      +   P  +I +  HTDS+G  K
Sbjct: 423 VQRVAPNVIRLDSMSLFDTGKWVLKPGSTKRLVSSLMDIKARPGWLIVVAGHTDSVGEEK 482

Query: 125 NNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
            N L+S +RA+ ++ ++   G   +   +V+G+    PI TNDT  GR  N+R+EI + P
Sbjct: 483 ANQLLSLKRAESVRDWMRDTGDVPDSCFAVQGYGESRPIATNDTPEGRALNRRVEISLVP 542

Query: 185 R 185
           +
Sbjct: 543 Q 543


>gi|124006466|ref|ZP_01691299.1| outer membrane protein [Microscilla marina ATCC 23134]
 gi|123987879|gb|EAY27559.1| outer membrane protein [Microscilla marina ATCC 23134]
          Length = 693

 Score =  103 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 31/117 (26%), Positives = 51/117 (43%), Gaps = 1/117 (0%)

Query: 69  GDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLL 128
               +  +       ++  L+    P L  +  IL K P   I I  HTD+ G+   NL 
Sbjct: 578 NQGQSIRLNNLFFDYNQDTLKPSSYPELNRLIKILQKHPQMNIEISGHTDAHGSADKNLT 637

Query: 129 ISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPR 185
           +SQ RA+ +  YL  +   + + +  +G+    P+  N T  GR  N+R+E  I   
Sbjct: 638 LSQARANSVLRYLTTQ-GIAKQRLRAKGYGQGRPVANNTTVAGRALNRRVEFLILKE 693


>gi|325523338|gb|EGD01688.1| Outer membrane protein [Burkholderia sp. TJI49]
          Length = 552

 Score =  103 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 26/106 (24%), Positives = 49/106 (46%)

Query: 79  HVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIK 138
            +    +  L+      +     ++   P   I +  +TD++G   +NL +S  RA  ++
Sbjct: 443 SLFDSGKAQLKPDSTRAMVGALEMIKTHPDKRILVAGYTDNVGHPDSNLKLSVARAQAVR 502

Query: 139 SYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
            +LI+         +++G+    PI  NDT  GR  N+R+EI + P
Sbjct: 503 DWLIEASGIPATQFAIQGYGDTRPIADNDTPEGRARNRRVEITLVP 548


>gi|4580967|gb|AAD24554.1|AF117962_1 OprF [Pseudomonas chlororaphis subsp. chlororaphis]
          Length = 325

 Score =  103 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 24/105 (22%), Positives = 48/105 (45%)

Query: 78  VHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVI 137
                  +  ++      ++ +A  + + P T   ++ HTDS+G    N  +S+ RA+ +
Sbjct: 216 DVKFDFDKSVVKPNSYADIKNLADFMKQNPQTTTVVEGHTDSVGPDAYNQKLSERRANAV 275

Query: 138 KSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           K  L  +    +  +   G+    P+  N T+ GR  N+R+E Q+
Sbjct: 276 KQVLTSQYGVESSRVQSVGYGESRPVADNATEAGRAVNRRVEAQV 320


>gi|78048827|ref|YP_365002.1| PAL family outer membrane lipoprotein [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|294626855|ref|ZP_06705447.1| PAL family outer membrane lipoprotein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|294665412|ref|ZP_06730700.1| PAL family outer membrane lipoprotein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
 gi|325929356|ref|ZP_08190486.1| peptidoglycan-associated lipoprotein [Xanthomonas perforans 91-118]
 gi|78037257|emb|CAJ25002.1| PAL family outer membrane lipoprotein [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|292598869|gb|EFF43014.1| PAL family outer membrane lipoprotein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|292604823|gb|EFF48186.1| PAL family outer membrane lipoprotein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
 gi|325540268|gb|EGD11880.1| peptidoglycan-associated lipoprotein [Xanthomonas perforans 91-118]
          Length = 172

 Score =  103 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 33/188 (17%), Positives = 71/188 (37%), Gaps = 19/188 (10%)

Query: 1   MIKE---LGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQ 57
           M K    L +S+  +  ++GC    +E        +  + +      S L          
Sbjct: 1   MNKSTRVLLVSLLSVAVLAGCSKKVKETPPPATDTTAGSSVPTGPSTSGL---------- 50

Query: 58  LQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHT 117
                     +         V    + +  L+ +F  ++   A  L   PS+ I +Q + 
Sbjct: 51  -----YGPGDLDTDACLRQRVVYFDLDQDSLKPEFQAIMACHAKYLRDRPSSRITLQGNA 105

Query: 118 DSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQR 177
           D  G+ + N+ + + R + + S L   G S+++ ++V  +  + P+ T   +     N+R
Sbjct: 106 DERGSREYNMGLGERRGNAVSSSLQAAGGSASQ-LTVVSYGEERPVCTESNESCWSQNRR 164

Query: 178 IEIQIFPR 185
           +EI    +
Sbjct: 165 VEIVYTAQ 172


>gi|325279770|ref|YP_004252312.1| OmpA/MotB domain-containing protein [Odoribacter splanchnicus DSM
           20712]
 gi|324311579|gb|ADY32132.1| OmpA/MotB domain protein [Odoribacter splanchnicus DSM 20712]
          Length = 625

 Score =  103 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 32/110 (29%), Positives = 54/110 (49%), Gaps = 1/110 (0%)

Query: 73  TCYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQE 132
           T  +      V +  L  +  P L+ +   L + P   I I  HTD+ G+ ++N  +S+ 
Sbjct: 516 TLVLKGIFFDVDDYRLRPESYPELRQLVVFLKQNPEVKIEISGHTDNTGSDQHNYRLSEN 575

Query: 133 RADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           RA  +  YL    +   R    +G+    P+ TNDT+ GR+ N+R EI++
Sbjct: 576 RAFEVYKYLFLNHIQKERM-EYKGYGKDRPLRTNDTEEGRKENRRTEIRV 624


>gi|312887507|ref|ZP_07747103.1| OmpA/MotB domain protein [Mucilaginibacter paludis DSM 18603]
 gi|311299995|gb|EFQ77068.1| OmpA/MotB domain protein [Mucilaginibacter paludis DSM 18603]
          Length = 630

 Score =  103 bits (256), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 32/121 (26%), Positives = 55/121 (45%), Gaps = 1/121 (0%)

Query: 63  IVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGT 122
           + +  I       +       ++  ++ +    L  +   LN  PS  I +  HTD++G 
Sbjct: 510 VPLQAIETGNKVILKNIFFDTNKYDIKDESKTELAKLIAFLNDNPSVKIEVSGHTDNVGV 569

Query: 123 LKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
              N  +SQ RA  +  YLI + +S NR +  +G+    PI  N  + GR+ N+R E +I
Sbjct: 570 DAINQTLSQNRAKAVYQYLIGQHISPNRLVY-KGYGKAQPIAPNTNEEGRKLNRRTEFKI 628

Query: 183 F 183
            
Sbjct: 629 I 629


>gi|296329693|ref|ZP_06872178.1| flagellar motor protein MotB [Bacillus subtilis subsp. spizizenii
           ATCC 6633]
 gi|305674090|ref|YP_003865762.1| motility protein B; MotB component of the stator flagellum complex
           [Bacillus subtilis subsp. spizizenii str. W23]
 gi|296153191|gb|EFG94055.1| flagellar motor protein MotB [Bacillus subtilis subsp. spizizenii
           ATCC 6633]
 gi|305412334|gb|ADM37453.1| motility protein B; MotB component of the stator flagellum complex
           [Bacillus subtilis subsp. spizizenii str. W23]
          Length = 261

 Score =  103 bits (256), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 34/155 (21%), Positives = 65/155 (41%), Gaps = 5/155 (3%)

Query: 37  DIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV-SEVFLEKKFLPM 95
               K   +   + E   + +  +  +      + +   I   + F   +  + K+ +P+
Sbjct: 100 AADQKELENVKSQVEKFIKDKKLEHQLETKMTSEGLLITIKDSIFFDSGKATIRKEDVPL 159

Query: 96  LQLIATILNKFPSTVIAIQSHTDSIGT----LKNNLLISQERADVIKSYLIQRGVSSNRF 151
            + I+ +L   P   I I  HTD++       ++N  +S  RA      LI+      + 
Sbjct: 160 AKEISNLLVINPPRNIIISGHTDNMPIKNSEFQSNWHLSVMRAVNFMGLLIENPKLDAKV 219

Query: 152 ISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRG 186
            S +G+    P+ +N T  GR  N+R+E+ I PRG
Sbjct: 220 FSAKGYGEYKPVASNKTAEGRSKNRRVEVLILPRG 254


>gi|110834388|ref|YP_693247.1| OmpA family protein [Alcanivorax borkumensis SK2]
 gi|110647499|emb|CAL16975.1| OmpA family protein [Alcanivorax borkumensis SK2]
          Length = 362

 Score =  103 bits (256), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 32/164 (19%), Positives = 68/164 (41%), Gaps = 6/164 (3%)

Query: 23  REKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQM-QLQDTGIVVSRIGDMITCYIPVHVS 81
             ++   + + +  D          D+  +  Q  ++   G +++      T        
Sbjct: 204 ETREVEKIVEVSAPDSDGDGIPDDRDQCPNTIQGGKVDGEGCLLTNQ----TITFNNIGF 259

Query: 82  FVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYL 141
            +    +     P+L  +   L    +  + I  HTDS G+ + N  +S  RA  ++ YL
Sbjct: 260 ELDSANITASSRPILDRLVKALKSQTNFDVEIAGHTDSSGSAEYNEGLSDRRAKAVRQYL 319

Query: 142 IQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPR 185
           I +   S+  ++ RG+    P+ +N+T  GR  N+R+E ++  +
Sbjct: 320 IDQ-GISSERLTARGYGEVVPVASNETASGRAMNRRVEFRVSEQ 362


>gi|88810227|ref|ZP_01125484.1| OmpA/MotB [Nitrococcus mobilis Nb-231]
 gi|88791857|gb|EAR22967.1| OmpA/MotB [Nitrococcus mobilis Nb-231]
          Length = 263

 Score =  103 bits (256), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 30/143 (20%), Positives = 57/143 (39%), Gaps = 3/143 (2%)

Query: 45  SSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATILN 104
            +  +  +  + QL +  +   +    I   +   +       L+      L  +AT L 
Sbjct: 124 ETQQRQIEVLREQLAE--LKPKQTEQGIMLTLSHVLFAFDSARLQSAAQAPLDKLATYLR 181

Query: 105 KFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPID 164
           + P   + I  +TDS G    N  +S+ RA  +   +  +       + V G     P+ 
Sbjct: 182 ERPQIQVKIVGYTDSTGAANYNQRLSKRRAQSVADAMA-QRGVERASMRVVGRGESNPVA 240

Query: 165 TNDTKVGRQNNQRIEIQIFPRGN 187
           +N T+ GRQ N+R+E  +  + N
Sbjct: 241 SNATEQGRQLNRRVEFTLLNQAN 263


>gi|305665914|ref|YP_003862201.1| Thrombospondin type 3 repeat:OmpA/MotB [Maribacter sp. HTCC2170]
 gi|88710689|gb|EAR02921.1| Thrombospondin type 3 repeat:OmpA/MotB [Maribacter sp. HTCC2170]
          Length = 446

 Score =  103 bits (256), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 38/167 (22%), Positives = 76/167 (45%), Gaps = 15/167 (8%)

Query: 17  GCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYI 76
           GC    ++   V        D+      +   +  +E Q QL D    +           
Sbjct: 294 GCPWTDKDGDSVLDKDDQCPDVAGTVANNGCPEVTEEVQKQLNDYARTI----------- 342

Query: 77  PVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADV 136
              +    +  ++ +   ++  I  IL+++P+    ++ HTDS+G+ K N  +S+ RA+ 
Sbjct: 343 ---LFDTGKSSIKAESTSVMVDIIQILSEYPTAKFTVEGHTDSVGSAKLNQTLSESRANS 399

Query: 137 IKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
           ++ +LI +    +  +S  G+    PI TN+T+ GR+ N+R+EI + 
Sbjct: 400 VRDFLIDK-GIGSSRLSAIGYGEDKPIATNNTRSGRKQNRRVEINLV 445


>gi|110638331|ref|YP_678540.1| outer membrane protein [Cytophaga hutchinsonii ATCC 33406]
 gi|110281012|gb|ABG59198.1| possible outer membrane protein [Cytophaga hutchinsonii ATCC 33406]
          Length = 424

 Score =  103 bits (256), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 36/166 (21%), Positives = 68/166 (40%), Gaps = 2/166 (1%)

Query: 19  GLASREKKKVFLHKSNDTDIVNKRFG-SSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIP 77
            +   E  K  + ++            +   K     + +++     V  +       + 
Sbjct: 258 AVVQDEPVKPAVIENTTVVSTTTILQPADTSKQIKTTKTEIKPKDESVFDVKKGDKIVLK 317

Query: 78  VHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVI 137
             +   S+     +    L  +   +N+ P   I +  HTD+ G    NL +S+ERA  +
Sbjct: 318 HVLFVQSKDDFLPESYAELDRLVATMNQHPQITIEVSGHTDNQGNRDLNLKLSEERAIKV 377

Query: 138 KSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
           K YL+ R     + I+V+G+    PI  NDT+  R+ N+R+E +I 
Sbjct: 378 KDYLVSR-GIEAKRINVKGYGPDKPISANDTEEHRRLNRRVEFEII 422


>gi|88859188|ref|ZP_01133829.1| flagellar motor protein [Pseudoalteromonas tunicata D2]
 gi|88819414|gb|EAR29228.1| flagellar motor protein [Pseudoalteromonas tunicata D2]
          Length = 290

 Score =  103 bits (256), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 41/173 (23%), Positives = 74/173 (42%), Gaps = 7/173 (4%)

Query: 23  REKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF 82
            +        +++     ++    + K   + + Q+QD  I +  +G  I   I  + SF
Sbjct: 112 SQSTAKSEAAASEKTADQEQVNELVKKIAQQLEEQIQDGAIELESLGQQIIIRIRENGSF 171

Query: 83  V-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGT----LKNNLLISQERADVI 137
                FL+ +F P++Q IA +L   P   I +  HTD          NN  +S +R+  +
Sbjct: 172 PSGSAFLQPQFKPIIQKIADLLKDVPG-EITVSGHTDDYQVSNELYFNNWDLSAKRSVAV 230

Query: 138 KSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGNIKK 190
            S + +        + V G A   P+  N+    R+ N+R+EI I  +G  K+
Sbjct: 231 ASEMQKVSGFDKNRMVVIGHADTRPLVPNEDSESRKRNRRVEISIM-QGKAKE 282


>gi|297618036|ref|YP_003703195.1| OmpA/MotB domain protein [Syntrophothermus lipocalidus DSM 12680]
 gi|297145873|gb|ADI02630.1| OmpA/MotB domain protein [Syntrophothermus lipocalidus DSM 12680]
          Length = 258

 Score =  103 bits (256), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 32/196 (16%), Positives = 72/196 (36%), Gaps = 17/196 (8%)

Query: 6   GLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSS------LDKAEDEFQMQLQ 59
            L+  +   +SG  ++  E     + +     I+ +  G +      L+  E +    ++
Sbjct: 52  ALANSLSMVLSGKSISIMETPGPSVVEGRSGQIIREGQGDTPTLQGNLEAIEKQLAEYIK 111

Query: 60  D-----TGIVVSRIGDMITCYIPVHVSFV-SEVFLEKKFLPMLQLIATILNKFPSTVIAI 113
                   IV+      +   +   + F      L  +   +++ +   L   P+  + +
Sbjct: 112 SEEGLAGNIVLMEQERGLVISLKDTLLFPKGSDVLTPRAHEIIRKVGESLKTIPNY-VRV 170

Query: 114 QSHTD----SIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTK 169
           + HTD    +     +N  +S  RA  +   L          +S  G+    P+  ND++
Sbjct: 171 EGHTDDLPINTPKFPSNWELSVLRATNVVHVLAGEVGIPPDRLSATGYGEYRPLMPNDSE 230

Query: 170 VGRQNNQRIEIQIFPR 185
             R  N+R++I I  +
Sbjct: 231 PNRAMNRRVDIVILKQ 246


>gi|326798930|ref|YP_004316749.1| OmpA/MotB domain protein [Sphingobacterium sp. 21]
 gi|326549694|gb|ADZ78079.1| OmpA/MotB domain protein [Sphingobacterium sp. 21]
          Length = 229

 Score =  103 bits (256), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 44/172 (25%), Positives = 77/172 (44%), Gaps = 4/172 (2%)

Query: 20  LASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVH 79
             +       +       +     G  +DK   E +  +   G  V + G+ I       
Sbjct: 53  KKAGNTAVGAIIGGALGGVAGGLIGKKMDKQAAEIERTV--DGAEVVQAGEGIIVKFDSG 110

Query: 80  VSF-VSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIK 138
           + F   +  L+ +    ++ +   LN  P T I I  HTD+ GT + N  +S+ RA  +K
Sbjct: 111 ILFGFDQTALKPEAQTNIKNLVKSLNDNPDTDILIIGHTDNKGTAEYNQGLSERRAAAVK 170

Query: 139 SYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGNIKK 190
           +Y + +G+SS+R  +  G ++  PI  N T+ GR  N+R+EI I     +K+
Sbjct: 171 NYAVAQGLSSSRAKT-EGKSFNEPIADNSTEAGRAQNRRVEIVIVANEKMKE 221


>gi|147678453|ref|YP_001212668.1| flagellar motor protein [Pelotomaculum thermopropionicum SI]
 gi|146274550|dbj|BAF60299.1| flagellar motor protein [Pelotomaculum thermopropionicum SI]
          Length = 255

 Score =  103 bits (256), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 35/192 (18%), Positives = 67/192 (34%), Gaps = 15/192 (7%)

Query: 6   GLSMFIMTTISGCGLASREKKKVFLHKSNDTDI-----VNKRFGSSLDKAEDEFQMQLQD 60
            ++M + + + G      E         + + +           + L+    E Q  ++ 
Sbjct: 51  AIAMSLASAMGGGQSVMTEPGASLAPGVSGSSLPADLGQAAAEAADLESLRRELQEYIEQ 110

Query: 61  TG----IVVSRIGDMITCYIPVHVSFV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQS 115
            G    + V+     +         F      L  +    +  I  IL K P+  I ++ 
Sbjct: 111 NGLTGRVSVNLEERGLVLSFLDVALFPLGSARLTPEAQETVGKIGKILLKAPNY-IRVEG 169

Query: 116 HTDSIGTLKN----NLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVG 171
           HTD++         N  +S  RA  +   LI +       +S  G+    P   ND+   
Sbjct: 170 HTDNLPINTREFPSNWELSVARATSVVQELIHKLNFPPERLSATGYGEFRPRMPNDSAEH 229

Query: 172 RQNNQRIEIQIF 183
           RQ N+R+++ I 
Sbjct: 230 RQQNRRVDLVIL 241


>gi|262194964|ref|YP_003266173.1| OmpA/MotB domain protein [Haliangium ochraceum DSM 14365]
 gi|262078311|gb|ACY14280.1| OmpA/MotB domain protein [Haliangium ochraceum DSM 14365]
          Length = 623

 Score =  103 bits (256), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 31/115 (26%), Positives = 56/115 (48%), Gaps = 1/115 (0%)

Query: 70  DMITCYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLI 129
           D     I       ++  +  +  P+L+ +A +LN  P   + ++ HTD  G    N  +
Sbjct: 502 DGSIEIIEKVYFPNNQARILPRSFPVLKEVARVLNNHPDIELRVEGHTDDRGNDTYNRKL 561

Query: 130 SQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           SQ RAD + ++L+++   +   +S +GF  + PI  N +  GR  N+R+E  I  
Sbjct: 562 SQRRADSVVAFLVEQ-GIAAERLSAKGFGEERPIADNASAQGRDQNRRVEFVITN 615


>gi|260551454|ref|ZP_05825638.1| peptidoglycan-associated lipoprotein [Acinetobacter sp. RUH2624]
 gi|260405448|gb|EEW98941.1| peptidoglycan-associated lipoprotein [Acinetobacter sp. RUH2624]
          Length = 191

