RPSBLAST alignment of GI: 254780953 and MMDB domain: 2k1s_A_

>2k1s_A (A:) Inner membrane lipoprotein YIAD; abbababab, OMPA, alpha beta, palmitate, transmembrane, structural genomics, PSI-2; NMR {Escherichia coli K12}Length = 149
 Score = 91.7 bits (227), Expect = 6e-20
 Identities = 47/140 (33%), Positives = 79/140 (56%), Gaps = 2/140 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVS-EVFLEKKFLPMLQLIATILNK 105
           +D  E + + +++ TG+ V+R GD I   +P +V+F S    L+      L  +A +L +
Sbjct: 3   MDVQEAKLRDKMRGTGVSVTRSGDNIILNMPNNVTFDSSSATLKPAGANTLTGVAMVLKE 62

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +P T + +  +TDS G    N+ +SQ+RAD + S LI +GV ++R I  +G     PI +
Sbjct: 63  YPKTAVNVIGYTDSTGGHDLNMRLSQQRADSVASALITQGVDASR-IRTQGLGPANPIAS 121

Query: 166 NDTKVGRQNNQRIEIQIFPR 185
           N T  G+  N+R+EI + P 
Sbjct: 122 NSTAEGKAQNRRVEITLSPL 141