RPS-BLAST 2.2.22 [Sep-27-2009]

Database: pdb70 
           24,244 sequences; 5,693,230 total letters

Searching..................................................done

Query= gi|254780953|ref|YP_003065366.1| OmpA/MotB [Candidatus
Liberibacter asiaticus str. psy62]
         (190 letters)



>3ldt_A Outer membrane protein, OMPA family protein; OMPA-like domain,
           PSI-II, NYSGXRC, structural genomics, protein structure
           initiative; 2.30A {Legionella pneumophila}
          Length = 169

 Score =  115 bits (288), Expect = 9e-27
 Identities = 38/142 (26%), Positives = 62/142 (43%), Gaps = 3/142 (2%)

Query: 44  GSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVF-LEKKFLPMLQLIATI 102
               D      +  LQ   I     GD  T  IP    F+     L +   P L  +  +
Sbjct: 21  SIYRDSKRKIIR-DLQKQDIQYVEYGDTRTLIIPTDKYFMFSSPRLNEICYPGLNNVIRL 79

Query: 103 LNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYP 162
           LN +P + I +   TD++G+  +   +SQ +A+ + ++L   G+++ R +   G+  K  
Sbjct: 80  LNFYPQSTIYVAGFTDNVGSRSHKRKLSQAQAETMMTFLWANGIAAKR-LKAEGYGDKNA 138

Query: 163 IDTNDTKVGRQNNQRIEIQIFP 184
           I  N    G   N+RIEIQ F 
Sbjct: 139 ISDNAIIHGSAQNRRIEIQWFT 160


>2kgw_A Outer membrane protein A; OMPA- like, cell membrane, transmembrane;
           NMR {Mycobacterium tuberculosis}
          Length = 129

 Score = 98.7 bits (246), Expect = 7e-22
 Identities = 30/95 (31%), Positives = 49/95 (51%), Gaps = 1/95 (1%)

Query: 88  LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVS 147
           L      +L  +A  L   P   + I  +TD+ G+   N+ +S +RA ++  YL+ RGV+
Sbjct: 35  LIPADYEILNRVADKLKACPDARVTINGYTDNTGSEGINIPLSAQRAKIVADYLVARGVA 94

Query: 148 SNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
            +  I+  G     PI +N T  GR  N+R+EI +
Sbjct: 95  GDH-IATVGLGSVNPIASNATPEGRAKNRRVEIVV 128


>2zf8_A MOTY, component of sodium-driven polar flagellar motor; beta
           barrel, 2-layer sandwich, flagellum, structural protein;
           2.85A {Vibrio alginolyticus}
          Length = 278

 Score = 96.5 bits (240), Expect = 3e-21
 Identities = 24/96 (25%), Positives = 47/96 (48%), Gaps = 2/96 (2%)

Query: 88  LEKKFLPMLQLIATILNKFPS-TVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGV 146
           L K     L  IA  +       ++ + ++TDS      +  +S+ RA+ ++ Y    G+
Sbjct: 173 LTKASKKRLSQIADYIRHNQDIDLVLVATYTDSTDGKSASQSLSERRAESLRDYFQSLGL 232

Query: 147 SSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
             +R I V+G+  + PI  N + +G+  N+R+ I +
Sbjct: 233 PEDR-IQVQGYGKRRPIADNGSPIGKDKNRRVVISL 267


>3oon_A Outer membrane protein (TPN50); protein structure initiative,
           PSI-2, structural genomics, MI center for structural
           genomics, MCSG; 1.79A {Borrelia burgdorferi}
          Length = 123

 Score = 94.0 bits (234), Expect = 2e-20
 Identities = 33/124 (26%), Positives = 56/124 (45%), Gaps = 4/124 (3%)

Query: 60  DTGIVVSRIGDMITCYIPVHVSFVSEVF-LEKKFLPMLQLIATILNKFPSTVIAIQSHTD 118
           +  I V +    I   +   + F    F + +K    + LIA +L KF    I I+ HT+
Sbjct: 1   NAAIEVEKNNKGIN--LSFDIEFYPNSFQILQKEYKKIDLIAKLLEKFKKNNILIEGHTE 58