 Score =  103 bits (256), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 33/184 (17%), Positives = 66/184 (35%), Gaps = 10/184 (5%)

Query: 1   MIKELGLSMF----IMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQM 56
           M+K +    F    +   ++GC       +K     +  T   +    + L +       
Sbjct: 4   MMKSIKYLAFPLLSVALVMTGCAS-----RKPATTANAGTTNPSTVNTTGLSEDAALNAQ 58

Query: 57  QLQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSH 116
            L           +       V         L  +    LQ  A  L    ++ +A+  H
Sbjct: 59  NLAGASSKGVTEANKAALAKRVVHFDYDSSDLSAEDYQTLQAHAQFLMANANSKVALTGH 118

Query: 117 TDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQ 176
           TD  GT + N+ + + RA  ++SYLI     + + +    +  + P++    +   + N+
Sbjct: 119 TDERGTREYNMALGERRAKAVQSYLIT-SGVNPQQLEAVSYGKEAPVNPGHDESAWKENR 177

Query: 177 RIEI 180
           R+EI
Sbjct: 178 RVEI 181


>gi|161504616|ref|YP_001571728.1| hypothetical protein SARI_02730 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|160865963|gb|ABX22586.1| hypothetical protein SARI_02730 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 574

 Score =  103 bits (256), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 31/109 (28%), Positives = 53/109 (48%)

Query: 79  HVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIK 138
            +    +  L+     ML      +   P  +I +  HTD+ G  K N  +S +RA+ ++
Sbjct: 443 SLFDSGKSALKAGSTRMLVNSLVGIKAKPGWLIVVSGHTDNTGNPKLNQTLSLKRAEAVR 502

Query: 139 SYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGN 187
           +++   G       +V+G+    PI TNDT  GR  N+R+EI + P+ N
Sbjct: 503 NWMRDTGDVPESCFAVQGYGESRPIATNDTPEGRALNRRVEISLVPQAN 551


>gi|21232447|ref|NP_638364.1| outer membrane protein P6 precursor [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66767470|ref|YP_242232.1| outer membrane protein P6 precursor [Xanthomonas campestris pv.
           campestris str. 8004]
 gi|188990576|ref|YP_001902586.1| PAL family outer membrane lipoprotein [Xanthomonas campestris pv.
           campestris str. B100]
 gi|21114228|gb|AAM42288.1| outer membrane protein P6 precursor [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66572802|gb|AAY48212.1| outer membrane protein P6 precursor [Xanthomonas campestris pv.
           campestris str. 8004]
 gi|167732336|emb|CAP50528.1| PAL family outer membrane lipoprotein [Xanthomonas campestris pv.
           campestris]
          Length = 172

 Score =  103 bits (256), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 33/188 (17%), Positives = 71/188 (37%), Gaps = 19/188 (10%)

Query: 1   MIKE---LGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQ 57
           M K    L +S+  +  ++GC    +E        +  +        S L          
Sbjct: 1   MNKSTRVLLVSLLSVAVLAGCSKKVKETPPPATDTTAGSTAPTGPSTSGL---------- 50

Query: 58  LQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHT 117
                     +         V    + +  L+ +F  ++   A  L   PS+ I +Q + 
Sbjct: 51  -----YGPGDLDTDACLRQRVVYFDLDQDSLKPEFQAIMACHAKYLRDRPSSRITLQGNA 105

Query: 118 DSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQR 177
           D  G+ + N+ + + R + + S L   G S+++ ++V  +  + P+ T  ++     N+R
Sbjct: 106 DERGSREYNMGLGERRGNAVSSALQAAGGSASQ-LTVVSYGEERPVCTETSESCWSQNRR 164

Query: 178 IEIQIFPR 185
           +EI    +
Sbjct: 165 VEIVYTAQ 172


>gi|323495403|ref|ZP_08100480.1| outer membrane protein OmpA [Vibrio brasiliensis LMG 20546]
 gi|323310326|gb|EGA63513.1| outer membrane protein OmpA [Vibrio brasiliensis LMG 20546]
          Length = 322

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 26/107 (24%), Positives = 55/107 (51%), Gaps = 1/107 (0%)

Query: 76  IPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERAD 135
           +      ++   L+++   +L  +   +N++P   + I  +TDS G    N  +S++RA 
Sbjct: 210 VDSGSFALNSSELKEESKSILDELVQFMNQYPQANVEITGYTDSSGAAAYNQKLSEKRAQ 269

Query: 136 VIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
            + +  ++     +  I+V G     PI +N+T+ GR+ N+R+EI +
Sbjct: 270 SVAN-ALESEGIDSSRITVSGEGENNPIASNETREGREQNRRVEIVV 315


>gi|167032610|ref|YP_001667841.1| OmpF family protein [Pseudomonas putida GB-1]
 gi|166859098|gb|ABY97505.1| OmpF family protein [Pseudomonas putida GB-1]
          Length = 344

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 27/126 (21%), Positives = 54/126 (42%), Gaps = 4/126 (3%)

Query: 61  TGIVVSRIGDMITCYIP----VHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSH 116
             + V   G      +            +  ++      ++ +A  + ++P T   ++ H
Sbjct: 214 ANVTVDADGCPAVAEVVRVELDVKFDFDKSVVKPNSYGDIKNLADFMKQYPQTTTVVEGH 273

Query: 117 TDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQ 176
           TDS+G    N  +S+ RA+ +K  L Q+    +  +   G+    P+  N T+ GR  N+
Sbjct: 274 TDSVGPDAYNQKLSERRANAVKQVLTQQYGVESSRVDSVGYGETRPVADNATEEGRAINR 333

Query: 177 RIEIQI 182
           R+E Q+
Sbjct: 334 RVEAQV 339


>gi|532658|gb|AAA99311.1| antigen [Treponema pallidum]
          Length = 416

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 42/157 (26%), Positives = 65/157 (41%), Gaps = 5/157 (3%)

Query: 34  NDTDIVNKRFGSSLDKAED--EFQMQLQD---TGIVVSRIGDMITCYIPVHVSFVSEVFL 88
             T           D A    E Q  L+D       V    + +T  I           L
Sbjct: 260 QGTATAKNFAPERFDPARTVVELQETLKDLHMPDAKVRETEEGVTISIENVQFDADSASL 319

Query: 89  EKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSS 148
                  L+ IA +L  FP   + +  H +  G++++   IS+ERADV+  YL + GV  
Sbjct: 320 APSEYEKLRKIAELLRAFPDRELLVSGHAERRGSVQDQQRISEERADVVARYLQELGVVD 379

Query: 149 NRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPR 185
              +  RG   +  I  ND++ GR+ N+R+EI I  +
Sbjct: 380 AAHVYTRGCGAQQSIAPNDSEDGRRKNRRVEITIISK 416


>gi|315180895|gb|ADT87809.1| sodium-driven polar flagellar protein [Vibrio furnissii NCTC 11218]
          Length = 320

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 37/180 (20%), Positives = 77/180 (42%), Gaps = 12/180 (6%)

Query: 15  ISGCGL--ASREKKKVFLHKSNDTDIVNKRFGSSLDK----AEDEFQMQLQDTGIVVSRI 68
           ++G      + +  +    +       ++     ++      +   Q +++   I V  +
Sbjct: 123 LTGGQSPETATQDNQNTETEMQQQQAQSQSMSEEMETVLESIKKALQREIEQGAIEVENL 182

Query: 69  GDMITCYIPVHVSFV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSI----GTL 123
           G  I   I    +F     FL+ KF P+++ IA ++   P   + +  HTD+        
Sbjct: 183 GQQIVIRIREKGAFPEGSAFLQPKFRPLVRQIADLVKDVPGI-VRVSGHTDNQRLDSELY 241

Query: 124 KNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
           ++N  +S +RA  +   + +    +++ + VRG A   P+  NDT+  R  N+R+EI I 
Sbjct: 242 RSNWDLSAQRAVSVAQEMEKVKGFNHQRLQVRGMADTDPLGPNDTEAQRSRNRRVEISIM 301


>gi|169831941|ref|YP_001717923.1| OmpA/MotB domain-containing protein [Candidatus Desulforudis
           audaxviator MP104C]
 gi|169638785|gb|ACA60291.1| OmpA/MotB domain protein [Candidatus Desulforudis audaxviator
           MP104C]
          Length = 257

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 33/142 (23%), Positives = 57/142 (40%), Gaps = 6/142 (4%)

Query: 48  DKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKF 106
            + ++  +       I ++     +   I   V F      L      ++  +  IL + 
Sbjct: 106 KQVQELMEEAGLTAHIEMTTEERGLVISIQDTVLFATGSADLTPTAREIMDKLGLILLQT 165

Query: 107 PSTVIAIQSHTDSIGTLKN----NLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYP 162
           P+  I I+ HTD++         N  +S  R+  +  YLI R       +S  G+    P
Sbjct: 166 PNY-IRIEGHTDNVPINTPRFPSNWELSAARSTSVVRYLIARHNFPPERLSATGYGEYRP 224

Query: 163 IDTNDTKVGRQNNQRIEIQIFP 184
            DTNDT  GRQ N+R++  +  
Sbjct: 225 RDTNDTAQGRQRNRRVDFVVLS 246


>gi|325923680|ref|ZP_08185304.1| outer membrane protein/peptidoglycan-associated (lipo)protein
           [Xanthomonas gardneri ATCC 19865]
 gi|325545846|gb|EGD17076.1| outer membrane protein/peptidoglycan-associated (lipo)protein
           [Xanthomonas gardneri ATCC 19865]
          Length = 407

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 33/148 (22%), Positives = 58/148 (39%), Gaps = 6/148 (4%)

Query: 41  KRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIA 100
              G  ++  +D+         I        ++  +       ++  L      +L    
Sbjct: 258 DDDGDGVNNCDDKCPASQPGQTIGPDGCPVPVSIDLKGVNFDFNKSTLRPDAQSILSEAT 317

Query: 101 TILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYK 160
            IL ++P   + +  HTDS GT   N  +S+ RA  +  YL + GV ++R +   G+   
Sbjct: 318 EILKRYPDLKVEVAGHTDSKGTDAYNQKLSERRATTVYDYLTKNGVDASRLVGPIGYGES 377

Query: 161 YPIDTN------DTKVGRQNNQRIEIQI 182
            PI  N      D   GR  N+R E+ +
Sbjct: 378 RPIAPNANPDGSDNPEGRAKNRRTELNV 405


>gi|325918947|ref|ZP_08181016.1| outer membrane protein/peptidoglycan-associated (lipo)protein
           [Xanthomonas vesicatoria ATCC 35937]
 gi|325534834|gb|EGD06761.1| outer membrane protein/peptidoglycan-associated (lipo)protein
           [Xanthomonas vesicatoria ATCC 35937]
          Length = 365

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 33/148 (22%), Positives = 58/148 (39%), Gaps = 6/148 (4%)

Query: 41  KRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIA 100
              G  ++  +D+         I        ++  +       ++  L      +L    
Sbjct: 216 DDDGDGVNNCDDKCPASQPGQTIGPDGCPVPVSIDLKGVNFDFNKSTLRPDAQSILSEAT 275

Query: 101 TILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYK 160
            IL ++P   + +  HTDS GT   N  +S+ RA  +  YL + GV ++R +   G+   
Sbjct: 276 EILKRYPDLKVEVAGHTDSKGTDAYNQKLSERRATTVYDYLTKNGVDASRLVGPIGYGES 335

Query: 161 YPIDTN------DTKVGRQNNQRIEIQI 182
            PI  N      D   GR  N+R E+ +
Sbjct: 336 RPIAPNANPDGSDNPEGRAKNRRTELNV 363


>gi|311104068|ref|YP_003976921.1| inner membrane lipoprotein YiaD [Achromobacter xylosoxidans A8]
 gi|310758757|gb|ADP14206.1| inner membrane lipoprotein YiaD [Achromobacter xylosoxidans A8]
          Length = 215

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 42/206 (20%), Positives = 72/206 (34%), Gaps = 25/206 (12%)

Query: 1   MIKELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKR------------------ 42
           +   + +       ++GC    +    V                                
Sbjct: 6   IFNRIAVVAATGALLAGCATQQQTNTAVGTGAGAAIGAGIGALIGHGKGAAIGAGIGAVA 65

Query: 43  ---FGSSLDKAEDEFQMQLQDT-GIVVSRIGDM-ITCYIPVHV-SFVSEVFLEKKFLPML 96
               G +    +++ Q     + GI V  + D  +   IP  V     +  L+   LP+L
Sbjct: 66  GGLVGYNWKVVKEDVQKSGASSLGIDVVEMPDGSLKVNIPSGVSFDTDKTQLKPALLPVL 125

Query: 97  QLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRG 156
             +A  LN+ P     +  HTDS G L +N  +S  RA  +    + +   +   ++V G
Sbjct: 126 DSVARSLNQHPELRAKVVGHTDSTGALAHNQTLSVNRAKSVTD-YLGKQGVAAGRLTVEG 184

Query: 157 FAYKYPIDTNDTKVGRQNNQRIEIQI 182
                PI  N T  GR  N+R+EI +
Sbjct: 185 RGPNDPIGDNATAEGRALNRRVEIYL 210


>gi|15639284|ref|NP_218733.1| outer membrane protein (tpn50) [Treponema pallidum subsp. pallidum
           str. Nichols]
 gi|189025526|ref|YP_001933298.1| outer membrane protein TpN50 [Treponema pallidum subsp. pallidum
           SS14]
 gi|586110|sp|P38369|TPN50_TREPA RecName: Full=Outer membrane protein tpn50; AltName: Full=Antigen
           tpp57; Flags: Precursor
 gi|3322558|gb|AAC65272.1| outer membrane protein (tpn50) [Treponema pallidum subsp. pallidum
           str. Nichols]
 gi|7144504|gb|AAA20517.2| TpN50 precursor [Treponema pallidum]
 gi|189018101|gb|ACD70719.1| outer membrane protein TpN50 [Treponema pallidum subsp. pallidum
           SS14]
 gi|291059692|gb|ADD72427.1| outer membrane protein Tpn50 (Antigen tpp57) [Treponema pallidum
           subsp. pallidum str. Chicago]
          Length = 417

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 42/157 (26%), Positives = 64/157 (40%), Gaps = 5/157 (3%)

Query: 34  NDTDIVNKRFGSSLDKAED--EFQMQLQD---TGIVVSRIGDMITCYIPVHVSFVSEVFL 88
             T           D A    E Q  L+D       V    + +T  I           L
Sbjct: 261 QGTATAKNFAPERFDPARTVVELQETLKDLHMPDAKVRETEEGVTISIENVQFDADSASL 320

Query: 89  EKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSS 148
                  L+ IA +L  FP   + +  H    G++++   IS+ERADV+  YL + GV  
Sbjct: 321 APSEYEKLRKIAELLRAFPDRELLVSGHAARRGSVQDQQRISEERADVVARYLQELGVVD 380

Query: 149 NRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPR 185
              +  RG   +  I  ND++ GR+ N+R+EI I  +
Sbjct: 381 AAHVYTRGCGAQQSIAPNDSEDGRRKNRRVEITIISK 417


>gi|332981443|ref|YP_004462884.1| OmpA/MotB domain-containing protein [Mahella australiensis 50-1
           BON]
 gi|332699121|gb|AEE96062.1| OmpA/MotB domain protein [Mahella australiensis 50-1 BON]
          Length = 251

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 35/176 (19%), Positives = 71/176 (40%), Gaps = 10/176 (5%)

Query: 15  ISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITC 74
           +S       ++ +    ++N+     +     + +     Q       + ++     I  
Sbjct: 65  MSSVPATGGDEGQDLEQRTNEPQDEFESLYEDMQRY---IQQNNIAATVEMTENKMEILL 121

Query: 75  YIPVHVSFV-SEVFLEKKFLPMLQLIATILNKFPSTV--IAIQSHTDSIG----TLKNNL 127
               +V F   +  +    LP+L  IA +L  +   +  + I+ HTD++        +N 
Sbjct: 122 RFKDNVLFESGKADIIPSALPVLNNIAGVLKTYKEQIGGVRIEGHTDNVPIHTVMFPSNW 181

Query: 128 LISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
            +S  RA  +  Y ++R       +S  G+   +P+ TNDT  GR  N+R++I I 
Sbjct: 182 ELSTARAVTVLRYFVERQHLPPEMLSAVGYGEYHPVATNDTIEGRAKNRRVDIVIT 237


>gi|84623210|ref|YP_450582.1| outer membrane protein P6 precursor [Xanthomonas oryzae pv. oryzae
           MAFF 311018]
 gi|84367150|dbj|BAE68308.1| outer membrane protein P6 precursor [Xanthomonas oryzae pv. oryzae
           MAFF 311018]
          Length = 172

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 33/188 (17%), Positives = 72/188 (38%), Gaps = 19/188 (10%)

Query: 1   MIKE---LGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQ 57
           M K    L +S+  +  ++GC    +E      + +  + +      S L          
Sbjct: 1   MNKSTRVLLVSLLSVAVLAGCSKKVKETPPPATNTTAGSSVPTGPSTSGL---------- 50

Query: 58  LQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHT 117
                     +         V    + +  L+ +F  ++   A  L   PS+ I +Q + 
Sbjct: 51  -----YGPGDLDTDACLRQRVVYFDLDQDSLKPEFQAIMACHAKYLRDRPSSRITLQGNA 105

Query: 118 DSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQR 177
           D  G+ + N+ + + R + + S L   G S+++ ++V  +  + P+ T   +     N+R
Sbjct: 106 DERGSREYNMGLGERRGNAVSSSLQAAGGSASQ-LTVVSYGEERPVCTESNESCWSQNRR 164

Query: 178 IEIQIFPR 185
           +EI    +
Sbjct: 165 VEIVYTAQ 172


>gi|291483903|dbj|BAI84978.1| flagellar motor protein MotB [Bacillus subtilis subsp. natto
           BEST195]
          Length = 260

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 33/155 (21%), Positives = 65/155 (41%), Gaps = 5/155 (3%)

Query: 37  DIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV-SEVFLEKKFLPM 95
               +   +   + E   + +  +  +      + +   I   + F   +  + K+ +P+
Sbjct: 99  AADQEELENVKSQVEKFIKDKKLEHQLETKMTSEGLLITIKDSIFFDSGKATIRKEDVPL 158

Query: 96  LQLIATILNKFPSTVIAIQSHTDSIGT----LKNNLLISQERADVIKSYLIQRGVSSNRF 151
            + I+ +L   P   I I  HTD++       ++N  +S  RA      LI+      + 
Sbjct: 159 AKEISNLLVINPPRNIIISGHTDNMPIKNSEFQSNWHLSVMRAVNFMGLLIENPKLDAKV 218

Query: 152 ISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRG 186
            S +G+    P+ +N T  GR  N+R+E+ I PRG
Sbjct: 219 FSAKGYGEYKPVASNKTAEGRSKNRRVEVLILPRG 253


>gi|26988814|ref|NP_744239.1| OmpF family protein [Pseudomonas putida KT2440]
 gi|148548857|ref|YP_001268959.1| OmpF family protein [Pseudomonas putida F1]
 gi|24983615|gb|AAN67703.1|AE016401_6 outer membrane protein OprF [Pseudomonas putida KT2440]
 gi|148512915|gb|ABQ79775.1| OmpF family protein [Pseudomonas putida F1]
 gi|313499790|gb|ADR61156.1| OprF [Pseudomonas putida BIRD-1]
          Length = 344

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 27/131 (20%), Positives = 55/131 (41%), Gaps = 4/131 (3%)

Query: 61  TGIVVSRIGDMITCYIP----VHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSH 116
             + V   G      +            +  ++      ++ +A  + ++P T   ++ H
Sbjct: 214 ANVTVDADGCPAVAEVVRVELDVKFDFDKSVVKPNSYGDIKNLADFMKQYPQTTTVVEGH 273

Query: 117 TDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQ 176
           TDS+G    N  +S+ RA+ +K  L Q+    +  +   G+    P+  N T+ GR  N+
Sbjct: 274 TDSVGPDAYNQKLSERRANAVKQVLTQQYGVESSRVDSVGYGETRPVADNATEEGRAVNR 333

