RPSBLAST alignment of GI: 254780953 and MMDB domain: 3cyp_B_

>3cyp_B (B:) Chemotaxis protein MOTB; bacterial flagellar motor, peptidoglycan binding, bacterial flagellum, flagellar rotation, inner membrane, membrane; 1.60A {Helicobacter pylori} PDB: 3cyq_B*Length = 138
 Score = 74.3 bits (182), Expect = 1e-14
 Identities = 27/113 (23%), Positives = 47/113 (41%), Gaps = 6/113 (5%)

Query: 78  VHVSFVSEVFLEKKFLPMLQLIATILNKFP-STVIAIQSHTDSI----GTLKNNLLISQE 132
                 +   + +  +  ++ IA I+ K P    I ++  TD         K++  ++  
Sbjct: 5   FTFENATSDAINQDMMLYIERIAKIIQKLPKRVHINVRGFTDDTPLVKTRFKSHYELAAN 64

Query: 133 RADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPR 185
           RA  +   LIQ GV+ N+ +S   +    PI  ND+   R  N R+EI     
Sbjct: 65  RAYRVMKVLIQYGVNPNQ-LSFSSYGSTNPIAPNDSLENRMKNNRVEIFFSTD 116