RPSBLAST alignment for GI: 254780953 and conserved domain: PRK09967

>gnl|CDD|182172 PRK09967, PRK09967, putative outer membrane lipoprotein; Provisional. Length = 160
 Score = 45.4 bits (107), Expect = 8e-06
 Identities = 28/91 (30%), Positives = 43/91 (47%), Gaps = 3/91 (3%)

Query: 97  QLIATILNKFPSTVIA---IQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFIS 153
           Q I T+  K  ST +    +  HTD+ G    N  +S +RA+V+       G      ++
Sbjct: 69  QQIQTMAAKLASTGLTHARMDGHTDNYGEDSYNEGLSLKRANVVADAWAMGGQIPRSNLT 128

Query: 154 VRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP 184
            +G   KYPI +N T  GR  N+R+ + I  
Sbjct: 129 TQGLGKKYPIASNKTAQGRAENRRVAVVITT 159