Query: 177 RIEIQIFPRGN 187
           R+E Q+  +  
Sbjct: 334 RVEAQVEAQAK 344


>gi|323498631|ref|ZP_08103623.1| flagellar motor protein MotB [Vibrio sinaloensis DSM 21326]
 gi|323316329|gb|EGA69348.1| flagellar motor protein MotB [Vibrio sinaloensis DSM 21326]
          Length = 314

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 36/175 (20%), Positives = 76/175 (43%), Gaps = 6/175 (3%)

Query: 20  LASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVH 79
                +      +   +  +++   + ++  +   + +++   I V  +G  I   I   
Sbjct: 132 STQNNQNSESDSQQQQSAEMSQELETLMESIKKALEREIEQGAIEVENLGQQIDIRIREK 191

Query: 80  VSFV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGT----LKNNLLISQERA 134
            +F     FL+ KF P+++ IA ++   P   I +  HTD+        ++N  +S +RA
Sbjct: 192 GAFPEGSAFLQPKFRPLVRQIAELVKDIPGI-IRVSGHTDNQRIESELYRSNWDLSAQRA 250

Query: 135 DVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGNIK 189
             +   + +    + + + VRG A   P+  NDT+  R  N+R+EI I     ++
Sbjct: 251 VSVAQEMEKVRGFTPQRLRVRGMADTEPLGPNDTEAQRSRNRRVEISIMQGEALQ 305


>gi|307545103|ref|YP_003897582.1| OmpA/MotB [Halomonas elongata DSM 2581]
 gi|307217127|emb|CBV42397.1| OmpA/MotB [Halomonas elongata DSM 2581]
          Length = 270

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 36/167 (21%), Positives = 63/167 (37%), Gaps = 6/167 (3%)

Query: 19  GLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQD-----TGIVVSRIGDMIT 73
                              +     G  LD   D              G  V+ +G +  
Sbjct: 101 SDGDGVPDDKDQCPGTPAGVAVDAVGCPLDSDGDGVPDYQDQCPGTPAGAEVNALGCVED 160

Query: 74  CYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQER 133
             +           L      +L  +A+ L    +  + I+ HTDS+G  + N  +SQ R
Sbjct: 161 LVLQDVNFEFDSAQLTMGAESVLTDVASKLRANENVRVRIEGHTDSVGPAQYNKDLSQRR 220

Query: 134 ADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEI 180
           AD + S+L  +   +   ++  G+  + P+ +NDTK GR  N+R+E+
Sbjct: 221 ADSVASFLASQ-GIAANRMTTIGYGEEQPVASNDTKAGRAENRRVEL 266


>gi|260767264|ref|ZP_05876205.1| Flagellar motor rotation protein MotB [Vibrio furnissii CIP 102972]
 gi|260617772|gb|EEX42950.1| Flagellar motor rotation protein MotB [Vibrio furnissii CIP 102972]
          Length = 320

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 37/180 (20%), Positives = 77/180 (42%), Gaps = 12/180 (6%)

Query: 15  ISGCGL--ASREKKKVFLHKSNDTDIVNKRFGSSLDK----AEDEFQMQLQDTGIVVSRI 68
           ++G      + +  +    +       ++     ++      +   Q +++   I V  +
Sbjct: 123 LTGGQSPETATQDNQNTETEMQQQQAQSQSMSEEMETVLESIKKALQREIEQGAIEVENL 182

Query: 69  GDMITCYIPVHVSFV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSI----GTL 123
           G  I   I    +F     FL+ KF P+++ IA ++   P   + +  HTD+        
Sbjct: 183 GQQIVIRIREKGAFPEGSAFLQPKFRPLVRQIADLVKDVPGI-VRVSGHTDNQRLDSELY 241

Query: 124 KNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
           ++N  +S +RA  +   + +    +++ + VRG A   P+  NDT+  R  N+R+EI I 
Sbjct: 242 RSNWDLSAQRAVSVAQEMEKVKGFNHQRLQVRGMADTDPLGPNDTEAQRSRNRRVEISIM 301


>gi|4580972|gb|AAD24559.1|AF117967_1 OprF [Pseudomonas putida]
          Length = 338

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 26/123 (21%), Positives = 52/123 (42%), Gaps = 4/123 (3%)

Query: 61  TGIVVSRIGDMITCYIP----VHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSH 116
             + V   G      +            +  ++      ++ +A  + ++P T   ++ H
Sbjct: 214 ANVTVDADGCPAVAEVVRVELDVKFDFDKSVVKPNSYGDIKNLADFMKQYPQTTTVVEGH 273

Query: 117 TDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQ 176
           TDS+G    N  +S+ RA+ +K  L Q+    +  +   G+    P+  N T+ GR  N+
Sbjct: 274 TDSVGPDAYNQKLSERRANAVKQVLTQQYGVESTRVDSVGYGETRPVADNATEEGRAVNR 333

Query: 177 RIE 179
           R+E
Sbjct: 334 RVE 336


>gi|134298231|ref|YP_001111727.1| OmpA/MotB domain-containing protein [Desulfotomaculum reducens
           MI-1]
 gi|134050931|gb|ABO48902.1| OmpA/MotB domain protein [Desulfotomaculum reducens MI-1]
          Length = 236

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 32/177 (18%), Positives = 66/177 (37%), Gaps = 6/177 (3%)

Query: 12  MTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKA-EDEFQMQLQDTGIVVSRIGD 70
               SG G+   +     L    +           L K  +   +     T +  + I +
Sbjct: 54  AALNSGAGIMESKSLSDQLIDKTEVKTDTVVELQELKKQLDQYIKENNMTTEVETNIINN 113

Query: 71  MITCYIPVH-VSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTL----KN 125
            +T  I    +       ++ +   +++ + +IL ++P   + +  HTD+        ++
Sbjct: 114 HLTLTIRDRALFDSGSAVVKPQSRKIIKAMGSILQQYPKFEVLVAGHTDNQPIYNNTFES 173

Query: 126 NLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           N  +S +RA      ++       R +   G+    PI  N T  GR  N+R+E+ I
Sbjct: 174 NWDLSSKRALNCMKIMLTNKNLDPRRLVAIGYGEYRPIAENTTTEGRAKNRRVEVII 230


>gi|170720793|ref|YP_001748481.1| OmpF family protein [Pseudomonas putida W619]
 gi|169758796|gb|ACA72112.1| OmpF family protein [Pseudomonas putida W619]
          Length = 345

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 33/173 (19%), Positives = 65/173 (37%), Gaps = 10/173 (5%)

Query: 19  GLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIP- 77
           G   +            +D  N     ++DK  D          + V   G      +  
Sbjct: 179 GSGGKVAPAPAPVAEVCSDSDNDGVCDNVDKCPD------TPANVTVDADGCPAVAEVVR 232

Query: 78  ---VHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERA 134
                     +  ++      ++ +A  + ++P T   ++ HTDS+G    N  +S+ RA
Sbjct: 233 VELDVKFDFDKSVVKPNSYGDIKNLADFMKQYPQTTTVVEGHTDSVGPDAYNQKLSERRA 292

Query: 135 DVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGN 187
           + +K  L Q+    +  +   G+    P+  N T+ GR  N+R+E Q+  +  
Sbjct: 293 NAVKEVLTQQYGVESTRVDSVGYGETRPVADNATEDGRAVNRRVEAQVEAQAK 345


>gi|260892160|ref|YP_003238257.1| OmpA/MotB domain protein [Ammonifex degensii KC4]
 gi|260864301|gb|ACX51407.1| OmpA/MotB domain protein [Ammonifex degensii KC4]
          Length = 268

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 33/183 (18%), Positives = 64/183 (34%), Gaps = 9/183 (4%)

Query: 13  TTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMI 72
             +SG      E  +      +     N +      + E   + +     I        +
Sbjct: 70  AVVSG--APKFEPGEDAKFALSGGGEENLQLEKIKAEIEKYAREKGLQAKITARIEERGL 127

Query: 73  TCYIPVHVSFV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTD----SIGTLKNNL 127
              +   V F      L  +   +++ +  IL K P+  + I+ HT           +N 
Sbjct: 128 VVSVLDTVLFPIGSAELTPQAKEVVREVGKILLKMPNC-VRIEGHTCDLPIHTPRYPSNW 186

Query: 128 LISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGN 187
            +S  RA  +   LI       + +   G+A   P+  ND++  RQ N+R++  +  R  
Sbjct: 187 ELSVARATSVVQELIHTVNFPPQRLCACGYAEYRPLVPNDSEEHRQMNRRVDFVVL-RST 245

Query: 188 IKK 190
            +K
Sbjct: 246 YQK 248


>gi|307822441|ref|ZP_07652673.1| OmpA/MotB domain protein [Methylobacter tundripaludum SV96]
 gi|307737007|gb|EFO07852.1| OmpA/MotB domain protein [Methylobacter tundripaludum SV96]
          Length = 363

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 35/122 (28%), Positives = 54/122 (44%), Gaps = 3/122 (2%)

Query: 61  TGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTV-IAIQSHTDS 119
            G  +   G  I   +       +   L      +L  +A  L  +P    I +Q HT S
Sbjct: 240 KGSKIDNNGCPIKLVLTGQHFKYNSAELTLNAKEILDGVAGNLVSYPQKNDIEVQGHTSS 299

Query: 120 IGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIE 179
            GT K NL +SQ RA  +  YL  +GV     ++ +G+    PI  N T+ G+  N+R+E
Sbjct: 300 EGTNKYNLKLSQRRAQSVVDYLKLKGV--TNRLTAKGYGETQPIADNSTEAGKAENRRVE 357

Query: 180 IQ 181
           + 
Sbjct: 358 LI 359


>gi|162449773|ref|YP_001612140.1| outer membrane protein [Sorangium cellulosum 'So ce 56']
 gi|161160355|emb|CAN91660.1| outer membrane protein [Sorangium cellulosum 'So ce 56']
          Length = 601

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 40/173 (23%), Positives = 66/173 (38%), Gaps = 6/173 (3%)

Query: 16  SGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCY 75
           +G   ASR             +  +         +ED            V   G  I   
Sbjct: 422 AGSQPASRHGCPADTDGDGIPNAADACPYERGKPSEDR---ATHGCPFAVRIEGSQIVI- 477

Query: 76  IPVHVSFVSEVFLEKKFLPMLQLIATILNKFPST-VIAIQSHTDSIGTLKNNLLISQERA 134
           +           +E +   +L  +A +L + P    +A+  HTD+ G  + NL +SQ RA
Sbjct: 478 LQQVQFRTGRAEIEPESFELLSEVAAVLEEHPEIARVAVDGHTDNQGAAQANLSLSQRRA 537

Query: 135 DVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGN 187
             + +  +       R +  RGF  + P+  N T+ GR  N+R+E QI  R +
Sbjct: 538 LAVVA-WLTAHGIDARRLEARGFGARRPLADNRTRDGRAKNRRVEFQIRKRTD 589


>gi|325286152|ref|YP_004261942.1| OmpA/MotB domain-containing protein [Cellulophaga lytica DSM 7489]
 gi|324321606|gb|ADY29071.1| OmpA/MotB domain protein [Cellulophaga lytica DSM 7489]
          Length = 452

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 37/167 (22%), Positives = 74/167 (44%), Gaps = 15/167 (8%)

Query: 17  GCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYI 76
           GC    ++K  V        ++      +   +  +E Q +L D    +           
Sbjct: 300 GCPWEDKDKDGVLDKDDKCPEVAGTVANNGCPEVTEEVQKKLNDYARTI----------- 348

Query: 77  PVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADV 136
              +    +  ++ +   ++  I TIL ++P+    ++ HTDS+G+   N  +S+ RA  
Sbjct: 349 ---LFDTGKSSIKAESTAVMVDIITILKEYPNAKFTVEGHTDSVGSATLNQKLSESRALS 405

Query: 137 IKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
           +K +L+++       +S  G+    PI TN T+ GR+ N+R+EI + 
Sbjct: 406 VKEFLVEK-GIGEFRLSAVGYGEDKPIATNKTRAGRKQNRRVEINLV 451


>gi|120556561|ref|YP_960912.1| OmpA/MotB domain-containing protein [Marinobacter aquaeolei VT8]
 gi|120326410|gb|ABM20725.1| OmpA/MotB domain protein [Marinobacter aquaeolei VT8]
          Length = 401

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 35/150 (23%), Positives = 59/150 (39%), Gaps = 5/150 (3%)

Query: 33  SNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKF 92
            +D D V        D        +    GI  +     +    P      +   ++  +
Sbjct: 253 DSDNDGVVNSQDQCPDTTAGATVDETGCEGITETVETIELRVQFPT-----NSSVIDNAY 307

Query: 93  LPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFI 152
              ++ +A  + ++P T + I  HTDS G    N  +SQ RA+ +   L          +
Sbjct: 308 DNEIRRVADFMEEYPETTVEIAGHTDSAGEAGYNQFLSQRRAEAVAGRLTGPLGVDPDRV 367

Query: 153 SVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           S  G+    P+ TNDT  GR  N+R+E +I
Sbjct: 368 SAVGYGEAEPVATNDTPAGRAQNRRVEARI 397


>gi|297537693|ref|YP_003673462.1| OmpA/MotB domain-containing protein [Methylotenera sp. 301]
 gi|297257040|gb|ADI28885.1| OmpA/MotB domain protein [Methylotenera sp. 301]
          Length = 224

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 44/207 (21%), Positives = 83/207 (40%), Gaps = 30/207 (14%)

Query: 3   KELGLSMFIMTTISGCGLASREKKKVF---------------------------LHKSND 35
           K +  S+ +  T+ GC   +  +K                                 +  
Sbjct: 4   KIIVSSILVAFTLGGCANMTETQKGTAKGAGIGAGVGAVVGAIAGNTRGAVIGAAVGAAA 63

Query: 36  TDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRI-GDMITCYIPVHVSFV-SEVFLEKKFL 93
             +    +    ++ + + +     TG+ V++   + +   IP  +SF      ++  F 
Sbjct: 64  GGVAGNVWTKRQEEQKRQMEEATAGTGVAVTQTADNRLKLDIPSDISFAVGRADVQPNFR 123

Query: 94  PMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFIS 153
            +L   A  L   P++ + I  HTDS G+   N  +S  RA  ++ YL  + V+SNR I+
Sbjct: 124 AILDTFANGLVTNPNSNVTIIGHTDSTGSDAVNNPLSLNRAASVRDYLTSKRVASNR-IT 182

Query: 154 VRGFAYKYPIDTNDTKVGRQNNQRIEI 180
           + G   + P+  NDT   +  N+R+EI
Sbjct: 183 IDGRGSREPLVANDTAANKAKNRRVEI 209


>gi|92113921|ref|YP_573849.1| OmpA/MotB [Chromohalobacter salexigens DSM 3043]
 gi|91797011|gb|ABE59150.1| OmpA/MotB [Chromohalobacter salexigens DSM 3043]
          Length = 294

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 36/144 (25%), Positives = 62/144 (43%), Gaps = 7/144 (4%)

Query: 37  DIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPML 96
           D          D+  D         G  V+ +G      +           L  +   +L
Sbjct: 154 DSDGDGVPDYQDQCPD------TPAGAEVNALGCAADLVLKDVNFEFDSATLTSEAENIL 207

Query: 97  QLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRG 156
             +A  L+   S  + ++ +TDS+G+   N  +SQ RAD +K YL+ +   +   I+  G
Sbjct: 208 DDVAAKLSSNESVDVRLEGYTDSVGSASYNKDLSQRRADSVKEYLVSK-GVNADSITTYG 266

Query: 157 FAYKYPIDTNDTKVGRQNNQRIEI 180
           +  + PI TN+T  GR  N+R+E+
Sbjct: 267 YGEQNPIATNETAEGRAENRRVEL 290


>gi|226944423|ref|YP_002799496.1| major outer membrane porin OprF [Azotobacter vinelandii DJ]
 gi|226719350|gb|ACO78521.1| major outer membrane porin OprF [Azotobacter vinelandii DJ]
          Length = 351

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 30/164 (18%), Positives = 72/164 (43%), Gaps = 2/164 (1%)

Query: 19  GLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPV 78
           G   +++           D+ N     ++D+  D       +     + + +++   + V
Sbjct: 185 GSGGKQQPVAEPVAEVCADVDNDGVCDNVDRCPDTPANTTVNAE-GCTAVAEVVRVELDV 243

Query: 79  HVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIK 138
              F  +  ++++    ++ +A  + ++P T   ++ HTDS+GT   N  +S+ RA+ ++
Sbjct: 244 KFDF-DKAQVKEESYADIKNLADFMKQYPQTNTTVEGHTDSVGTDAYNQKLSERRANAVR 302

Query: 139 SYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
             L+         +   G+    P+  N T+ GR  N+R+E ++
Sbjct: 303 DVLVNEYGVQGSRVDSVGYGESRPVADNATESGRAINRRVEAEV 346


>gi|288550313|ref|ZP_05969946.2| membrane protein OmpA-family [Enterobacter cancerogenus ATCC 35316]
 gi|288315417|gb|EFC54355.1| membrane protein OmpA-family [Enterobacter cancerogenus ATCC 35316]
          Length = 563

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 30/109 (27%), Positives = 53/109 (48%)

Query: 79  HVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIK 138
            +       L+     +L      +   P  +I +  HTDS G  K+N ++S +RA+ ++
Sbjct: 431 SLFDTGRWALKPGSTKLLVNSLVGIKAKPGWLIVVAGHTDSTGDDKSNQVLSLKRAESVR 490

Query: 139 SYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGN 187
            ++   G       +V+G+    P+ TNDT  GR  N+R+EI + P+ N
Sbjct: 491 DWMRDTGDVPESCFAVQGYGESRPVATNDTPEGRALNRRVEISLVPQAN 539


>gi|258593360|emb|CBE69699.1| OmpA/MotB precursor [NC10 bacterium 'Dutch sediment']
          Length = 249

 Score =  102 bits (254), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 42/166 (25%), Positives = 69/166 (41%), Gaps = 11/166 (6%)

Query: 18  CGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIG--DMITCY 75
           C       K          D          D+           +G+ V+R+G  +     
Sbjct: 90  CPNTPAGVKVDAT--GCPPDSDGDGVPDYKDQCPG------TPSGVKVNRLGCPERKAII 141

Query: 76  IPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERAD 135
           +       +   L  + L +L  +A IL+K P   + I  HTDS+GT   N  +SQ RA+
Sbjct: 142 LKGVNFAFNSAELTTESLTILDGVAEILSKHPDLKVTIAGHTDSVGTADYNKKLSQRRAE 201

Query: 136 VIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQ 181
            +++YL      +   ++  GF  + PI +ND   GR  N+R+E+Q
Sbjct: 202 SVRNYLAS-HGVNAAKLTAVGFGEEQPIASNDEAEGRTKNRRVELQ 246


>gi|254509011|ref|ZP_05121116.1| flagellar motor protein [Vibrio parahaemolyticus 16]
 gi|219548046|gb|EED25066.1| flagellar motor protein [Vibrio parahaemolyticus 16]
          Length = 298

 Score =  102 bits (254), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 35/175 (20%), Positives = 77/175 (44%), Gaps = 6/175 (3%)

Query: 20  LASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVH 79
                +      +   +  +++   + ++  +   + +++   I V  +G  I   I   
Sbjct: 116 STQNNQNSESDSQQQQSAEMSQELETLMESIKKALEREIEQGAIEVENLGQQIDIRIREK 175

Query: 80  VSFV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGT----LKNNLLISQERA 134
            +F     FL+ KF P+++ IA ++   P   + +  HTD+        ++N  +S +RA
Sbjct: 176 GAFPEGSAFLQPKFRPLVRQIADLVKDIPGI-VRVSGHTDNQRIESELYRSNWDLSAQRA 234

Query: 135 DVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGNIK 189
             +   + +    +++ + VRG A   P+  NDT+  R  N+R+EI I     ++
Sbjct: 235 VSVAQEMEKVRGFTSQRLRVRGMADTEPLGPNDTEAQRSRNRRVEISIMQGEALQ 289