Query: 119 SIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRI 178
             G  +    +S++RA  I +YLI+  V     I  +G+  + P     +   +  N+R+
Sbjct: 59  QFGLEEEMHELSEKRARAIGNYLIKMKVKDKDQILFKGWGSQKPKYPKSSP-LKAKNRRV 117

Query: 179 EIQI 182
           EI I
Sbjct: 118 EITI 121


>3cyp_B Chemotaxis protein MOTB; bacterial flagellar motor, peptidoglycan
           binding, bacterial flagellum, flagellar rotation, inner
           membrane, membrane; 1.60A {Helicobacter pylori} PDB:
           3cyq_B*
          Length = 138

 Score = 86.9 bits (215), Expect = 3e-18
 Identities = 29/105 (27%), Positives = 48/105 (45%), Gaps = 6/105 (5%)

Query: 88  LEKKFLPMLQLIATILNKFPSTV-IAIQSHTDSI----GTLKNNLLISQERADVIKSYLI 142
           + +  +  ++ IA I+ K P  V I ++  TD         K++  ++  RA  +   LI
Sbjct: 15  INQDMMLYIERIAKIIQKLPKRVHINVRGFTDDTPLVKTRFKSHYELAANRAYRVMKVLI 74

Query: 143 QRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGN 187
           Q GV+ N+ +S   +    PI  ND+   R  N R+EI      N
Sbjct: 75  QYGVNPNQ-LSFSSYGSTNPIAPNDSLENRMKNNRVEIFFSTDAN 118


>2k1s_A Inner membrane lipoprotein YIAD; abbababab, OMPA, alpha beta,
           palmitate, transmembrane, structural genomics, PSI-2;
           NMR {Escherichia coli K12}
          Length = 149

 Score = 84.5 bits (208), Expect = 1e-17
 Identities = 46/139 (33%), Positives = 78/139 (56%), Gaps = 2/139 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVS-EVFLEKKFLPMLQLIATILNK 105
           +D  E + + +++ TG+ V+R GD I   +P +V+F S    L+      L  +A +L +
Sbjct: 3   MDVQEAKLRDKMRGTGVSVTRSGDNIILNMPNNVTFDSSSATLKPAGANTLTGVAMVLKE 62

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +P T + +  +TDS G    N+ +SQ+RAD + S LI +GV ++R    +G     PI +
Sbjct: 63  YPKTAVNVIGYTDSTGGHDLNMRLSQQRADSVASALITQGVDASRIR-TQGLGPANPIAS 121

Query: 166 NDTKVGRQNNQRIEIQIFP 184
           N T  G+  N+R+EI + P
Sbjct: 122 NSTAEGKAQNRRVEITLSP 140


>1r1m_A Outer membrane protein class 4; 1.90A {Neisseria meningitidis}
           SCOP: d.79.7.1
          Length = 164

 Score = 82.4 bits (203), Expect = 6e-17
 Identities = 25/118 (21%), Positives = 48/118 (40%), Gaps = 8/118 (6%)

Query: 75  YIPVHVSFVSEVF-------LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNL 127
           Y+   +S  ++         L  +    L+++A  L++     + ++ HTD +G+ K N 
Sbjct: 6   YVDETISLSAKTLFGFDKDSLRAEAQDNLKVLAQRLSRTNIQSVRVEGHTDFMGSDKYNQ 65

Query: 128 LISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPR 185
            +S+ RA V+ + L+  GV  +R IS  G        T   +           +   R
Sbjct: 66  ALSERRAYVVANNLVSNGVPVSR-ISAVGLGESQAQMTQVCEAEVAKLGAKVSKAKKR 122


>2zov_A Chemotaxis protein MOTB; 2-layer sandwich, bacterial flagellum,
           cell projection, flagellar rotation, inner membrane,
           membrane; 2.00A {Salmonella typhimurium}
          Length = 210

 Score = 75.5 bits (185), Expect = 7e-15
 Identities = 29/145 (20%), Positives = 56/145 (38%), Gaps = 15/145 (10%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVS-EVFLEKKFLPMLQLIATILNK 105
           L       ++ L   G+ +  I D           F +    +E     +L+ IA +LN 
Sbjct: 46  LRALRPHLKIDLVQEGLRIQ-IIDS-----QNRPMFKTGSAEVEPYMRDILRAIAPVLNG 99

