RPSBLAST alignment for GI: 254780953 and conserved domain: TIGR03789

>gnl|CDD|163501 TIGR03789, pdsO, proteobacterial sortase system OmpA family protein. A newly defined histidine kinase (TIGR03785) and response regulator (TIGR03787) gene pair occurs exclusively in Proteobacteria, mostly of marine origin, nearly all of which contain a subfamily 6 sortase (TIGR03784) and its single dedicated target protein (TIGR03788) adjacent to to the sortase. This protein family shows up in only in those species with the histidine kinase/response regulator gene pair, and often adjacent to that pair. It belongs to the OmpA protein family (pfam00691). Its function is unknown. We assign the gene symbol pdsO, for Proteobacterial Dedicated Sortase system OmpA family protein. Length = 239
 Score = 52.5 bits (126), Expect = 7e-08
 Identities = 22/81 (27%), Positives = 43/81 (53%), Gaps = 2/81 (2%)

Query: 88  LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVS 147
           +E  F P L  +AT++ + P   + +  + D  G  + N  +S++R   ++SYLI++GV 
Sbjct: 146 IEPHFQPQLDEVATLMKQSPELKLDLSGYADRRGDSQYNQALSEQRVLEVRSYLIKQGVD 205

Query: 148 SNRFISVRGFAYKYPI-DTND 167
             R ++ + F    P+ D  +
Sbjct: 206 EAR-LTTQAFGESAPLKDEQE 225