>gi|224372468|ref|YP_002606840.1| thrombospondin type 3 repeat:OmpA/MotB [Nautilia profundicola AmH]
 gi|223589113|gb|ACM92849.1| thrombospondin type 3 repeat:OmpA/MotB [Nautilia profundicola AmH]
          Length = 373

 Score =  102 bits (254), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 36/146 (24%), Positives = 66/146 (45%), Gaps = 8/146 (5%)

Query: 37  DIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPML 96
           D       + LDK  +  +      G+VV   G  +T              ++ +F+  +
Sbjct: 234 DDDQDGVPNYLDKCSNTPK------GVVVDEHGCAMTYDF-GITFDNDSADIKPQFMKKI 286

Query: 97  QLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRG 156
           +  A  L + P+    IQ +TDS G+ + N  +S+ RA  +   LI++   S   +S +G
Sbjct: 287 EEFAEFLKQNPAYKAEIQGYTDSKGSAEYNQKLSERRAKAVYEVLIKQ-GISKDRLSYKG 345

Query: 157 FAYKYPIDTNDTKVGRQNNQRIEIQI 182
           +    P+ +NDT  G+  N+R+  +I
Sbjct: 346 YGEANPVASNDTPDGKAQNRRVVAKI 371


>gi|167893289|ref|ZP_02480691.1| ompA family protein [Burkholderia pseudomallei 7894]
          Length = 171

 Score =  102 bits (254), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 37/135 (27%), Positives = 66/135 (48%), Gaps = 3/135 (2%)

Query: 50  AEDEFQMQLQDTGIVVSRIGDM-ITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKFP 107
            +++     Q TG  V+   D  +   +P  V+F   +  +   F P+L  +AT LN+ P
Sbjct: 31  IKNKLAPSAQQTGTQVTEQPDGSLKLNVPSSVTFATDQYAITPAFTPLLNDLATTLNQNP 90

Query: 108 STVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTND 167
               ++  +TDS G+  +N  +SQ RA  + +  + +   +   +S +G     PI  N 
Sbjct: 91  QITASVVGYTDSTGSAAHNQTLSQNRAQSVVN-ALAQRGVAANRLSAQGMGASNPIADNA 149

Query: 168 TKVGRQNNQRIEIQI 182
           T+ GR  N+R+EI +
Sbjct: 150 TEAGRAQNRRVEIYL 164


>gi|167844755|ref|ZP_02470263.1| ompA family protein [Burkholderia pseudomallei B7210]
          Length = 163

 Score =  102 bits (254), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 37/135 (27%), Positives = 66/135 (48%), Gaps = 3/135 (2%)

Query: 50  AEDEFQMQLQDTGIVVSRIGDM-ITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKFP 107
            +++     Q TG  V+   D  +   +P  V+F   +  +   F P+L  +AT LN+ P
Sbjct: 23  IKNKLAPSAQQTGTQVTEQPDGSLKLNVPSSVTFATDQYAITPAFTPLLNDLATTLNQNP 82

Query: 108 STVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTND 167
               ++  +TDS G+  +N  +SQ RA  + +  + +   +   +S +G     PI  N 
Sbjct: 83  QITASVVGYTDSTGSAAHNQTLSQNRAQSVVN-ALAQRGVAANRLSAQGMGASNPIADNA 141

Query: 168 TKVGRQNNQRIEIQI 182
           T+ GR  N+R+EI +
Sbjct: 142 TEAGRAQNRRVEIYL 156


>gi|83648502|ref|YP_436937.1| flagellar motor protein MotB [Hahella chejuensis KCTC 2396]
 gi|83636545|gb|ABC32512.1| Flagellar motor protein [Hahella chejuensis KCTC 2396]
          Length = 326

 Score =  102 bits (254), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 31/147 (21%), Positives = 61/147 (41%), Gaps = 6/147 (4%)

Query: 41  KRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV-SEVFLEKKFLPMLQLI 99
           +   +         + ++++  + V   G  I   +    SF      L  +F P++  +
Sbjct: 141 EETENDAITLASALESEVRNNQVEVETRGRKIVIRVQEKGSFSSGSADLNPEFYPVIDKL 200

Query: 100 ATILNKFPSTVIAIQSHTDSIGTL----KNNLLISQERADVIKSYLIQRGVSSNRFISVR 155
             +L       I+++ H+DSI       ++N  +S  RA  +   L + G       S+ 
Sbjct: 201 VELLKSMEG-SISVEGHSDSIPIRTARFRSNWDLSAARALEVAHALFESGELEPSRFSIA 259

Query: 156 GFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           G+A   P+  ND+   R  N+R+EI +
Sbjct: 260 GYADTKPLAPNDSAENRARNRRVEIIL 286


>gi|206577657|ref|YP_002237882.1| OmpA domain protein [Klebsiella pneumoniae 342]
 gi|206566715|gb|ACI08491.1| OmpA domain protein [Klebsiella pneumoniae 342]
          Length = 565

 Score =  102 bits (254), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 28/108 (25%), Positives = 54/108 (50%)

Query: 80  VSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKS 139
           +    +  L+     +L      +   P  +I +  HTDSIG  K+N  +S +RA+ ++ 
Sbjct: 435 LFDTGKSTLKPGSTKLLVNSLLGIKAKPGWLIVVAGHTDSIGNDKSNQQLSLKRAEAVRD 494

Query: 140 YLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGN 187
           ++   G       +V+G+    P+ +N+T  GR  N+R+EI + P+ +
Sbjct: 495 WMRDTGDVPESCFAVQGYGASRPVASNETPEGRAKNRRVEISLVPQKD 542


>gi|289661910|ref|ZP_06483491.1| PAL family outer membrane lipoprotein [Xanthomonas campestris pv.
           vasculorum NCPPB702]
 gi|289667001|ref|ZP_06488076.1| PAL family outer membrane lipoprotein [Xanthomonas campestris pv.
           musacearum NCPPB4381]
          Length = 172

 Score =  102 bits (254), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 34/188 (18%), Positives = 72/188 (38%), Gaps = 19/188 (10%)

Query: 1   MIKE---LGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQ 57
           M K    L +S+  +  ++GC    +E        +  + +      S L          
Sbjct: 1   MNKSTRVLLVSLLSVAVLAGCSKKVKETPPPATDTTAGSSVPTGPSTSGL---------- 50

Query: 58  LQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHT 117
                     +         V    + +  L+ +F  ++   A  L   PS+ I +Q +T
Sbjct: 51  -----YGPGDLDTDACLRQRVVYFDLDQDSLKPEFQAIMACHAKYLRDRPSSRITLQGNT 105

Query: 118 DSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQR 177
           D  G+ + N+ + + R + + S L   G S+++ ++V  +  + P+ T   +     N+R
Sbjct: 106 DERGSREYNMGLGERRGNAVSSSLQAAGGSASQ-LTVVSYGEERPVCTESGESCWSQNRR 164

Query: 178 IEIQIFPR 185
           +EI    +
Sbjct: 165 VEIVYTAQ 172


>gi|152970821|ref|YP_001335930.1| hypothetical protein KPN_02274 [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|150955670|gb|ABR77700.1| putative exported protein [Klebsiella pneumoniae subsp. pneumoniae
           MGH 78578]
          Length = 565

 Score =  102 bits (254), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 27/108 (25%), Positives = 54/108 (50%)

Query: 80  VSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKS 139
           +    +  L+     +L      +   P  +I +  HTDSIG  ++N  +S +RA+ ++ 
Sbjct: 435 LFDTGKSTLKPGSTKLLVNSLLGIKAKPGWLIVVAGHTDSIGNDRSNQQLSLKRAEAVRD 494

Query: 140 YLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGN 187
           ++   G       +V+G+    P+ +N+T  GR  N+R+EI + P+ +
Sbjct: 495 WMRDTGDVPESCFAVQGYGASRPVASNETPEGRAQNRRVEISLVPQKD 542


>gi|315644424|ref|ZP_07897557.1| OmpA/MotB domain protein [Paenibacillus vortex V453]
 gi|315280174|gb|EFU43467.1| OmpA/MotB domain protein [Paenibacillus vortex V453]
          Length = 273

 Score =  102 bits (254), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 31/174 (17%), Positives = 67/174 (38%), Gaps = 9/174 (5%)

Query: 21  ASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGD----MITCYI 76
            +                + ++    L+K + +    +++ G+            +   I
Sbjct: 83  KASSPNVPATTPDQRRAELMRQEQEDLEKLKKQLDNYIKNNGLTSELSTKLNHSQLVITI 142

Query: 77  PVHVSFV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIG----TLKNNLLISQ 131
             +  F   E  ++ +   + + I+ +L+KFP   I +  HTD++        +N  +S 
Sbjct: 143 RDNALFPSGEAVVKPEARKLAKAISQMLHKFPDYEIIVSGHTDNVPIANSRYPSNWDLSS 202

Query: 132 ERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPR 185
           +RA      L+       +     G+   +PI  N T+ GR  N+R+E+ I  +
Sbjct: 203 DRALQFMKILLTNSALDPKRFMPIGYGEYHPIADNKTEAGRAKNRRVEVSIIRK 256


>gi|94500546|ref|ZP_01307077.1| flagellar motor protein [Oceanobacter sp. RED65]
 gi|94427336|gb|EAT12315.1| flagellar motor protein [Oceanobacter sp. RED65]
          Length = 331

 Score =  102 bits (254), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 41/179 (22%), Positives = 73/179 (40%), Gaps = 11/179 (6%)

Query: 19  GLASREKKKVFLHKSNDTDIVNKRFGSSLD-KAEDEFQMQLQDTGIVVSRIGDMITCYIP 77
           G   ++ +++ + K +++             +   E + ++    + +   G  I   I 
Sbjct: 122 GNTGKQTREITVPKESESQKKQAEQAEETAFELATELEREISKGQVELETQGSKIVIRIR 181

Query: 78  VHVSFV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSI-----GTLKNNLLISQ 131
              SF     ++E +FLP+L  I  +L + P   I+++ HTDS      G   +N  +S 
Sbjct: 182 EKGSFNAGGAYVEDEFLPVLDTIREVLVEVPG-RISVEGHTDSTPLGRGGRYNSNWELSA 240

Query: 132 ERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIF---PRGN 187
            RA  +  YL            V G     P+  N T  GR  N+R+EI +    P+ N
Sbjct: 241 ARAAAVAEYLFIAPEMPESRFRVVGHGSVRPVAENKTAEGRAKNRRVEIIVLRSKPQDN 299


>gi|84394351|ref|ZP_00993072.1| flagellar motor protein [Vibrio splendidus 12B01]
 gi|84375010|gb|EAP91936.1| flagellar motor protein [Vibrio splendidus 12B01]
          Length = 315

 Score =  102 bits (254), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 36/142 (25%), Positives = 68/142 (47%), Gaps = 6/142 (4%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV-SEVFLEKKFLPMLQLIATILNK 105
           ++  +   + ++    I V  +G  I   I    +F     FL+ KF P+++ +A ++  
Sbjct: 160 MESIKKALEREIDQGAIEVENLGQQIVIRIREKGAFPSGSAFLQPKFRPLVRQVAELVKD 219

Query: 106 FPSTVIAIQSHTDSI----GTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKY 161
            P   + I  HTD+        ++N  +S +RA  +   + +    S++ + VRG A   
Sbjct: 220 VPGI-VRISGHTDNQRLDSELYRSNWDLSSQRAVSVAQEMEKVRGFSHQRLRVRGMADTE 278

Query: 162 PIDTNDTKVGRQNNQRIEIQIF 183
           P++ NDT+  R  N+R+EI I 
Sbjct: 279 PVEPNDTEWQRSLNRRVEISIM 300


>gi|261403961|ref|YP_003240202.1| OmpA/MotB domain-containing protein [Paenibacillus sp. Y412MC10]
 gi|329930219|ref|ZP_08283832.1| chemotaxis protein MotB [Paenibacillus sp. HGF5]
 gi|261280424|gb|ACX62395.1| OmpA/MotB domain protein [Paenibacillus sp. Y412MC10]
 gi|328935241|gb|EGG31722.1| chemotaxis protein MotB [Paenibacillus sp. HGF5]
          Length = 268

 Score =  102 bits (254), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 32/174 (18%), Positives = 68/174 (39%), Gaps = 9/174 (5%)

Query: 21  ASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGD----MITCYI 76
            +                + ++    L+K + +    +++ G+            +   I
Sbjct: 83  KATTPSVPATTPDQRRAELMRQEQEDLEKLKKQLDNYIKNNGLTSELSTKLNHSQLVITI 142

Query: 77  PVHVSFV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGT----LKNNLLISQ 131
             +  F   E  ++ +   + + I+ +L+KFP   I +  HTD++        +N  +S 
Sbjct: 143 RDNALFPSGEAVVKPEARKLAKAISQMLHKFPDYEIIVSGHTDNVPISNSKYPSNWDLSS 202

Query: 132 ERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPR 185
           +RA      L+       +     G+   +PI  N+T VGR  N+R+E+ I  +
Sbjct: 203 DRALQFMKILLTNSELDPKRFMPIGYGEYHPIADNNTAVGRAKNRRVEVSIIRK 256


>gi|166712982|ref|ZP_02244189.1| outer membrane protein P6 precursor [Xanthomonas oryzae pv.
           oryzicola BLS256]
          Length = 172

 Score =  102 bits (254), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 31/181 (17%), Positives = 70/181 (38%), Gaps = 16/181 (8%)

Query: 5   LGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIV 64
           L +S+  +  ++GC    +E      + +  + +      S L                 
Sbjct: 8   LLVSLLSVAVLAGCSKKVKETPPPATNTTAVSSVPTGPSTSGL---------------YG 52

Query: 65  VSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLK 124
              +         V    + +  L+ +F  ++   A  L   PS+ I +Q + D  G+ +
Sbjct: 53  PGDLDTDACLRQRVVYFDLDQDSLKPEFQAIMACHAKYLRDRPSSRITLQGNADERGSRE 112

Query: 125 NNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
            N+ + + R + + S L   G S+++ ++V  +  + P+ T   +     N+R+EI    
Sbjct: 113 YNMGLGERRGNAVSSSLQAAGGSASQ-LTVVSYGEERPVCTESNESCWSQNRRVEIVYTA 171

Query: 185 R 185
           +
Sbjct: 172 Q 172


>gi|117918835|ref|YP_868027.1| OmpA/MotB domain-containing protein [Shewanella sp. ANA-3]
 gi|117611167|gb|ABK46621.1| OmpA/MotB domain protein [Shewanella sp. ANA-3]
          Length = 202

 Score =  102 bits (254), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 32/183 (17%), Positives = 74/183 (40%), Gaps = 5/183 (2%)

Query: 4   ELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGI 63
           +  +    +  ++GC +  R+   +    +     ++ + G  + +A +      +  G 
Sbjct: 2   KTVILFMSVALLAGCSM--RDTVNIEEMTTTQAYDLSDKDGDGVIEARERCNDTAKGAGT 59

Query: 64  VVSRIGDMITCYIP---VHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSI 120
                G +           +      ++  ++ P ++ IA  L ++P+T + I+ HT   
Sbjct: 60  DNYGCGQIKAINERKEINVLFPNDSAYIAPEYYPQIEEIAMFLRQYPTTKVTIEGHTSRT 119

Query: 121 GTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEI 180
           GT + N ++SQERAD + + L  R       ++  G+    P+    T      N+R+  
Sbjct: 120 GTDERNAVLSQERADAVTAVLADRFSIDRSRLTAIGYGSSRPLVLEHTPDAETRNRRVVA 179

Query: 181 QIF 183
           ++ 
Sbjct: 180 EVT 182


>gi|299140724|ref|ZP_07033862.1| lipoprotein PG3 [Prevotella oris C735]
 gi|298577690|gb|EFI49558.1| lipoprotein PG3 [Prevotella oris C735]
          Length = 225

 Score =  102 bits (254), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 39/210 (18%), Positives = 79/210 (37%), Gaps = 31/210 (14%)

Query: 2   IKELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFG----------------- 44
           +K L ++   +  +S C  +++ +    L  +    ++    G                 
Sbjct: 1   MKNLKMATVGLCVLSVCSCSTK-QGTGTLIGAGGGSVLGAIVGKIAGNTAVGAAIGGAVG 59

Query: 45  --------SSLDKAEDEFQMQLQDTGIVVSRIGDMIT---CYIPVHVSFVSE-VFLEKKF 92
                     +DK   +   Q+++  +      + +          + F +    L    
Sbjct: 60  AGAGALIGRHMDKVAAQ-AAQIRNAKVEEVTDANGLKAVKVTFDSGILFATNQATLTSSS 118

Query: 93  LPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFI 152
              L   + +L       + I  HTD+ G    N+ +S  RA+ + +YL Q GVS ++F 
Sbjct: 119 KNDLAKFSKVLKDNSDCHVDIYGHTDTTGNDGINIPLSNRRAESVVNYLKQCGVSGSQFQ 178

Query: 153 SVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           +V G     P+  N T  GR+ N+R+E+ +
Sbjct: 179 NVVGKGSAEPVADNSTAAGRKQNRRVEVYL 208


>gi|146281895|ref|YP_001172048.1| outer membrane protein [Pseudomonas stutzeri A1501]
 gi|145570100|gb|ABP79206.1| outer membrane protein [Pseudomonas stutzeri A1501]
          Length = 212

 Score =  102 bits (254), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 33/203 (16%), Positives = 68/203 (33%), Gaps = 26/203 (12%)

Query: 8   SMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFG----------------------- 44
            + + T ++GC    ++           T                               
Sbjct: 10  VIVMTTFLAGCAGVQKQDWPTCAAVGGVTGAALGAIESSTYAGWGALIGGGVAAAYCWAN 69

Query: 45  --SSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATI 102
                  A  E    +  T          +   + V   F     +++     +Q +A  
Sbjct: 70  GMEEETVAVVETVEPMPQTQPEPEPAAAPVRVELDVKFDF-DRDVVKQDSYSDIQNLADF 128

Query: 103 LNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYP 162
           + ++  T   ++ HTDS+GT   N  +S+ RA+ ++  L+         ++  G+    P
Sbjct: 129 MKEYRQTTTVLEGHTDSVGTDAYNQRLSERRANAVRRVLVDELGVEGNRVNAVGYGESRP 188

Query: 163 IDTNDTKVGRQNNQRIEIQIFPR 185
           +  N T+ GR  N+R+E ++  R
Sbjct: 189 VADNSTEEGRAINRRVEAEVEAR 211


>gi|124003367|ref|ZP_01688217.1| outer membrane protein [Microscilla marina ATCC 23134]
 gi|123991465|gb|EAY30896.1| outer membrane protein [Microscilla marina ATCC 23134]
          Length = 116

 Score =  102 bits (254), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 34/111 (30%), Positives = 55/111 (49%), Gaps = 1/111 (0%)

Query: 73  TCYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQE 132
              +       ++  L+ K    L  +   L + P     I  HTD+IG    N  +SQ+
Sbjct: 2   VFTLNNVFFEYNKYALKDKSKVELDNLVKFLKENPEISGEISGHTDNIGDKARNRELSQQ 61

Query: 133 RADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
           RA+ ++ YL+  GV ++R +  +G+    P  TNDT+ GR  N+RIE +I 
Sbjct: 62  RANSVRDYLVSHGVDASRLVY-KGYGDSKPAATNDTEEGRAKNRRIEFKIL 111


>gi|95928801|ref|ZP_01311547.1| OmpA/MotB [Desulfuromonas acetoxidans DSM 684]
 gi|95135146|gb|EAT16799.1| OmpA/MotB [Desulfuromonas acetoxidans DSM 684]
          Length = 415

 Score =  102 bits (254), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 37/125 (29%), Positives = 60/125 (48%), Gaps = 1/125 (0%)

Query: 61  TGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSI 120
            G  V   G  +   + +     ++  +  + +  +   A  +NK+P   I I  HTDS 
Sbjct: 292 AGAHVDEYGCQLVLTLLIE-FDTNKADIRPQHIQDMTNAAAFINKYPGEKILISGHTDSD 350