Query: 106 FPSTVIAIQSHTDSIGTLK-----NNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYK 160
            P+  I++  HTD           +N  +S +RA+  +  L+  G+ + + + V G A  
Sbjct: 100 IPNR-ISLAGHTDDFPYANGEKGYSNWELSADRANASRRELVAGGLDNGKVLRVVGMAAT 158

Query: 161 YPIDTNDTKVGRQNNQRIEIQIFPR 185
             +           N+RI + +  +
Sbjct: 159 MRLSDRGP--DDAINRRISLLVLNK 181


>2zvy_A Chemotaxis protein MOTB; 2-layer sandwich, bacterial flagellum,
           cell inner membrane, cell membrane, flagellar rotation,
           membrane; 1.75A {Salmonella typhimurium} PDB: 2zvz_A
          Length = 183

 Score = 57.1 bits (137), Expect = 2e-09
 Identities = 29/145 (20%), Positives = 56/145 (38%), Gaps = 15/145 (10%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVS-EVFLEKKFLPMLQLIATILNK 105
           L       ++ L   G+ +  I D           F +    +E     +L+ IA +LN 
Sbjct: 35  LRALRPHLKIDLVQEGLRIQ-IIDS-----QNRPMFKTGSAEVEPYMRDILRAIAPVLNG 88

Query: 106 FPSTVIAIQSHTDSIGTL-----KNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYK 160
            P+  I++  HTD           +N  +S +RA+  +  L+  G+ + + + V G A  
Sbjct: 89  IPNR-ISLAGHTDDFPYANGEKGYSNWELSADRANASRRELVAGGLDNGKVLRVVGMAAT 147

Query: 161 YPIDTNDTKVGRQNNQRIEIQIFPR 185
             +           N+RI + +  +
Sbjct: 148 MRLSDRGP--DDAINRRISLLVLNK 170


>3khn_A MOTB protein, putative; structural genomics, OMPA-like domain,
           PSI-2, protein structure initiative; 2.03A
           {Desulfovibrio vulgaris str}
          Length = 174

 Score = 53.0 bits (126), Expect = 4e-08
 Identities = 26/149 (17%), Positives = 48/149 (32%), Gaps = 9/149 (6%)

Query: 46  SLDKAEDEFQMQLQDTG----IVVSRIGDMITCYIPVHVSFVS-EVFLEKKFLPMLQLIA 100
           +  +  +E +      G    I       +IT  +P  V F    V L      +L  + 
Sbjct: 15  AQRQTYNEMRTYFTVNGVEGVIGAVFDEGVITLRVPSEVLFAPGAVELAPGADRVLATLK 74

Query: 101 TILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRF----ISVRG 156
            +  +     I I+  TD +    N           ++S  + R           ++  G
Sbjct: 75  DLFIRRREQNINIKGFTDDVQPSANARFKDNWEVSALRSVNVLRYFLGAGIEPARLTATG 134

Query: 157 FAYKYPIDTNDTKVGRQNNQRIEIQIFPR 185
                P+  N +   R  N+R+E  +  R
Sbjct: 135 LGELDPLFPNTSDENRARNRRVEFVLERR 163


>2hqs_H Peptidoglycan-associated lipoprotein; TOLB, PAL, TOL, transport
           protein/lipoprotein complex; 1.50A {Escherichia coli}
           SCOP: d.79.7.1 PDB: 2w8b_C 1oap_A
          Length = 118

 Score = 51.8 bits (123), Expect = 1e-07
 Identities = 25/95 (26%), Positives = 42/95 (44%), Gaps = 1/95 (1%)

Query: 88  LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVS 147
           +   F  ML   A  L   PS  + ++ H D  GT + N+ + + RA+ +K YL  +GVS
Sbjct: 17  IRSDFAQMLDAHANFLRSNPSYKVTVEGHADERGTPEYNISLGERRANAVKMYLQGKGVS 76

Query: 148 SNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQI 182
               IS+  +  + P      +     N+R  +  
Sbjct: 77  -ADQISIVSYGKEKPAVLGHDEAAYSKNRRAVLVY 110


