RPSBLAST alignment for GI: 254780953 and conserved domain: PRK10808

>gnl|CDD|182748 PRK10808, PRK10808, outer membrane protein A; Reviewed. Length = 351
 Score = 47.8 bits (114), Expect = 2e-06
 Identities = 22/76 (28%), Positives = 41/76 (53%), Gaps = 10/76 (13%)

Query: 116 HTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPI--DTNDTKVGRQ 173
           +TD IG+   N  +S++RA  +  YL+ +G+ +++ IS RG     P+  +T D    R 
Sbjct: 265 YTDRIGSDAYNQGLSEKRAQSVVDYLVSKGIPADK-ISARGMGKSNPVTGNTCDNVKPRA 323

Query: 174 N-------NQRIEIQI 182
                   ++R+EI++
Sbjct: 324 ALIDCLAPDRRVEIEV 339