Query: 121 GTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEI 180
           G+   N  +SQ RAD +K+YLIQ        ++ +GF    PI  N T  G+Q N+R+E+
Sbjct: 351 GSEAYNQQLSQRRADAVKAYLIQNYAIDGTNLTAKGFGESQPIADNTTAAGKQKNRRVEL 410

Query: 181 QIFPR 185
            +F  
Sbjct: 411 SLFNN 415


>gi|50085693|ref|YP_047203.1| peptidoglycan-associated lipoprotein precursor [Acinetobacter sp.
           ADP1]
 gi|49531669|emb|CAG69381.1| peptidoglycan-associated lipoprotein precursor [Acinetobacter sp.
           ADP1]
          Length = 193

 Score =  102 bits (254), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 33/180 (18%), Positives = 62/180 (34%), Gaps = 5/180 (2%)

Query: 2   IKELGLSMFI-MTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQD 60
           +K   L +      ++GC      K    +  +N            L +        L  
Sbjct: 8   MKLFVLPVLATALVMTGCAS---RKPAAPVSAANTPSTATTVSTEGLSEDAALNAKNLTG 64

Query: 61  TGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSI 120
                    +       V         L  +    LQ  A  L    ++ +A+  HTD  
Sbjct: 65  ASAKGVTAANRAFLAKRVVHFDYDSSDLSTEDYQTLQAHAQFLIANANSRVALTGHTDER 124

Query: 121 GTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEI 180
           GT + N+ + + RA  ++SYLI     + + +    +  + PI+    +   + N+R+EI
Sbjct: 125 GTREYNMALGERRAKAVQSYLITN-GVNPQQLEAVSYGKEMPINPGHNEAAWKENRRVEI 183


>gi|56477938|ref|YP_159527.1| outer membrane lipoprotein [Aromatoleum aromaticum EbN1]
 gi|56313981|emb|CAI08626.1| outer membrane lipoprotein containing OmpA/MotB domain [Aromatoleum
           aromaticum EbN1]
          Length = 189

 Score =  102 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 42/184 (22%), Positives = 74/184 (40%), Gaps = 4/184 (2%)

Query: 4   ELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGI 63
            L + + + T +S C   +           + T  V K          +    +L  +  
Sbjct: 5   SLFVLVGVSTLLSACATTTVTSPPGTATPIHRTVPVAKNTAFDWPAERNRIVKRLSGSSE 64

Query: 64  VVSRIGDMITCYI---PVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSI 120
           + +R+ D  T  +               +    P L  +A+ L   P   I +  HTDS+
Sbjct: 65  IATRVLDNGTLQLLLPGAEAFSRGGTEPQPVLTPNLDRVASALASSPEVEIRVFGHTDSL 124

Query: 121 GTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEI 180
            +  +NL +S +RA+ +  +L +RG+   R +   G     PI  N T+ GR  N+R+EI
Sbjct: 125 DSELHNLQLSIQRAETVAEHLRRRGIPLVR-LHADGKGEAEPIADNATEAGRAKNRRVEI 183

Query: 181 QIFP 184
            + P
Sbjct: 184 VLRP 187


>gi|317502696|ref|ZP_07960808.1| immunogenic lipoprotein PG3 [Prevotella salivae DSM 15606]
 gi|315666182|gb|EFV05737.1| immunogenic lipoprotein PG3 [Prevotella salivae DSM 15606]
          Length = 225

 Score =  102 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 40/210 (19%), Positives = 79/210 (37%), Gaps = 31/210 (14%)

Query: 2   IKELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFG----------------- 44
           +K L ++   +  +S C  A++ +    L  +    ++    G                 
Sbjct: 1   MKNLKMATMGLCVLSVCSCATK-QGTGTLIGAGGGSVLGAIVGKIAGNTAVGAAIGGAVG 59

Query: 45  --------SSLDKAEDEFQMQLQDTGIVVSRIGDMIT---CYIPVHVSFVSE-VFLEKKF 92
                     +DK   +   Q+++  +      + +          + F +    L    
Sbjct: 60  AGAGALIGRHMDKVAAQ-AAQIRNAKVEEVTDANGLKAVKVTFDSGILFATNQATLTASS 118

Query: 93  LPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFI 152
              L   + +L       + I  HTD+ G    N+ +S  RA+ + +YL   GVSS++F 
Sbjct: 119 KNDLVKFSKVLKDNSDCHVDIYGHTDNTGNDAINIPLSNRRAESVVNYLKSCGVSSSQFQ 178

Query: 153 SVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           +V G     P+  N T  GR+ N+R+E+ +
Sbjct: 179 NVVGKGSSEPVADNSTAAGRKQNRRVEVYL 208


>gi|157370029|ref|YP_001478018.1| OmpA/MotB domain-containing protein [Serratia proteamaculans 568]
 gi|157321793|gb|ABV40890.1| OmpA/MotB domain protein [Serratia proteamaculans 568]
          Length = 569

 Score =  102 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 30/117 (25%), Positives = 53/117 (45%)

Query: 71  MITCYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLIS 130
            I     + +    +  L+     ML      +   P  +I +  HTD+ G    N  +S
Sbjct: 429 KIVRLDSMSLFDSGKYALKAGSTKMLINSLVGIKAKPGWLIVVAGHTDNTGNPALNQTLS 488

Query: 131 QERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGN 187
           Q+RA  ++ ++   G       +V+G+    P+ TNDT  GR  N+R+EI + P+ +
Sbjct: 489 QKRAAAVRDWMRDTGDVPESCFAVQGYGESRPVATNDTPEGRALNRRVEISLVPQAD 545


>gi|327480660|gb|AEA83970.1| outer membrane protein OprF precursor [Pseudomonas stutzeri DSM
           4166]
          Length = 299

 Score =  102 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 26/119 (21%), Positives = 60/119 (50%), Gaps = 1/119 (0%)

Query: 64  VVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTL 123
                 +++   + V   F  +  + ++    ++ +A  + ++P T   ++ HTDS+GT 
Sbjct: 177 EPEPAPEVVRVELDVKFDF-DKSRVREESYSDIKNLADFMQQYPQTTTVVEGHTDSVGTD 235

Query: 124 KNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           + N  +S+ RA+ +++ L+         ++  G+    P+  N T+ GRQ N+R+E ++
Sbjct: 236 QYNQRLSERRAEAVRNVLVNEYGVQGNRVNSVGYGESRPVADNSTEEGRQINRRVEAEV 294


>gi|221635437|ref|YP_002523313.1| chemotaxis protein MotB (Motility protein B) [Thermomicrobium
           roseum DSM 5159]
 gi|221157647|gb|ACM06765.1| chemotaxis protein MotB (Motility protein B) [Thermomicrobium
           roseum DSM 5159]
          Length = 237

 Score =  102 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 34/131 (25%), Positives = 57/131 (43%), Gaps = 6/131 (4%)

Query: 58  LQDTGIVVSRIGDMITCYIPVHVSFV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSH 116
           L   G  V    + I  ++   + F   +  L  +   +L  IA I+   P+  I ++ H
Sbjct: 101 LDRQGAEVELTSEGIVIHLSDAILFPPGQAELRPEAQRVLDGIAAIIEPLPN-PIRVEGH 159

Query: 117 TDS----IGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGR 172
           TDS     G+  +N  +S  RA     YL        + +S  G+    P  +N+T  GR
Sbjct: 160 TDSTPPPPGSYPDNWELSAMRAVNTVRYLTDVAGLPPQRLSAAGYGEFRPRASNETVEGR 219

Query: 173 QNNQRIEIQIF 183
           + N+R++I I 
Sbjct: 220 RKNRRVDIVIV 230


>gi|213054486|gb|ACJ39422.1| PomB2 [Aeromonas hydrophila]
          Length = 297

 Score =  102 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 44/172 (25%), Positives = 75/172 (43%), Gaps = 6/172 (3%)

Query: 17  GCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYI 76
             G    E K V      +     ++      +  ++ + Q+QD  I V  +G  I   I
Sbjct: 111 AGGHDKSEDKLVGGDTRQEAQKKQEQSNDLAKELAEQMKAQIQDGAIEVEALGQQIIIRI 170

Query: 77  PVHVSFV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTL----KNNLLISQ 131
               +F     FL+ +F P+++ +AT+L   P   I I  HTD + T     ++N  +S 
Sbjct: 171 REKAAFPAGSAFLQPQFWPVVRKVATLLKDVPG-EITISGHTDDVATEDELFQSNWELSS 229

Query: 132 ERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
           +RA  +   +I+        + V+G A   P+  N T   R+ N+R+EI I 
Sbjct: 230 QRAVAVAHQMIKVPGFDGGRLVVQGMADSQPLVPNTTPENRRMNRRVEISIM 281


>gi|168334555|ref|ZP_02692711.1| flagellar motor protein [Epulopiscium sp. 'N.t. morphotype B']
          Length = 251

 Score =  102 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 43/173 (24%), Positives = 69/173 (39%), Gaps = 10/173 (5%)

Query: 17  GCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYI 76
           G      E+ +          I  +     LDK     + +  D  + V + G+ +    
Sbjct: 76  GVENVPEEEDRKAAENIKQITIEMENIKEELDKF---LKSEGLDNKVTVEQDGEEVVLTF 132

Query: 77  PVHVSFVSE-VFLEKKFLPMLQLIATILNKF--PSTVIAIQSHTDSIGTLK----NNLLI 129
              + F S    ++   L +L  I   + ++     +   + HTD++        +N  +
Sbjct: 133 EDFMLFDSGLAVIKPDGLEVLGKIGNEIKQYLEDDYIARAEGHTDNLPINSLIFPSNWEL 192

Query: 130 SQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           S  RA  +  YLI     S   IS  GF   YPI TNDT  GR  N+R+EI+I
Sbjct: 193 SASRAISVAKYLINDIGISPMRISAEGFGEFYPIATNDTPEGRAQNRRVEIKI 245


>gi|148976605|ref|ZP_01813292.1| flagellar motor protein MotB [Vibrionales bacterium SWAT-3]
 gi|145963956|gb|EDK29214.1| flagellar motor protein MotB [Vibrionales bacterium SWAT-3]
          Length = 315

 Score =  102 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 36/142 (25%), Positives = 68/142 (47%), Gaps = 6/142 (4%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV-SEVFLEKKFLPMLQLIATILNK 105
           ++  +   + ++    I V  +G  I   I    +F     FL+ KF P+++ +A ++  
Sbjct: 160 MESIKKALEREIDQGAIEVENLGQQIVIRIREKGAFPSGSAFLQPKFRPLVRQVAELVKD 219

Query: 106 FPSTVIAIQSHTDSI----GTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKY 161
            P   + I  HTD+        ++N  +S +RA  +   + +    S++ + VRG A   
Sbjct: 220 VPGI-VRISGHTDNQRLDSELYRSNWDLSSQRAVSVAQEMEKVRGFSHQRLRVRGMADTE 278

Query: 162 PIDTNDTKVGRQNNQRIEIQIF 183
           P++ NDT+  R  N+R+EI I 
Sbjct: 279 PVEPNDTEWQRSLNRRVEISIM 300


>gi|91202869|emb|CAJ72508.1| similar to flagellar motor protein MotB [Candidatus Kuenenia
           stuttgartiensis]
          Length = 223

 Score =  102 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 41/205 (20%), Positives = 78/205 (38%), Gaps = 27/205 (13%)

Query: 3   KELGLSMFIMTTISGCGLASR----EKKKVFLHKSNDTDIVN------------KRFGSS 46
           K   L++F+   ++GC          +++    +    +I              K     
Sbjct: 9   KFFLLAVFVG--MTGCAELDELRVLNRRQAITIRDQSDEIARYRNQLTSMSEKIKASEEE 66

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSE-VFLEKKFLPMLQLIATILNK 105
           ++K   +    +   G+ V    +      P  + F S    ++      L+ +A  L +
Sbjct: 67  MEKLR-KLAESI-GGGVSVRDTFEGPVILFPEMILFDSGMATIKAHGEDALRKMARFLEE 124

Query: 106 FPSTVIAIQSHTDSIGT------LKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAY 159
            P++ + I  HTDS           +N  +S  RA  +  +L ++G    + I + GF  
Sbjct: 125 NPASSLRIDGHTDSDPIIKTKHLWDSNHHLSAARALSVFHFLTKKGNIPEQRIHIAGFGP 184

Query: 160 KYPIDTNDTKVGRQNNQRIEIQIFP 184
             PI  N T  G++ N+R+E  I P
Sbjct: 185 NRPIAPNTTPAGKKENRRVEFLILP 209


>gi|220934517|ref|YP_002513416.1| OmpA/MotB domain protein [Thioalkalivibrio sp. HL-EbGR7]
 gi|219995827|gb|ACL72429.1| OmpA/MotB domain protein [Thioalkalivibrio sp. HL-EbGR7]
          Length = 305

 Score =  102 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 36/164 (21%), Positives = 64/164 (39%), Gaps = 7/164 (4%)

Query: 27  KVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSE 85
           +     +++     +      D+ E      +    I + R    I   I   + F    
Sbjct: 112 RDAELDADELQAAAEGMSRLADEIERAMLPLMDADLIRMRRDRFWIEVEINTSLLFASGS 171

Query: 86  VFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKN----NLLISQERADVIKSYL 141
             L  + +P+LQ +ATIL  FP   I ++  TD++         N  +S  RA  + +  
Sbjct: 172 AQLSSEAVPVLQRLATILRDFP-ARIQVEGFTDTVPINTPIFPSNWELSAARAASVVNLF 230

Query: 142 IQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPR 185
            +  +   R  +  G+    PI  NDT  GR+ N+R+ I +   
Sbjct: 231 SRNQLDPTRM-AAIGYGEYRPIADNDTAEGRRQNRRVSIVVLAE 273


>gi|189464066|ref|ZP_03012851.1| hypothetical protein BACINT_00401 [Bacteroides intestinalis DSM
           17393]
 gi|198275155|ref|ZP_03207686.1| hypothetical protein BACPLE_01313 [Bacteroides plebeius DSM 17135]
 gi|298482396|ref|ZP_07000582.1| outer membrane protein [Bacteroides sp. D22]
 gi|189438400|gb|EDV07385.1| hypothetical protein BACINT_00401 [Bacteroides intestinalis DSM
           17393]
 gi|198271975|gb|EDY96245.1| hypothetical protein BACPLE_01313 [Bacteroides plebeius DSM 17135]
 gi|298271375|gb|EFI12950.1| outer membrane protein [Bacteroides sp. D22]
          Length = 213

 Score =  102 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 43/211 (20%), Positives = 83/211 (39%), Gaps = 28/211 (13%)

Query: 1   MIKELG-LSMFIMTTISGCGLA-----------SREKKKVFLHKSNDTDIVNKRFGSSLD 48
           M K++  L+ F++T  + C               +EK  +  + +  T  +       + 
Sbjct: 1   MKKKIIILAAFVVTFFTACTSTHMITFSNAELSDKEKDMIENNSNYSTASIVGGSAKLVK 60

Query: 49  KAEDEFQMQLQDTGIVVSRIGDMITCY---------------IPVHVSFVSEVFLEKKFL 93
           +  D+   +  +      +  D ++                     +       L ++  
Sbjct: 61  EERDKAIQEKIEARRNKLKAIDGLSISSYKDKNGKEQFKATAQSEILFKFDSYELNEEAQ 120

Query: 94  PMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFIS 153
            ML  +  I+++ P+T I I  HTD+IG  + N+++S+ RA  + +YL          I+
Sbjct: 121 KMLSDLCNIISEIPNTKIKIIGHTDNIGEKQYNIILSKNRAAAVGNYLRTA-GIETNNIT 179

Query: 154 VRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
             G  Y  PI  N ++ GR  N+R+EI I  
Sbjct: 180 EDGKGYSEPIADNTSEAGRAKNRRVEIFITN 210


>gi|5081414|gb|AAD39369.1|AF117974_1 outer membrane protein OprF [Pseudomonas sp. DC]
          Length = 343

 Score =  102 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 33/172 (19%), Positives = 67/172 (38%), Gaps = 4/172 (2%)

Query: 17  GCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAED-EFQMQLQDTGIVVSRIGDMITCY 75
           G G    E   V    +  +D  N     ++DK  +    + +   G         +   
Sbjct: 175 GGGSKKVEAAPVEAAPAVCSDSDNDGVCDNVDKCPNTPANVTVDANGCPAVAEVVRVQL- 233

Query: 76  IPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERAD 135
                    +  ++      ++ +A  + ++P T   ++ HTDS+G    N  +S+ RA+
Sbjct: 234 --DVKFDFDKSVVKPNSYRDIKNLADFMKQYPQTTTTVEGHTDSVGPDAYNQKLSERRAN 291

Query: 136 VIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGN 187
            +K  L+ +       +S  G+    P+  N T  GR  N+R+E ++  +  
Sbjct: 292 AVKQVLVNQYGVGANRVSSVGYGETRPVADNATDAGRAVNRRVEAEVEAQAK 343


>gi|218133672|ref|ZP_03462476.1| hypothetical protein BACPEC_01541 [Bacteroides pectinophilus ATCC
           43243]
 gi|217991047|gb|EEC57053.1| hypothetical protein BACPEC_01541 [Bacteroides pectinophilus ATCC
           43243]
          Length = 266

 Score =  102 bits (253), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 30/164 (18%), Positives = 66/164 (40%), Gaps = 5/164 (3%)

Query: 24  EKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV 83
            ++++        +   +      +  E + +  +    + V      +   +   + F 
Sbjct: 98  TQEEIKDAAQQIQEAGLQESEHMAENIEKQLEQNMLSDDVEVKATSKYVMLNLNSGILFD 157

Query: 84  -SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLI----SQERADVIK 138
             +  L+ + + +L  +++IL ++   +IAI+ HTD+     +        S  RA  + 
Sbjct: 158 SGKSELKTEAVTLLDKVSSILWEYNDNMIAIEGHTDNNPIHNSKYPDNTMLSLYRAYSVF 217

Query: 139 SYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           +YL  +       +   G     PI +N T  GR  N+R+EI+I
Sbjct: 218 TYLTDQKGFDASTMLATGRGESVPIASNATAEGRAQNRRVEIKI 261


>gi|116620394|ref|YP_822550.1| OmpA/MotB domain-containing protein [Candidatus Solibacter usitatus
           Ellin6076]
 gi|116223556|gb|ABJ82265.1| OmpA/MotB domain protein [Candidatus Solibacter usitatus Ellin6076]
          Length = 545

 Score =  102 bits (253), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 34/147 (23%), Positives = 68/147 (46%), Gaps = 2/147 (1%)

Query: 36  TDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPM 95
                ++  +   +  +  + QL +  +        +   I   +   ++  L+      
Sbjct: 384 AKQGMQKAEAEKAELRERLRNQL-NMILETRETARGLIINISDVLFDFNKYTLKPGAREK 442

Query: 96  LQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVR 155
           L  ++ IL  +P   I ++ HTDSIG+ + N  +S+ RA  ++ YL  + V ++  +S  
Sbjct: 443 LAKVSGILLAYPGLNIKVEGHTDSIGSDEYNQKLSESRASSVRDYLTSQNVPADS-VSAV 501

Query: 156 GFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           G     P+ +NDT  GRQ N+R+E+ +
Sbjct: 502 GLGKSDPVASNDTAAGRQRNRRVELVV 528


>gi|281425749|ref|ZP_06256662.1| lipoprotein PG3 [Prevotella oris F0302]
 gi|281400157|gb|EFB30988.1| lipoprotein PG3 [Prevotella oris F0302]
          Length = 225

 Score =  102 bits (253), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 39/210 (18%), Positives = 79/210 (37%), Gaps = 31/210 (14%)

Query: 2   IKELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFG----------------- 44
           +K L ++   +  +S C  +++ +    L  +    ++    G                 
Sbjct: 1   MKNLKMATVGLCVLSVCSCSTK-QGTGTLIGAGGGSVLGAIVGKIAGNTAVGAAIGGAVG 59

Query: 45  --------SSLDKAEDEFQMQLQDTGIVVSRIGDMIT---CYIPVHVSFVSE-VFLEKKF 92
                     +DK   +   Q+++  +      + +          + F +    L    
Sbjct: 60  AGAGALIGRHMDKVAAQ-AAQIRNAKVEEVTDANGLKAVKVTFDSGILFATNQATLTSSS 118

