RPSBLAST alignment for GI: 254780953 and conserved domain: pfam00691

>gnl|CDD|144333 pfam00691, OmpA, OmpA family. The Pfam entry also includes MotB and related proteins which are not included in the Prosite family. Length = 97
 Score = 71.3 bits (175), Expect = 2e-13
 Identities = 30/89 (33%), Positives = 45/89 (50%), Gaps = 2/89 (2%)

Query: 88  LEKKFLPMLQLIATIL-NKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGV 146
           L  +    L  +A +L        I I+ HTDS G+ K N  +S  RA  + +YL+  G+
Sbjct: 9   LTAEARETLDRLAEVLKAPELKIAIKIEGHTDSRGSAKYNWELSARRAQAVANYLVNHGI 68

Query: 147 SSNRFISVRGFAYKYPIDTNDTKVGRQNN 175
             +R ISV G+    P+ +ND+  GR  N
Sbjct: 69  PPSR-ISVEGYGESQPLASNDSDEGRAKN 96