RPSBLAST alignment of GI: 254780953 and protein with PDBid: 1r1m

>1r1m_A Outer membrane protein class 4; 1.90A {Neisseria meningitidis} SCOP: d.79.7.1 Length = 164
 Score = 82.4 bits (203), Expect = 6e-17
 Identities = 25/118 (21%), Positives = 48/118 (40%), Gaps = 8/118 (6%)

Query: 75  YIPVHVSFVSEVF-------LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNL 127
           Y+   +S  ++         L  +    L+++A  L++     + ++ HTD +G+ K N 
Sbjct: 6   YVDETISLSAKTLFGFDKDSLRAEAQDNLKVLAQRLSRTNIQSVRVEGHTDFMGSDKYNQ 65

Query: 128 LISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPR 185
            +S+ RA V+ + L+  GV  +R IS  G        T   +           +   R
Sbjct: 66  ALSERRAYVVANNLVSNGVPVSR-ISAVGLGESQAQMTQVCEAEVAKLGAKVSKAKKR 122