Query: 93  LPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFI 152
              L   + +L       + I  HTD+ G    N+ +S  RA+ + +YL Q GVS ++F 
Sbjct: 119 KNDLAKFSKVLKDNSDCHVDIYGHTDTTGNDGINIPLSNRRAESVVNYLKQCGVSGSQFK 178

Query: 153 SVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           +V G     P+  N T  GR+ N+R+E+ +
Sbjct: 179 NVVGKGSAEPVADNSTAAGRKQNRRVEVYL 208


>gi|238895326|ref|YP_002920061.1| hypothetical protein KP1_3385 [Klebsiella pneumoniae NTUH-K2044]
 gi|238547643|dbj|BAH63994.1| hypothetical protein KP1_3385 [Klebsiella pneumoniae subsp.
           pneumoniae NTUH-K2044]
          Length = 565

 Score =  102 bits (253), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 27/108 (25%), Positives = 54/108 (50%)

Query: 80  VSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKS 139
           +    +  L+     +L      +   P  +I +  HTDSIG  ++N  +S +RA+ ++ 
Sbjct: 435 LFDTGKSALKPGSTKLLVNSLLGIKAKPGWLIVVAGHTDSIGNDRSNQQLSLKRAEAVRD 494

Query: 140 YLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGN 187
           ++   G       +V+G+    P+ +N+T  GR  N+R+EI + P+ +
Sbjct: 495 WMRDTGDVPESCFAVQGYGASRPVASNETPEGRAQNRRVEISLVPQKD 542


>gi|120554618|ref|YP_958969.1| OmpA/MotB domain-containing protein [Marinobacter aquaeolei VT8]
 gi|120324467|gb|ABM18782.1| OmpA/MotB domain protein [Marinobacter aquaeolei VT8]
          Length = 189

 Score =  102 bits (253), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 27/181 (14%), Positives = 57/181 (31%), Gaps = 4/181 (2%)

Query: 4   ELGLSMFIMTTISGCGLASREKKKVF--LHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDT 61
           +    +     ++GC       ++       +              D +         D 
Sbjct: 8   KAFAMLLSAGLVAGCSSTGENMEEGAYGSDVAAIDQDGGSTVYGGADGSGVSASELTDDE 67

Query: 62  GIVVSRIGDMITCY-IPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSI 120
                   +      I           ++     +L   A  L   P   + ++ H D  
Sbjct: 68  RRAAQEQAEQEALRDITTFYFDFDTSEIKPDARDVLVAHARYLADNPRQQVRLEGHADER 127

Query: 121 GTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEI 180
           GT + NL + + RA+ ++ +LI  G S  +  +V  +  + P     T+     N+R+E+
Sbjct: 128 GTKEYNLALGERRANAVQRFLIVNGASRGQIETVS-YGEEKPAVRGSTESAWAQNRRVEL 186

Query: 181 Q 181
            
Sbjct: 187 V 187


>gi|60650175|ref|YP_209728.1| putative outer membrane protein [Bacteroides fragilis NCTC 9343]
 gi|255010962|ref|ZP_05283088.1| putative outer membrane protein [Bacteroides fragilis 3_1_12]
 gi|313148766|ref|ZP_07810959.1| lipoprotein [Bacteroides fragilis 3_1_12]
 gi|317477470|ref|ZP_07936697.1| OmpA family protein [Bacteroides eggerthii 1_2_48FAA]
 gi|60495255|emb|CAH05749.1| putative outer membrane protein [Bacteroides fragilis NCTC 9343]
 gi|313137533|gb|EFR54893.1| lipoprotein [Bacteroides fragilis 3_1_12]
 gi|316906390|gb|EFV28117.1| OmpA family protein [Bacteroides eggerthii 1_2_48FAA]
          Length = 213

 Score =  102 bits (253), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 43/211 (20%), Positives = 82/211 (38%), Gaps = 28/211 (13%)

Query: 1   MIKELG-LSMFIMTTISGCGLA-----------SREKKKVFLHKSNDTDIVNKRFGSSLD 48
           M K++  L+ F++T  + C               +EK  +  + +  T  +       + 
Sbjct: 1   MKKKIIILAAFVVTFFTACTSTHMITFSNAELSDKEKDMIENNSNYSTASIVGGSAKLVK 60

Query: 49  KAEDEFQMQLQDTGIVVSRIGDMITCY---------------IPVHVSFVSEVFLEKKFL 93
           +  D+   +  +      +  D ++                     +       L ++  
Sbjct: 61  EERDKAIQEKIEARRNKLKAIDGLSISSYKDKNGKEQFKATAQSEILFKFDSYELNEEAQ 120

Query: 94  PMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFIS 153
            ML  +  I+ + P+T I I  HTD+IG  + N+++S+ RA  + +YL          I+
Sbjct: 121 KMLSDLCNIITEIPNTKIKIIGHTDNIGEKQYNIILSKNRAAAVGNYLRTA-GIETNNIT 179

Query: 154 VRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
             G  Y  PI  N ++ GR  N+R+EI I  
Sbjct: 180 EDGKGYSEPIADNTSEAGRAKNRRVEIFITN 210


>gi|323706054|ref|ZP_08117624.1| OmpA/MotB domain protein [Thermoanaerobacterium xylanolyticum
           LX-11]
 gi|323534668|gb|EGB24449.1| OmpA/MotB domain protein [Thermoanaerobacterium xylanolyticum
           LX-11]
          Length = 241

 Score =  102 bits (253), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 30/168 (17%), Positives = 55/168 (32%), Gaps = 6/168 (3%)

Query: 22  SREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVS 81
            ++     L     T        S   + +   +       +            +   + 
Sbjct: 65  GQQSGNSILDSIKTTGTNGTNDNSIASQLDKLIKQYNLQNMVTYKVDERGFVISLNDTLL 124

Query: 82  FV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIG----TLKNNLLISQERADV 136
           F      ++      L  I  IL   P+  I ++ +TD++        +N  +S  RA  
Sbjct: 125 FDTGSADVKPDQKETLIKIGNILKSMPNY-IRVEGYTDNVPINNNQFHSNWELSVIRATN 183

Query: 137 IKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           +   L+         IS  G+    PI  ND+   RQ N+R++I I  
Sbjct: 184 VVEILVNDVKMDPAKISAVGYGEYRPIVPNDSDKNRQLNRRVDIVIMN 231


>gi|163755660|ref|ZP_02162779.1| OmpA/MotB [Kordia algicida OT-1]
 gi|161324573|gb|EDP95903.1| OmpA/MotB [Kordia algicida OT-1]
          Length = 635

 Score =  102 bits (253), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 41/166 (24%), Positives = 57/166 (34%), Gaps = 15/166 (9%)

Query: 17  GCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYI 76
           GC     +      +K     +V    G   +  E             V  I D      
Sbjct: 480 GCPDTDGDGFPD--NKDKCPTVVGTIEGCPAEVVET-----------EVVTIPDP-AVGE 525

Query: 77  PVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADV 136
                      L+K    +L  IA  L       I+I  H DS GT + N  +S ERA  
Sbjct: 526 RKVYFDFDSSKLDKNAKEILDNIAANLKNDAGYNISIIGHADSRGTDRYNDKLSIERAQ- 584

Query: 137 IKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           +    +     SN  I++ G     PI  N T  GR  N+R+E+ I
Sbjct: 585 VIKNYLDSKKLSNSNITITGKGESAPIAPNTTPEGRAKNRRVELII 630


>gi|163757275|ref|ZP_02164371.1| OmpA/MotB [Kordia algicida OT-1]
 gi|161322760|gb|EDP94113.1| OmpA/MotB [Kordia algicida OT-1]
          Length = 617

 Score =  102 bits (253), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 43/166 (25%), Positives = 63/166 (37%), Gaps = 15/166 (9%)

Query: 17  GCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYI 76
           GC     +      +K     +V    G   +  E             V  I D      
Sbjct: 462 GCPDTDGDGFPD--NKDKCPTVVGTIEGCPAEVVET-----------EVVTIPDP-AVGE 507

Query: 77  PVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADV 136
                      L++    +L  IA  L       I+I  H DS GT + N  +S ERA  
Sbjct: 508 RKVYFDFDSSKLDQNAKEILDNIAANLKNDAGYNISIIGHADSRGTDRYNDKLSVERAQA 567

Query: 137 IKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           IK+YL  + +S++  I++ G     PI  N T  GR  N+R+E+ I
Sbjct: 568 IKNYLDSKKLSNSN-ITITGKGESAPIAPNTTPEGRAKNRRVELII 612


>gi|78485827|ref|YP_391752.1| OmpA/MotB [Thiomicrospira crunogena XCL-2]
 gi|78364113|gb|ABB42078.1| OmpA/MotB family protein [Thiomicrospira crunogena XCL-2]
          Length = 187

 Score =  102 bits (253), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 35/181 (19%), Positives = 75/181 (41%), Gaps = 3/181 (1%)

Query: 2   IKELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDT 61
           +K+L L  F+  T+ GC      ++      +  T    +   SS   +       +   
Sbjct: 6   LKQLFLVGFLGLTLVGCSSTPTTEEGDTGSTTEQTSASAETETSSATDSNAGSGADMAAA 65

Query: 62  GIVVSRIGDMITCYIPVHV--SFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDS 119
                +  + +   +   V         ++ +F  ++++ A  +    S ++ ++ + D 
Sbjct: 66  TNAAGQTAEDLYAALQGKVVNFEFDRSEVQSQFYDVIKMNADYMALNDSAMVTVKGYCDE 125

Query: 120 IGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIE 179
            GT + NL + + RA+ +K+ L+  GVS +R I+V  F  + P+D    +     N+R E
Sbjct: 126 RGTREYNLALGERRANAVKNALVAEGVSPSR-INVISFGEENPVDPAHNEAAWAKNRRAE 184

Query: 180 I 180
            
Sbjct: 185 F 185


>gi|332528331|ref|ZP_08404331.1| OmpA/MotB [Hylemonella gracilis ATCC 19624]
 gi|332042202|gb|EGI78528.1| OmpA/MotB [Hylemonella gracilis ATCC 19624]
          Length = 186

 Score =  102 bits (253), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 30/182 (16%), Positives = 69/182 (37%), Gaps = 5/182 (2%)

Query: 2   IKELGLSMFIMTTISGCGLASREKKKV---FLHKSNDTDIVNKRFGSSLDKAEDEFQMQL 58
           +K LG+++F   T++ C     + +              + +     S+ +     +  +
Sbjct: 4   LKYLGIALFS-LTLAACSSVKLDPQTGSDKASAGQTSATVADGGAVGSVPQPTATPETVV 62

Query: 59  QDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTD 118
           Q  G   + +         +         ++ +F  +++  A  L+  P+  + I+ HTD
Sbjct: 63  QSAGPTAASLQSAAMAAGRLVYFDYDSYVIKPEFQKLIEAQARYLSSDPALRVVIEGHTD 122

Query: 119 SIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRI 178
             G  + NL + Q RA+ ++   +     ++  I    F  + P+     +     N+R 
Sbjct: 123 ERGGREYNLALGQRRAEAVRR-ALSLLGVADTQIDAVSFGEEKPVSEGSNESAWSQNRRA 181

Query: 179 EI 180
           EI
Sbjct: 182 EI 183


>gi|330951777|gb|EGH52037.1| thrombospondin type 3 repeat-containing OmpA/MotB protein
           [Pseudomonas syringae Cit 7]
          Length = 344

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 31/173 (17%), Positives = 67/173 (38%), Gaps = 10/173 (5%)

Query: 19  GLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIP- 77
           G + + +          +D  N     ++DK  D          + V   G      +  
Sbjct: 178 GGSKKVEAAPAPVAEVCSDSDNDGVCDNVDKCPD------TPANVTVDADGCPAVAEVVR 231

Query: 78  ---VHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERA 134
                     +  ++      ++ +A  + ++P T   ++ HTDS+G    N  +S+ RA
Sbjct: 232 VELDVKFDFDKSVVKPNSYGDIKNLADFMQQYPQTTTTVEGHTDSVGPDAYNQKLSERRA 291

Query: 135 DVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGN 187
           + +K  L+ +       ++  G+    P+  N T+ GR  N+R+E ++  +  
Sbjct: 292 NAVKQVLVNQYGVGANRVNSVGYGESRPVADNATEAGRAVNRRVEAEVEAQAK 344


>gi|311694925|gb|ADP97798.1| peptidoglycan-associated lipoprotein [marine bacterium HP15]
          Length = 190

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 26/182 (14%), Positives = 64/182 (35%), Gaps = 5/182 (2%)

Query: 4   ELGLSMFIMTTISGCGLASREKKKVFLHK---SNDTDIVNKRFGSSLDKAEDEFQMQLQD 60
           +    +  +  ++GC       ++   +    +              D+         ++
Sbjct: 8   KAFALLLSVGLVAGCSSTGGTSEEGGEYGSDVAAVDQEGGSTVYGGDDQGGVSSSAMTEE 67

Query: 61  TGIVVSRIGDMITCY-IPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDS 119
             +   +  +      I           ++++   +L   A  L   P   + I+ H D 
Sbjct: 68  ERMEARKQAEQQALREITTFYFDFDTAEIKQEARDVLVAHARFLANNPGQNVRIEGHADE 127

Query: 120 IGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIE 179
            GT + NL + + RA+ ++ +LI  G S  +  +V  +  + P     ++     N+R+E
Sbjct: 128 RGTKEYNLALGERRANAVQRFLIVNGASRGQLETVS-YGEEKPAVMGSSESAWAQNRRVE 186

Query: 180 IQ 181
           + 
Sbjct: 187 LV 188


>gi|126734944|ref|ZP_01750690.1| OmpA family domain protein [Roseobacter sp. CCS2]
 gi|126715499|gb|EBA12364.1| OmpA family domain protein [Roseobacter sp. CCS2]
          Length = 220

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 47/166 (28%), Positives = 81/166 (48%), Gaps = 3/166 (1%)

Query: 21  ASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHV 80
           + RE+ +  L  +     V    G+SLD+  ++ + QL++  + VS  G  +   +   +
Sbjct: 57  SVRERNQAALIGAALGAGVGAGVGNSLDRQAEDLRRQLRND-VGVSNNGRDLRVVLSEDL 115

Query: 81  SFVSEVF-LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKS 139
            F +    L       L+++A  L ++P + + +  HTD++G    N  +S+ RA  + S
Sbjct: 116 LFATNSTQLSGTAQRELRIVANSLQQYPDSTVNVIGHTDNVGEASFNQGLSERRASAVSS 175

Query: 140 YLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPR 185
            L+  GVS NR I   G     P+ +N    GRQ N+R+EI I P 
Sbjct: 176 VLVGGGVSRNR-IRTIGAGENNPVASNLNAAGRQANRRVEIVITPN 220


>gi|83643665|ref|YP_432100.1| outer membrane protein and related peptidoglycan-associated
           (lipo)protein [Hahella chejuensis KCTC 2396]
 gi|83631708|gb|ABC27675.1| Outer membrane protein and related peptidoglycan-associated
           (lipo)protein [Hahella chejuensis KCTC 2396]
          Length = 494

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 38/173 (21%), Positives = 66/173 (38%)

Query: 16  SGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCY 75
           +      +++ +  L          KR    + +  +  Q     T   V R    +   
Sbjct: 321 AASLETMKQEMEQKLLAVQLETDAVKRANEEIQRRFEFVQELFTLTEADVYRQNANVLIR 380

Query: 76  IPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERAD 135
                       +++  + +L  I   +  FP+  I I  HTD+ G    N  +S++RA 
Sbjct: 381 AHGFKFASGSSEVQRDNVTLLNKIIDAIEAFPNCKIRISGHTDNRGDRALNQSLSEKRAS 440

Query: 136 VIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGNI 188
            +  +L   G   +  I   GF    P+  NDTK GR  N+R+E+ I    N+
Sbjct: 441 NVAKFLANVGSIDSSRIEAEGFGASRPVANNDTKEGRAANRRVEVLIINDANL 493


>gi|229543005|ref|ZP_04432065.1| OmpA/MotB domain protein [Bacillus coagulans 36D1]
 gi|229327425|gb|EEN93100.1| OmpA/MotB domain protein [Bacillus coagulans 36D1]
          Length = 274

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 34/178 (19%), Positives = 76/178 (42%), Gaps = 9/178 (5%)

Query: 19  GLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQ----DTGIVVSRIGDMITC 74
              + +        ++ TD  N +  + L + +      +     +     S  G+ +  
Sbjct: 92  AQKNGDSTTNGSKSNSTTDASNGQGDAQLKETQQRINTYIAHNKLEGKFETSLTGEGLLI 151

Query: 75  YIPVHVSFV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTL----KNNLLI 129
            I  +V F   +  + K+ +   + ++ +L   P   I +  HTD++       ++N  +
Sbjct: 152 TIRDNVLFDSGKAEVRKEDIKTAKALSNLLVMDPPRSIIVSGHTDNVPIHNSVFQSNWDL 211

Query: 130 SQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGN 187
           S  RA      +++    + ++ S +G+   +PI +NDT+ GR  N+R+E+ I P+  
Sbjct: 212 SVMRATNFLKIILENKNLNPKYFSAKGYGEYHPIASNDTQGGRAKNRRVEVLILPKNE 269


>gi|121533592|ref|ZP_01665419.1| OmpA/MotB domain protein [Thermosinus carboxydivorans Nor1]
 gi|121307583|gb|EAX48498.1| OmpA/MotB domain protein [Thermosinus carboxydivorans Nor1]
          Length = 257

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 37/222 (16%), Positives = 80/222 (36%), Gaps = 41/222 (18%)

Query: 1   MIKELG-----LSMFIMTTISGCGLASREKKK----------VFLHKSNDTDIV------ 39
           M++ L      +++ ++  +    ++S ++KK              +   T+++      
Sbjct: 19  MMRWLLTYADLITLLMVFFVVMYAMSSADQKKFNALKASLAAALRTEGAGTNLIFEYSGN 78

Query: 40  --------NKRFGSSLDKAEDEFQM------QLQDTGIVVSRIGDMITCYIPVHVSFVSE 85
                    +     L+   +            Q  G  VS  G  I   +   +  +  
Sbjct: 79  RPFNQVVNPEGTEKDLETFREIISQIQQRVKDPQGVGFTVSERGLTIRF-LDSILFDLGR 137

Query: 86  VFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIG----TLKNNLLISQERADVIKSYL 141
             L    LP+L  +A  L +  +  I ++ H D++        +N  +S  R+  +  Y 
Sbjct: 138 AELRPDALPLLDAVADALKQTDNY-IRVEGHADNLPINTAQFPSNWELSAARSIAVTRYF 196

Query: 142 IQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
           I +     R +S  G+    P+  N ++  R  N+R++I I 
Sbjct: 197 IDKHGLEPRRLSSLGYGEYRPLYPNTSEANRAKNRRVDIVIL 238


>gi|52842260|ref|YP_096059.1| peptidoglycan-associated lipoprotein precursor (19 kDa surface
           antigen) (PPL) [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
 gi|54294942|ref|YP_127357.1| peptidoglycan-associated lipoprotein precursor (19 kDa surface
           antigen) (PPL) [Legionella pneumophila str. Lens]
 gi|54297971|ref|YP_124340.1| peptidoglycan-associated lipoprotein precursor (19 kDa surface
           antigen) (PPL) [Legionella pneumophila str. Paris]
 gi|148359617|ref|YP_001250824.1| peptidoglycan-associated lipoprotein [Legionella pneumophila str.
           Corby]
 gi|296107659|ref|YP_003619360.1| Peptidoglycan-associated lipoprotein precursor [Legionella
           pneumophila 2300/99 Alcoy]
 gi|129597|sp|P26493|PAL_LEGPN RecName: Full=Peptidoglycan-associated lipoprotein; AltName:
           Full=19 kDa surface antigen; AltName: Full=PPL; Flags:
           Precursor
 gi|44129|emb|CAA43033.1| lipoprotein antigen [Legionella pneumophila]
 gi|52629371|gb|AAU28112.1| peptidoglycan associated lipoprotein [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
 gi|53751756|emb|CAH13178.1| Peptidoglycan-associated lipoprotein precursor (19 kDa surface
           antigen) (PPL) [Legionella pneumophila str. Paris]
 gi|53754774|emb|CAH16261.1| Peptidoglycan-associated lipoprotein precursor (19 kDa surface
           antigen) (PPL) [Legionella pneumophila str. Lens]
 gi|148281390|gb|ABQ55478.1| Peptidoglycan-associated lipoprotein precursor (19 kDa surface
           antigen) (PPL) [Legionella pneumophila str. Corby]
 gi|295649561|gb|ADG25408.1| Peptidoglycan-associated lipoprotein precursor [Legionella
           pneumophila 2300/99 Alcoy]
 gi|307610774|emb|CBX00386.1| peptidoglycan-associated lipoprotein precursor [Legionella
           pneumophila 130b]
          Length = 176