>2aiz_P Outer membrane protein P6; alpha-beta sandwich; HET: UDP AMU DGL
           6CL DAL; NMR {Haemophilus influenzae} SCOP: d.79.7.1
          Length = 134

 Score = 47.6 bits (112), Expect = 2e-06
 Identities = 23/93 (24%), Positives = 46/93 (49%), Gaps = 1/93 (1%)

Query: 88  LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVS 147
           +  +++ +L   A  LN  P+  + ++ +TD  GT + N+ + Q RAD +K YL  +GV 
Sbjct: 41  ITGEYVQILDAHAAYLNATPAAKVLVEGNTDERGTPEYNIALGQRRADAVKGYLAGKGVD 100

Query: 148 SNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEI 180
           + +  +V  +  + P      +     N+R  +
Sbjct: 101 AGKLGTVS-YGEEKPAVLGHDEAAYSKNRRAVL 132


>2pff_B Fatty acid synthase subunit beta; fatty acid synthase,
           acyl-carrier-protein, beta-ketoacyl reductase,
           beta-ketoacyl synthase, dehydratase; 4.00A
           {Saccharomyces cerevisiae}
          Length = 2006

 Score = 39.2 bits (91), Expect = 6e-04
 Identities = 41/233 (17%), Positives = 63/233 (27%), Gaps = 118/233 (50%)

Query: 3   KELGLSM------FIMT--TISGCGLAS--RE---------------KKKV-----FL-- 30
           K++ +S+       +++    S  GL    R+               ++K+     FL  
Sbjct: 364 KQVEISLVNGAKNLVVSGPPQSLYGLNLTLRKAKAPSGLDQSRIPFSERKLKFSNRFLPV 423

Query: 31  ----HKS---NDTDIVNKRF--------GSSL-------DKAEDEFQMQLQDTGI-VVSR 67
               H       +D++NK             +           D     L+     +  R
Sbjct: 424 ASPFHSHLLVPASDLINKDLVKNNVSFNAKDIQIPVYDTFDGSD-----LRVLSGSISER 478

Query: 68  IGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHT-------DS- 119
           I D I    PV          E           T   +F +T      H         S 
Sbjct: 479 IVDCIIRL-PVK--------WET---------TT---QFKAT------HILDFGPGGASG 511

Query: 120 IGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTN-DTKVG 171
           +G L +       R    K      GV   R I V G      +D N D   G
Sbjct: 512 LGVLTH-------R---NKD---GTGV---RVI-VAG-----TLDINPDDDYG 542



 Score = 37.6 bits (87), Expect = 0.002
 Identities = 24/154 (15%), Positives = 50/154 (32%), Gaps = 44/154 (28%)

Query: 42  RFGSSLDKAEDEFQMQLQDTGIV--VSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLI 99
           +F   L +  + F    + T     V +       ++     +VS +    K     Q++
Sbjct: 36  QFNKILPEPTEGFAADDEPTTPAELVGK-------FL----GYVSSLVEPSKVGQFDQVL 84

Query: 100 ATILNKFPSTVIAIQSHTDSIGTLKNNLLISQE-----RADVIKSYL---------IQRG 145
              L +F +  +      + I  L   LL   +       ++IK+Y+           + 
Sbjct: 85  NLCLTEFENCYLE----GNDIHALAAKLLQENDTTLVKTKELIKNYITARIMAKRPFDKK 140

Query: 146 VSSNRFISVRGFAYKYPIDTNDTKV----GRQNN 175
            +S  F +V            + ++    G Q N
Sbjct: 141 SNSALFRAVG---------EGNAQLVAIFGGQGN 165



 Score = 29.9 bits (67), Expect = 0.38
 Identities = 23/151 (15%), Positives = 48/151 (31%), Gaps = 50/151 (33%)

Query: 53  EFQMQLQDT-----GIVVSRIGDMITCYIPVHVSFVSEVFLE--KKFLPMLQLIAT-ILN 104
           E +  L+       G+V +         I    S+  E F    +K + +L  I      
Sbjct: 262 ELRSYLKGATGHSQGLVTA-------VAIAETDSW--ESFFVSVRKAITVLFFIGVRCYE 312

