RPSBLAST alignment for GI: 254780953 and conserved domain: PRK09040

>gnl|CDD|181620 PRK09040, PRK09040, hypothetical protein; Provisional. Length = 214
 Score = 36.5 bits (85), Expect = 0.004
 Identities = 19/61 (31%), Positives = 31/61 (50%), Gaps = 1/61 (1%)

Query: 125 NNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
           +N  +S +RA  +   LI  GV ++   +   F  + P+ +N    GR  N+R+EI   P
Sbjct: 145 DNWELSAQRALTVTRALIDAGVPASSVFAA-AFGSEQPVASNADDEGRAKNRRVEIAPVP 203

Query: 185 R 185
           R
Sbjct: 204 R 204