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 30/178 (16%), Positives = 54/178 (30%), Gaps = 14/178 (7%)

Query: 4   ELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGI 63
           +LGL +     ++ C                D         +     E            
Sbjct: 8   KLGLLVASAVLVAACSKTPGSADGGAAVGDGDATAQGLGQMTHFAGQEP-------GESY 60

Query: 64  VVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTL 123
                 + +            +  L  K+LP +   A  L   P   + I  HTD  G+ 
Sbjct: 61  TTQAPHNQLYL------FAYDDSTLASKYLPSVNAQAEYLKTHPGARVMIAGHTDERGSR 114

Query: 124 KNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQ 181
           + N+ + + RAD +   L      S + I V  +  + P +    +     N+R+E  
Sbjct: 115 EYNVALGERRADTVAEILRMA-GVSRQQIRVVSYGKERPANYGHDEASHAQNRRVEFI 171


>gi|237707828|ref|ZP_04538309.1| conserved hypothetical protein [Bacteroides sp. 9_1_42FAA]
 gi|229458156|gb|EEO63877.1| conserved hypothetical protein [Bacteroides sp. 9_1_42FAA]
          Length = 213

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 43/211 (20%), Positives = 82/211 (38%), Gaps = 28/211 (13%)

Query: 1   MIKELG-LSMFIMTTISGCGLA-----------SREKKKVFLHKSNDTDIVNKRFGSSLD 48
           M K++  L+ F++T  + C               +EK  +  + +  T  +       + 
Sbjct: 1   MKKKIIILAAFVITFFTACTSTHMITFSNAELSDKEKDMIENNSNYSTASIVGGSAKLVK 60

Query: 49  KAEDEFQMQLQDTGIVVSRIGDMITCY---------------IPVHVSFVSEVFLEKKFL 93
           +  D+   +  +      +  D ++                     +       L ++  
Sbjct: 61  EERDKAIQEKIEARRNKLKAIDGLSISSYKDKNGKEQFKATAQSEILFKFDSYELNEEAQ 120

Query: 94  PMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFIS 153
            ML  +  I+ + P+T I I  HTD+IG  + N+++S+ RA  + +YL          I+
Sbjct: 121 KMLSDLCNIITEIPNTKIKIIGHTDNIGEKQYNIILSKNRAAAVGNYLRTA-GIETNNIT 179

Query: 154 VRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
             G  Y  PI  N ++ GR  N+R+EI I  
Sbjct: 180 EDGKGYSEPIADNTSEAGRAKNRRVEIFITN 210


>gi|255323068|ref|ZP_05364204.1| outer membrane fibronectin-binding protein [Campylobacter showae
           RM3277]
 gi|255299930|gb|EET79211.1| outer membrane fibronectin-binding protein [Campylobacter showae
           RM3277]
          Length = 332

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 29/121 (23%), Positives = 54/121 (44%), Gaps = 3/121 (2%)

Query: 61  TGIVVSRIGDMITCYIPVHV--SFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTD 118
            G+VV   G      +             +  K+L  ++ +A  + + P   + +  HTD
Sbjct: 208 AGVVVDETGCEKVIVLRDIGVNFAFDSYKITPKYLEEIRKVANFMGENPGYRVVLSGHTD 267

Query: 119 SIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRI 178
           S+G    N  +S++RA+ +    ++    S   I+  G+    P+ +N TK GR  N+R+
Sbjct: 268 SVGAEAYNQKLSEKRANAVAK-ALEELGVSADKITTVGYGELKPVASNKTKEGRAENRRV 326

Query: 179 E 179
           E
Sbjct: 327 E 327


>gi|253572950|ref|ZP_04850347.1| conserved hypothetical protein [Bacteroides sp. 1_1_6]
 gi|254885124|ref|ZP_05257834.1| lipoprotein PG3 [Bacteroides sp. 4_3_47FAA]
 gi|251837477|gb|EES65571.1| conserved hypothetical protein [Bacteroides sp. 1_1_6]
 gi|254837917|gb|EET18226.1| lipoprotein PG3 [Bacteroides sp. 4_3_47FAA]
          Length = 213

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 43/211 (20%), Positives = 82/211 (38%), Gaps = 28/211 (13%)

Query: 1   MIKELG-LSMFIMTTISGCGLA-----------SREKKKVFLHKSNDTDIVNKRFGSSLD 48
           M K++  L+ F++T  + C               +EK  +  + +  T  +       + 
Sbjct: 1   MKKKIIILAAFVITFFTACTSTHMITFSNAELSDKEKDMIENNSNYSTASIVGGSAKLVK 60

Query: 49  KAEDEFQMQLQDTGIVVSRIGDMITCY---------------IPVHVSFVSEVFLEKKFL 93
           +  D+   +  +      +  D ++                     +       L ++  
Sbjct: 61  EERDKAIQEKIEARRNKLKAIDGLSISSYKDKNGKEQFKATAQSEILFKFDSYELNEEAQ 120

Query: 94  PMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFIS 153
            ML  +  I+ + P+T I I  HTD+IG  + N+++S+ RA  + +YL          I+
Sbjct: 121 KMLSNLCNIITEIPNTKIKIIGHTDNIGEKQYNIILSKNRAAAVGNYLRTA-GIETNNIT 179

Query: 154 VRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
             G  Y  PI  N ++ GR  N+R+EI I  
Sbjct: 180 EDGKGYSEPIADNTSEAGRAKNRRVEIFITN 210


>gi|229588852|ref|YP_002870971.1| hypothetical protein PFLU1321 [Pseudomonas fluorescens SBW25]
 gi|229360718|emb|CAY47576.1| putative outer membrane protein [Pseudomonas fluorescens SBW25]
          Length = 231

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 44/227 (19%), Positives = 70/227 (30%), Gaps = 45/227 (19%)

Query: 1   MIKELGLSMFIMTTISGCGLASREKKKV-FLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQ 59
           +++     + +   ++GC    +                +     S+           + 
Sbjct: 3   IMRTALPLVLLTGVLTGCAGLQKTDWPTCAAVGGVTGAAIGATESSAYAGYGALLVGGMA 62

Query: 60  DT---------------------------GIVVSRIGDMI----------------TCYI 76
                                        G+ V   G                   T  I
Sbjct: 63  GAYCWVHGDGDEDGDGVPDSRDKCPGTPKGVQVDADGCPPAPPPVVVEEVVVVKEETIVI 122

Query: 77  PVHVSFVSEVFLEKKFLPMLQLIATILN-KFPSTVIAIQSHTDSIGTLKNNLLISQERAD 135
                      L       L  +AT L  + PS  + +  HTDS+G    N  +S++RA 
Sbjct: 123 RDVHFQFDSAQLTAADKTKLDTVATRLKQEAPSAQLRVSGHTDSVGKDAYNQRLSEKRAH 182

Query: 136 VIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
            +  YLI  GV  + F+SV G    +P+  N T  GR  N+R EIQI
Sbjct: 183 SVTDYLIGAGVPRSNFVSVTGAGESHPVADNKTAEGRALNRRTEIQI 229


>gi|146283087|ref|YP_001173240.1| OmpA family protein [Pseudomonas stutzeri A1501]
 gi|145571292|gb|ABP80398.1| OmpA family protein [Pseudomonas stutzeri A1501]
 gi|327481439|gb|AEA84749.1| OmpA family protein [Pseudomonas stutzeri DSM 4166]
          Length = 260

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 29/152 (19%), Positives = 62/152 (40%), Gaps = 3/152 (1%)

Query: 31  HKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEK 90
            +        +R  + L+  E + +       +   +            +       L+ 
Sbjct: 98  AEEELGKTSAQRAEARLEAREAQIRK--LQEDMQAKQTERGTLVTFGDVLFDYDRAELKP 155

Query: 91  KFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNR 150
             +  +Q +A  LN  P   + ++ +TDS G+ + N  +S+ RAD +    + +     +
Sbjct: 156 GGMRSVQKLADFLNDNPERKVIVEGYTDSTGSAEYNQRLSERRADAV-RMALVKMGVDPQ 214

Query: 151 FISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
            I  +G+  +YP+ +N    GR  N+R+E+ I
Sbjct: 215 RIVSQGYGKEYPVASNSDSAGRAMNRRVEVTI 246


>gi|86147426|ref|ZP_01065738.1| flagellar motor protein [Vibrio sp. MED222]
 gi|85834719|gb|EAQ52865.1| flagellar motor protein [Vibrio sp. MED222]
          Length = 315

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 36/142 (25%), Positives = 68/142 (47%), Gaps = 6/142 (4%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV-SEVFLEKKFLPMLQLIATILNK 105
           ++  +   + ++    I V  +G  I   I    +F     FL+ KF P+++ +A ++  
Sbjct: 160 MESIKKALEREIDQGAIEVENLGQQIVIRIREKGAFPSGSAFLQPKFRPLVRQVAELVKD 219

Query: 106 FPSTVIAIQSHTDSI----GTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKY 161
            P   + I  HTD+        ++N  +S +RA  +   + +    S++ + VRG A   
Sbjct: 220 VPGI-VRISGHTDNQRLDSELYRSNWDLSSQRAVSVAQEMEKVRGFSHQRLRVRGMADTE 278

Query: 162 PIDTNDTKVGRQNNQRIEIQIF 183
           P++ NDT+  R  N+R+EI I 
Sbjct: 279 PVEPNDTEWQRSLNRRVEISIM 300


>gi|332975535|gb|EGK12425.1| OmpA domain protein [Desmospora sp. 8437]
          Length = 243

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 32/121 (26%), Positives = 63/121 (52%), Gaps = 2/121 (1%)

Query: 66  SRIGDMITCYIPVHVSFV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLK 124
            +    +  ++P H+ F   +  +  K  P L  +   L ++  T + I  +TD  G+  
Sbjct: 124 EKGAKKVVIHVPGHILFDTDQSTIRAKARPELDKLGKSLKEYKGT-VRIYGYTDDRGSAA 182

Query: 125 NNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
            N  +SQERA+ +K+YL++    +   + ++GF  K+P+  N++   RQ N+R+EI +  
Sbjct: 183 YNQKLSQERAEAVKAYLVKECGIAGDHLKIKGFGKKHPVVPNNSDSNRQKNRRVEIIVDS 242

Query: 185 R 185
           +
Sbjct: 243 K 243


>gi|146306454|ref|YP_001186919.1| OmpA/MotB domain-containing protein [Pseudomonas mendocina ymp]
 gi|145574655|gb|ABP84187.1| OmpA/MotB domain protein [Pseudomonas mendocina ymp]
          Length = 210

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 30/198 (15%), Positives = 72/198 (36%), Gaps = 24/198 (12%)

Query: 8   SMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSL-------------------- 47
            +   T ++GC    +                     SS                     
Sbjct: 10  LILASTLLTGCAGLQKSDWPTCAAVGGVGGAALGAIESSTWAGGGAVLGAGMAAAYCWVH 69

Query: 48  ---DKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATILN 104
               +     +  + +  +V     + +   + V   F  +  ++++    ++ +A  + 
Sbjct: 70  GADAQQVAVAEEVVVEEVVVAEPRAEAVRVELDVKFDF-DKSQVKQESYGDIKALADFMK 128

Query: 105 KFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPID 164
           ++P T   ++ HTDS+G+   N  +S+ RA+ ++  L+ +    +  +   G+    P+ 
Sbjct: 129 QYPQTSTVVEGHTDSVGSDAYNQGLSERRANAVREVLVNQYGVESNRVQAVGYGESRPVA 188

Query: 165 TNDTKVGRQNNQRIEIQI 182
            N T  GR  N+R+E ++
Sbjct: 189 DNATAEGRAINRRVEAEV 206


>gi|325286633|ref|YP_004262423.1| OmpA/MotB domain-containing protein [Cellulophaga lytica DSM 7489]
 gi|324322087|gb|ADY29552.1| OmpA/MotB domain protein [Cellulophaga lytica DSM 7489]
          Length = 235

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 35/145 (24%), Positives = 68/145 (46%), Gaps = 2/145 (1%)

Query: 45  SSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVS-EVFLEKKFLPMLQLIATIL 103
           + +DK   + + ++    +     G ++T      V F + +  +       L  +A + 
Sbjct: 81  NRMDKQAQKIEEEIPGAQVERVDDGIVVTFDENSGVFFDTAKYNINGASKTSLDKLANVF 140

Query: 104 NKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPI 163
            ++P T I +  HTDS G    N+ +S+ RA+ + SYL  +G++++R  +   F  + P 
Sbjct: 141 IEYPDTNILVVGHTDSSGAADYNMTLSKNRANAVTSYLTAKGIAASR-FTTEWFGEEKPT 199

Query: 164 DTNDTKVGRQNNQRIEIQIFPRGNI 188
             N T  GR  N+R+ + I P   +
Sbjct: 200 HDNSTPEGRAKNRRVNVAILPNEKM 224


>gi|4580973|gb|AAD24560.1|AF117968_1 OprF [Pseudomonas resinovorans]
          Length = 340

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 31/162 (19%), Positives = 68/162 (41%), Gaps = 10/162 (6%)

Query: 21  ASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIP--- 77
           +++++           D  N     ++DK  D          + V   G      +    
Sbjct: 185 STKQEPAPAPVAEVCADSDNDGVCDNVDKCPD------TPANVTVDADGCPAVAEVVRVE 238

Query: 78  -VHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADV 136
                   +  ++++    ++ +A  +N++P+T   ++ HTDS+GT   N  +S+ RAD 
Sbjct: 239 LDVKFDFDKAKVKEESYGDIKNLADFMNQYPATTTTVEGHTDSVGTDAYNQKLSERRADA 298

Query: 137 IKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRI 178
           ++  L+ +    +  ++  G+    P+  N T  GR  N+R+
Sbjct: 299 VRDVLVDQYGVGSERVNAVGYGETRPVADNATADGRAVNRRV 340


>gi|107101208|ref|ZP_01365126.1| hypothetical protein PaerPA_01002240 [Pseudomonas aeruginosa PACS2]
          Length = 331

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 33/177 (18%), Positives = 72/177 (40%), Gaps = 7/177 (3%)

Query: 7   LSMFIMTTISGCGLASREKKKVFLH-KSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVV 65
           ++   +    G   A+   + V      +D D V        D   +          +  
Sbjct: 156 MAGLGVGFNFGGSKAAPAPEPVADVCSDSDNDGVCDNVDKCPDTPANVTVDANGCPAV-- 213

Query: 66  SRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKN 125
               +++   + V   F  +  +++     ++ +A  + ++PST   ++ HTDS+GT   
Sbjct: 214 ---AEVVRVQLDVKFDF-DKSKVKENSYADIKNLADFMKQYPSTSTTVEGHTDSVGTDAY 269

Query: 126 NLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           N  +S+ RA+ ++  L+         ++  G+    P+  N T  GR  N+R+E ++
Sbjct: 270 NQKLSERRANAVRDVLVNEYGVEGGRVNAVGYGESRPVADNATAEGRAINRRVEAEV 326


>gi|262042941|ref|ZP_06016085.1| conserved hypothetical protein [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|259039658|gb|EEW40785.1| conserved hypothetical protein [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
          Length = 568

 Score =  101 bits (252), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 32/121 (26%), Positives = 57/121 (47%)

Query: 65  VSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLK 124
           V R+   +     + +    +  L+      L      +   P  +I +  HTDS+G  K
Sbjct: 423 VQRVAPNVIRLDSMSLFDTGKWVLKPGSTKRLVSSLMDIKARPGWLIVVAGHTDSVGEEK 482

Query: 125 NNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
            N L+S +RA+ ++ ++   G   +   +V+G+    PI TN T  GR  N+R+EI + P
Sbjct: 483 ANQLLSLKRAESVRDWMRDTGDVPDSCFAVQGYGESRPIATNGTPEGRALNRRVEISLVP 542

Query: 185 R 185
           +
Sbjct: 543 Q 543


>gi|218710365|ref|YP_002417986.1| flagellar motor protein MotB [Vibrio splendidus LGP32]
 gi|218323384|emb|CAV19561.1| Flagellar motor protein [Vibrio splendidus LGP32]
          Length = 315

 Score =  101 bits (252), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 36/142 (25%), Positives = 68/142 (47%), Gaps = 6/142 (4%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV-SEVFLEKKFLPMLQLIATILNK 105
           ++  +   + ++    I V  +G  I   I    +F     FL+ KF P+++ +A ++  
Sbjct: 160 MESIKKALEREIDQGAIEVENLGQQIVIRIREKGAFPSGSAFLQPKFRPLVRQVAELVKD 219

Query: 106 FPSTVIAIQSHTDSI----GTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKY 161
            P   + I  HTD+        ++N  +S +RA  +   + +    S++ + VRG A   
Sbjct: 220 VPGI-VRISGHTDNQRLDSELYRSNWDLSSQRAVSVAQEMEKVRGFSHQRLRVRGMADTE 278

Query: 162 PIDTNDTKVGRQNNQRIEIQIF 183
           P++ NDT+  R  N+R+EI I 
Sbjct: 279 PVEPNDTEWQRSLNRRVEISIM 300


>gi|222053440|ref|YP_002535802.1| OmpA/MotB domain protein [Geobacter sp. FRC-32]
 gi|221562729|gb|ACM18701.1| OmpA/MotB domain protein [Geobacter sp. FRC-32]
          Length = 455

 Score =  101 bits (252), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 37/147 (25%), Positives = 73/147 (49%), Gaps = 5/147 (3%)

Query: 37  DIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSF-VSEVFLEKKFLPM 95
           D         LDK         + T +      D+ T  + +++ F   +  ++ K+   
Sbjct: 305 DSDGDGVADYLDKCPG----TPKGTKVKADGCPDLETLSMSINIQFVTGKNDIQPKYAGE 360

Query: 96  LQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVR 155
           ++ +A  + K+P+    I+ HTD++G+   N+ +SQ RA+ ++SYLI++   +   ++ +
Sbjct: 361 IKKVADYMQKYPTVKGVIEGHTDNVGSAAANMKLSQRRAEAVRSYLIKKHGIAADRLTAK 420

Query: 156 GFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           G+    PI  N T+ GRQ N+RI   +
Sbjct: 421 GYGMTRPIADNGTEAGRQQNRRITAVL 447


>gi|291519587|emb|CBK74808.1| Flagellar motor protein [Butyrivibrio fibrisolvens 16/4]
          Length = 313

 Score =  101 bits (252), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 39/171 (22%), Positives = 71/171 (41%), Gaps = 5/171 (2%)

Query: 19  GLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPV 78
              S E   V   K    +       +  ++ E++  +      + V    + +   I  
Sbjct: 129 SSESGEDISVAEAKEALEEAGASESENIAEEIEEKLALYGLQDQVEVDFNANYVMITING 188

Query: 79  HVSFV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTD----SIGTLKNNLLISQER 133
            + F   +  L +  L ++  ++ IL  +   +I I+ HTD    S GT +NN ++S  R
Sbjct: 189 ALLFNSGKAILTEDALEIVDNLSNILASYNQNIIEIEGHTDNVPMSSGTYENNDVLSMYR 248

Query: 134 ADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           A  +   + ++   +  +I   G     PI  N T  GR  N+R+EI+IF 
Sbjct: 249 ALYVADRIREKTNLNPAYIKSAGRGEYVPIADNSTAEGRARNRRVEIKIFN 299


