RPSBLAST alignment of GI: 254780953 and MMDB domain: 2hqs_H_

>2hqs_H (H:) Peptidoglycan-associated lipoprotein; TOLB, PAL, TOL, transport protein/lipoprotein complex; 1.50A {Escherichia coli}Length = 118
 Score = 75.5 bits (185), Expect = 4e-15
 Identities = 25/98 (25%), Positives = 43/98 (43%), Gaps = 1/98 (1%)

Query: 88  LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVS 147
           +   F  ML   A  L   PS  + ++ H D  GT + N+ + + RA+ +K YL  +GVS
Sbjct: 17  IRSDFAQMLDAHANFLRSNPSYKVTVEGHADERGTPEYNISLGERRANAVKMYLQGKGVS 76

Query: 148 SNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPR 185
           +   IS+  +  + P      +     N+R  +     
Sbjct: 77  A-DQISIVSYGKEKPAVLGHDEAAYSKNRRAVLVYLEH 113