RPSBLAST alignment of GI: 254780953 and protein with PDBid: 3khn

>3khn_A MOTB protein, putative; structural genomics, OMPA-like domain, PSI-2, protein structure initiative; 2.03A {Desulfovibrio vulgaris str} Length = 174
 Score = 53.0 bits (126), Expect = 4e-08
 Identities = 26/149 (17%), Positives = 48/149 (32%), Gaps = 9/149 (6%)

Query: 46  SLDKAEDEFQMQLQDTG----IVVSRIGDMITCYIPVHVSFVS-EVFLEKKFLPMLQLIA 100
           +  +  +E +      G    I       +IT  +P  V F    V L      +L  + 
Sbjct: 15  AQRQTYNEMRTYFTVNGVEGVIGAVFDEGVITLRVPSEVLFAPGAVELAPGADRVLATLK 74

Query: 101 TILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRF----ISVRG 156
            +  +     I I+  TD +    N           ++S  + R           ++  G
Sbjct: 75  DLFIRRREQNINIKGFTDDVQPSANARFKDNWEVSALRSVNVLRYFLGAGIEPARLTATG 134

Query: 157 FAYKYPIDTNDTKVGRQNNQRIEIQIFPR 185
                P+  N +   R  N+R+E  +  R
Sbjct: 135 LGELDPLFPNTSDENRARNRRVEFVLERR 163