>gi|117928060|ref|YP_872611.1| OmpA/MotB domain-containing protein [Acidothermus cellulolyticus
           11B]
 gi|117648523|gb|ABK52625.1| OmpA/MotB domain protein [Acidothermus cellulolyticus 11B]
          Length = 290

 Score =  101 bits (252), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 33/142 (23%), Positives = 60/142 (42%), Gaps = 7/142 (4%)

Query: 49  KAEDEFQMQLQDTGIV--VSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATILNKF 106
           + E   Q +     +   V   G +++      +    +  L      +L  IA +L   
Sbjct: 139 RIEAALQAKGLADSVKFRVETRGLIVSIVTDQVLFDTGKADLRPIGRQVLDAIAPVLRGL 198

Query: 107 PSTVIAIQSHTDSI----GTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYP 162
           P+  I+++ HTD++    G   +N  +S  RA  +  YL+         +S  G+A   P
Sbjct: 199 PN-DISVEGHTDNVPITGGPFASNWELSAIRATTVLRYLVSNDGLPEERMSATGYADTRP 257

Query: 163 IDTNDTKVGRQNNQRIEIQIFP 184
           +  NDT   RQ N+R++I +  
Sbjct: 258 LVPNDTPEHRQQNRRVDIVVLS 279


>gi|94501021|ref|ZP_01307545.1| peptidoglycan-associated lipoprotein, putative [Oceanobacter sp.
           RED65]
 gi|94426768|gb|EAT11752.1| peptidoglycan-associated lipoprotein, putative [Oceanobacter sp.
           RED65]
          Length = 180

 Score =  101 bits (252), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 31/177 (17%), Positives = 64/177 (36%), Gaps = 9/177 (5%)

Query: 4   ELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGI 63
           +L     +   ++GC  +     +    ++       +    S +           +T  
Sbjct: 8   KLFAVSALSLVMAGCASSGGTTDEAATTETEQQQSETQAVPESPNVD--------VNTDA 59

Query: 64  VVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTL 123
                 +       V         L  +F  +L   A  L   P   + ++ H D  GT+
Sbjct: 60  QAEAAQNNPLLDQTVVYFGFDRSELRPEFKDVLNAHAEYLVANPQASLTVEGHCDERGTV 119

Query: 124 KNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEI 180
           + NL + + RA+ +K YLI +GV+ ++  +V  +  + P      +     N+R E+
Sbjct: 120 EYNLALGERRAETVKRYLIVQGVAPSQLETVS-YGEERPAVMGSDESAWSKNRRAEL 175


>gi|121603984|ref|YP_981313.1| OmpA/MotB domain-containing protein [Polaromonas naphthalenivorans
           CJ2]
 gi|120592953|gb|ABM36392.1| OmpA/MotB domain protein [Polaromonas naphthalenivorans CJ2]
          Length = 220

 Score =  101 bits (252), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 47/215 (21%), Positives = 85/215 (39%), Gaps = 35/215 (16%)

Query: 2   IKELGL-----SMFIMTTISGCGLASREKKKVF----------------LHKSNDTDIVN 40
           ++++ +     +   M  +SGC   S  ++                    + S       
Sbjct: 1   MRKVFITTVTCAALAMAGLSGCANMSETQQGTAKGAGIGALAGAVLGAATNGSKGAATGA 60

Query: 41  KR-----------FGSSLDKAEDEFQMQLQDTGIVVSR-IGDMITCYIPVHV-SFVSEVF 87
                        +   +   +   +     TG+ VS+   + +   IP  V   V    
Sbjct: 61  VLGGALGAGGGYIWSKKMQDQKIAMERATAGTGVAVSQTQDNRLKLDIPSDVSFDVGRSA 120

Query: 88  LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVS 147
           ++  F P+L   AT LN+ P T ++I  HTDS G+   N  +S +RA+  + YL+ R   
Sbjct: 121 IKSNFAPVLTNFATSLNQNPITTVSIIGHTDSTGSDSVNNPLSVDRANAARDYLVGR-GV 179

Query: 148 SNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
           + + I+  G   + PI  N +  GR  N+R+EI +
Sbjct: 180 AAQRIATDGRGSREPIADNSSAQGRAKNRRVEIYV 214


>gi|238924159|ref|YP_002937675.1| hypothetical protein EUBREC_1797 [Eubacterium rectale ATCC 33656]
 gi|238875834|gb|ACR75541.1| hypothetical protein EUBREC_1797 [Eubacterium rectale ATCC 33656]
          Length = 275

 Score =  101 bits (252), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 28/171 (16%), Positives = 66/171 (38%), Gaps = 7/171 (4%)

Query: 19  GLASREKKKVFLHKSNDTDIVNKRFGSSLDKA-EDEFQMQLQDTGIVVSRIGDMITCYIP 77
                  +    +     + +       + +  E + +       + V      +   + 
Sbjct: 94  STTESTTEGDDKNAEEQYEQMELSESEKMSEQIEKQLENTSLQDAVEVDFNAQYVQLSLN 153

Query: 78  VHVSFV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIG-----TLKNNLLISQ 131
             + F   +  + ++  P++  I++IL  +   +I I+ HTD++        ++N ++S 
Sbjct: 154 GALLFESGKADVMEEAYPVVNKISSILAAYQDNLIEIEGHTDNVPVSSRSKYESNDVLSM 213

Query: 132 ERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
            RA  + +Y+      +   I   G     P+  N T  GR  N+R+EI++
Sbjct: 214 YRALSVANYIRDNTSLNPAHIKSSGRGDYDPVADNSTPEGRARNRRVEIKV 264


>gi|5081413|gb|AAD39368.1|AF117973_1 outer membrane protein OprF [Pseudomonas stutzeri DSM 4166]
          Length = 323

 Score =  101 bits (252), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 26/116 (22%), Positives = 58/116 (50%), Gaps = 1/116 (0%)

Query: 64  VVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTL 123
                 +++   + V   F  +  + ++    ++ +A  + ++P T   ++ HTDS+GT 
Sbjct: 208 EPEPAPEVVRVELDVKFDF-DKSRVREESYSDIKNLADFMQQYPQTTTVVEGHTDSVGTD 266

Query: 124 KNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIE 179
           + N  +S+ RA+ +++ L+         ++  G+    P+  N T+ GRQ N+R+E
Sbjct: 267 QYNQRLSERRAEAVRNVLVNEYGVQGNRVNSVGYGESRPVADNSTEEGRQINRRVE 322


>gi|332978756|gb|EGK15448.1| outer membrane porin OprF [Psychrobacter sp. 1501(2011)]
          Length = 304

 Score =  101 bits (252), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 32/130 (24%), Positives = 59/130 (45%), Gaps = 1/130 (0%)

Query: 53  EFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIA 112
             + Q +   I V  + + +T  +   +    +  ++ ++L  L   A  + K+  T + 
Sbjct: 173 APRPQPKPQPISVPVLEEKVTINLQ-VLFDNDKSVVKPQYLRDLSTAAEFMQKYSDTTVV 231

Query: 113 IQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGR 172
           I+ HTDS  +   N+ +S+ RA  +K   + +   S   I   G+    PI +N T  GR
Sbjct: 232 IEGHTDSNASDAYNIALSKRRAHAVKEVFVNQYGISPARIQAVGYGESRPIASNATAEGR 291

Query: 173 QNNQRIEIQI 182
           Q N+R+   I
Sbjct: 292 QMNRRVVAVI 301


>gi|312131420|ref|YP_003998760.1| ompa/motb domain protein [Leadbetterella byssophila DSM 17132]
 gi|311907966|gb|ADQ18407.1| OmpA/MotB domain protein [Leadbetterella byssophila DSM 17132]
          Length = 532

 Score =  101 bits (252), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 33/130 (25%), Positives = 65/130 (50%), Gaps = 1/130 (0%)

Query: 56  MQLQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQS 115
            ++    +  + I       +       ++  LEK+    L  +  +L K P+  I +Q 
Sbjct: 404 KEITGQDLETAPIKAGTAITLNNVFFEFAKATLEKESFLELDRLIALLVKNPNMAIEVQG 463

Query: 116 HTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNN 175
           HTD++G+   N+ +SQ+RAD +K+Y +++   +   I+  GF    P+ +N+T  G+  N
Sbjct: 464 HTDNVGSDNANMRLSQQRADAVKAYFVEK-GIATDRITSTGFGESRPVASNETTEGQAKN 522

Query: 176 QRIEIQIFPR 185
           +R+E  I  +
Sbjct: 523 RRVEFVILRK 532


>gi|289577780|ref|YP_003476407.1| OmpA/MotB domain protein [Thermoanaerobacter italicus Ab9]
 gi|289527493|gb|ADD01845.1| OmpA/MotB domain protein [Thermoanaerobacter italicus Ab9]
          Length = 239

 Score =  101 bits (252), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 27/156 (17%), Positives = 53/156 (33%), Gaps = 6/156 (3%)

Query: 34  NDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV-SEVFLEKKF 92
                     G    + E   +       +        +   +   + F      +  + 
Sbjct: 73  QGNSGDKNSLGEIEKQLEGFVKENNLQGMVTSYIDERGLVISLQDTILFDLGSADVHPEE 132

Query: 93  LPMLQLIATILNKFPSTVIAIQSHTDSIGTLKN----NLLISQERADVIKSYLIQRGVSS 148
             +L  I  +L   P+  I ++  TD +    N    N  +S  RA  +   L+      
Sbjct: 133 KDVLIKIGNMLKTLPN-HIRVEGFTDDLPIHNNKFDSNWELSVIRATNVVKILVHEAGVD 191

Query: 149 NRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
            + IS  G+    P+  ND++  R+ N+R++I I  
Sbjct: 192 PKKISAVGYGEYRPVVPNDSEEHRRLNRRVDIVIMN 227


>gi|91215766|ref|ZP_01252736.1| OmpA family protein [Psychroflexus torquis ATCC 700755]
 gi|91186232|gb|EAS72605.1| OmpA family protein [Psychroflexus torquis ATCC 700755]
          Length = 231

 Score =  101 bits (252), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 47/220 (21%), Positives = 81/220 (36%), Gaps = 36/220 (16%)

Query: 3   KELGLSMFIMTTISGCGLASREKKKV--------------FLHKSNDTDIVNKR------ 42
           K LGL + I    S C       K                 +  +N  D  N        
Sbjct: 7   KILGLLLAIAFLFSSCEAVKNTNKTQRVGAIGAIGGAVIGGVIGNNTGDGDNSVLGAIIG 66

Query: 43  ----------FGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVH---VSFVSEVFLE 89
                      G+++DK   E + ++   G  V+R+G+ I      +       ++  +E
Sbjct: 67  GVVGGAAGAYIGNTMDKQAKEIEEEIP--GAEVTRVGEGINVTFDENSGVYFTTNKSNIE 124

Query: 90  KKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSN 149
            K    L  +  I  K+P T I ++ HTDS G+   N+ +S+ RA  +    +     S+
Sbjct: 125 GKSEISLLKLIGIFQKYPKTNIIVEGHTDSTGSDSYNMDLSKRRAQSVTD-YLSNNGISS 183

Query: 150 RFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGNIK 189
             I    +  + P   N +   R  N+R+E+ I     +K
Sbjct: 184 SRIKTNWYGEEQPKFDNTSPEERSKNRRVELAIVANEELK 223


>gi|319779310|ref|YP_004130223.1| Outer membrane protein A precursor [Taylorella equigenitalis MCE9]
 gi|317109334|gb|ADU92080.1| Outer membrane protein A precursor [Taylorella equigenitalis MCE9]
          Length = 188

 Score =  101 bits (252), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 38/187 (20%), Positives = 67/187 (35%), Gaps = 7/187 (3%)

Query: 1   MIKELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQM---- 56
           M  +  L++ +  + +G   A      V              + +               
Sbjct: 1   MTSKFALAIALAFS-AGVASAQTVDNWVSDFGDPVVSDFGDCWQNDFWTPATALPECGGV 59

Query: 57  QLQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSH 116
                        + +T           +  L+ +   +L  IA  +       +    H
Sbjct: 60  TEPSAPAAQPITANKVTFNA-DTFFDFDKSSLKPEGRTVLDQIAEQVKLLTLESLITVGH 118

Query: 117 TDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQ 176
           TDSIGT   N  +S+ RA  +K+YLI +GV + + I   G     PI  N T+ GR  N+
Sbjct: 119 TDSIGTNAYNQKLSERRAATVKNYLIDKGVPAEQII-ASGRGETQPIADNRTREGRAQNR 177

Query: 177 RIEIQIF 183
           R++I++ 
Sbjct: 178 RVDIEMV 184


>gi|299137972|ref|ZP_07031152.1| OmpA/MotB domain protein [Acidobacterium sp. MP5ACTX8]
 gi|298599902|gb|EFI56060.1| OmpA/MotB domain protein [Acidobacterium sp. MP5ACTX8]
          Length = 513

 Score =  101 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 26/143 (18%), Positives = 63/143 (44%), Gaps = 2/143 (1%)

Query: 40  NKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLI 99
            ++  +      ++ + QL ++ +  S     +   +   +   ++  L+      L  +
Sbjct: 360 AQKSEADASAVREKLRAQL-NSVLATSESARGLIVNMSDVLFDTAKFTLKPDTKVSLAKV 418

Query: 100 ATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAY 159
           ATIL  +P   + ++ +TDS+G  + N  +S+ RA+ +    + +       ++  G+  
Sbjct: 419 ATILQLYPGLKVQVEGYTDSVGGDEYNQKLSENRANAVHD-FLVQNGVPAANVTAAGYGK 477

Query: 160 KYPIDTNDTKVGRQNNQRIEIQI 182
             P+  N T  GR  N+R+ + +
Sbjct: 478 NKPVADNGTAAGRAQNRRVNLVV 500


>gi|213963452|ref|ZP_03391706.1| OmpA family protein [Capnocytophaga sputigena Capno]
 gi|213953860|gb|EEB65188.1| OmpA family protein [Capnocytophaga sputigena Capno]
          Length = 454

 Score =  101 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 43/180 (23%), Positives = 79/180 (43%), Gaps = 14/180 (7%)

Query: 17  GCGLASREK--------KKVFLHKSNDT----DIVNKRFGSSLDKAEDEFQMQLQDTGIV 64
           GC     +         K V   K N+     D          D+  +E      +    
Sbjct: 275 GCPDTDGDGVADNVDQCKDVAGPKENNGCPWPDTDGDGVLDKDDECPEEAGPASNNGCPE 334

Query: 65  VSRIGDMITCYIPVHVSFV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTL 123
           V++            + F  ++  +  +   +L  I  +LNK+ +   +I+ +TD+ G  
Sbjct: 335 VTQEVQTQLNSFAKTILFDVNKATIRPESATVLNNIVNVLNKYKNAKFSIEGYTDTSGNK 394

Query: 124 KNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIF 183
             N  +S++RA  +K+YLI +G+   R ++ +GF  + PI +N TK GR+ N+R+EI + 
Sbjct: 395 AKNQKLSEDRAYSVKAYLIDKGIDQAR-LTAKGFGPEKPIASNKTKKGRELNRRVEINLV 453


>gi|28898406|ref|NP_798011.1| putative outer membrane protein [Vibrio parahaemolyticus RIMD
           2210633]
 gi|28806623|dbj|BAC59895.1| putative outer membrane protein [Vibrio parahaemolyticus RIMD
           2210633]
          Length = 214

 Score =  101 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 29/198 (14%), Positives = 73/198 (36%), Gaps = 11/198 (5%)

Query: 1   MIKELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQD 60
           ++K + + + +   ++ C  +S    +     +   D          D   ++ +     
Sbjct: 9   IMKNITI-IALSLVVAACSSSSDRGDEYDYIDTPIADQWADHQDDDSDGVINQ-RDLCPG 66

Query: 61  T--GIVVSRIGDMITCYIPVH-----VSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAI 113
           T  G  +   G               +       +   F   ++ ++  L ++PST I +
Sbjct: 67  TPLGAEIDNDGCGSYANSSQQMQIRVLFANDSDEINPVFAKQIRELSDFLKEYPSTSIEL 126

Query: 114 QSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQ 173
           Q +    G  ++NL +S+ RA+ +    + +   +   +++ G+       T   +V   
Sbjct: 127 QGYASRTGGSEHNLDLSKRRAENV-RKALLQNGITPDRVTIVGYGDTVLATTGTDEVSHA 185

Query: 174 NNQRIEIQIFP-RGNIKK 190
            N+R+   +   +G +KK
Sbjct: 186 LNRRVTATVVGHKGEVKK 203


>gi|167618284|ref|ZP_02386915.1| ompA family protein [Burkholderia thailandensis Bt4]
          Length = 171

 Score =  101 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 37/135 (27%), Positives = 66/135 (48%), Gaps = 3/135 (2%)

Query: 50  AEDEFQMQLQDTGIVVSRIGDM-ITCYIPVHVSF-VSEVFLEKKFLPMLQLIATILNKFP 107
            +++     Q TG  V+   D  +   +P  V+F   +  +   F P+L  +AT LN+ P
Sbjct: 31  IKNKLAPSAQQTGTQVTEQPDGSLKLNVPSSVTFATDQYAVTPAFTPLLNDLATTLNQNP 90

Query: 108 STVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTND 167
               ++  +TDS G+  +N  +SQ RA  + +  + +   +   +S +G     PI  N 
Sbjct: 91  QITASVVGYTDSTGSAAHNQTLSQNRAQSVVN-ALAQRGVAATRLSAQGMGASNPIADNA 149

Query: 168 TKVGRQNNQRIEIQI 182
           T+ GR  N+R+EI +
Sbjct: 150 TEAGRAQNRRVEIYL 164


>gi|319793387|ref|YP_004155027.1| peptidoglycaN-associated lipoprotein [Variovorax paradoxus EPS]
 gi|315595850|gb|ADU36916.1| peptidoglycan-associated lipoprotein [Variovorax paradoxus EPS]
          Length = 172

 Score =  101 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 34/181 (18%), Positives = 67/181 (37%), Gaps = 12/181 (6%)

Query: 1   MIKELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQD 60
           M+K    S+ I+  I+GC   ++   +  +     T        S++     +       
Sbjct: 1   MLKRTIYSLAIVALIAGCSSGTKLN-ETPVTDGRGTAGQQGGGASTVTPVNADQSAATAQ 59

Query: 61  TGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSI 120
             + V+RI                   ++ +F  ++   A  L   P   I+I+ HTD  
Sbjct: 60  GPVGVARI----------VYFDYDSYTVKPEFQSIVDGHARFLKSAPQRRISIEGHTDER 109

Query: 121 GTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEI 180
           G  + NL + Q+RA+ ++   +     ++  I    F  + P      +     N+R EI
Sbjct: 110 GGREYNLALGQKRAEAVRR-ALTLLGVNDSQIEAVSFGKEKPAVQGGGEEAWAQNRRAEI 168

Query: 181 Q 181
           +
Sbjct: 169 R 169


>gi|5081415|gb|AAD39370.1|AF117975_1 outer membrane protein OprF [Pseudomonas stutzeri ZoBell]
          Length = 321

 Score =  101 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 26/116 (22%), Positives = 58/116 (50%), Gaps = 1/116 (0%)

Query: 64  VVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTL 123
                 +++   + V   F  +  + ++    ++ +A  + ++P T   ++ HTDS+GT 
Sbjct: 206 EPEPAPEVVRVELDVKFDF-DKSRVREESYSDIKNLADFMQQYPQTTTTVEGHTDSVGTD 264

Query: 124 KNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIE 179
           + N  +S+ RA+ +++ L+         ++  G+    P+  N T+ GRQ N+R+E
Sbjct: 265 QYNQRLSERRAEAVRNVLVNEHGVQGNRVNSVGYGESRPVADNSTEEGRQINRRVE 320


>gi|148549426|ref|YP_001269528.1| OmpA/MotB domain-containing protein [Pseudomonas putida F1]
 gi|148513484|gb|ABQ80344.1| OmpA/MotB domain protein [Pseudomonas putida F1]