Query: 105 KFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPID 164
            +P+T +      DS+           E  + + S +          +S+         +
Sbjct: 313 AYPNTSLPPSILEDSL-----------ENNEGVPSPM----------LSISNL----TQE 347

Query: 165 TNDTKVGRQN-----NQRIEIQIF--PRGNI 188
                V + N      +++EI +    + N+
Sbjct: 348 QVQDYVNKTNSHLPAGKQVEISLVNGAK-NL 377


>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant
           photosynthetic reaction center, peripheral antenna; HET:
           CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1
          Length = 154

 Score = 31.1 bits (69), Expect = 0.16
 Identities = 11/42 (26%), Positives = 20/42 (47%), Gaps = 18/42 (42%)

Query: 89  EKKFLPMLQLIATILNKF------PSTVIAIQSHTDSIGTLK 124
           EK+ L  LQ  A++  K       P+  +AI++      T++
Sbjct: 18  EKQALKKLQ--ASL--KLYADDSAPA--LAIKA------TME 47


>2wnm_A Gene 2, GP2; small protein inhibntor bacterial RNA polymerase,
          hydrolase; NMR {Enterobacteria phage T7}
          Length = 64

 Score = 27.3 bits (60), Expect = 2.2
 Identities = 12/57 (21%), Positives = 26/57 (45%)

Query: 12 MTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRI 68
          M+ ++   L+   KK     +S++       +  +LD+A +  + Q    G  V+R+
Sbjct: 1  MSNVNTGSLSVDNKKFWATVESSEHSFEVPIYAETLDEALELAEWQYVPAGFEVTRV 57


>1w7p_D VPS36P, YLR417W; ESCRT-II complex, endosomal protein sorting,
           protein transport; 3.6A {Saccharomyces cerevisiae} SCOP:
           a.4.5.54 a.4.5.54
          Length = 566

 Score = 27.4 bits (60), Expect = 2.3
 Identities = 10/65 (15%), Positives = 24/65 (36%), Gaps = 1/65 (1%)

Query: 91  KFLPMLQLIATILNKFPSTVIAIQSHT-DSIGTLKNNLLISQERADVIKSYLIQRGVSSN 149
           +    L L    L K    ++ + S   D +     +L+     +D+++   I    +S 
Sbjct: 465 ERFEHLGLNELKLVKVNKRILCVTSEKFDVVKEKLVDLIGDNPGSDLLRLTQILSSNNSK 524

Query: 150 RFISV 154
              ++
Sbjct: 525 SNWTL 529


>2ps1_A Orotate phosphoribosyltransferase 1; alpha beta, oprtase-OA-PRPP
           complex; HET: ORO PRP; 1.75A {Saccharomyces cerevisiae}
           PDB: 2pry_A* 2prz_A*
          Length = 226

 Score = 25.1 bits (54), Expect = 9.6
 Identities = 21/122 (17%), Positives = 44/122 (36%), Gaps = 6/122 (4%)

Query: 31  HKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCY----IPVHVSFVSEV 86
            ++ D        GS+L+         +   G  ++   ++I+      +   ++   + 
Sbjct: 107 KEAKDHGEGGIIVGSALENKRILIIDDVMTAGTAINEAFEIISNAKGQVVGSIIALDRQE 166

Query: 87  FLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGV 146
            +       L    T+  K+   V++I S    I  L+    I+ E    I+ YL   G 
Sbjct: 167 VVSTDDKEGLSATQTVSKKYGIPVLSIVSLIHIITYLEGR--ITAEEKSKIEQYLQTYGA 224

Query: 147 SS 148
           S+
Sbjct: 225 SA 226


  Database: pdb70
    Posted date:  Jan 26, 2011 11:21 AM
  Number of letters in database: 5,693,230
  Number of sequences in database:  24,244
  
Lambda     K      H
   0.322    0.137    0.380 

Gapped
Lambda     K      H
   0.267   0.0680    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 24244
Number of Hits to DB: 1,485,491
Number of extensions: 62631
Number of successful extensions: 183
Number of sequences better than 10.0: 1
Number of HSP's gapped: 171
Number of HSP's successfully gapped: 22
Length of query: 190
Length of database: 5,693,230
Length adjustment: 87
Effective length of query: 103
Effective length of database: 3,584,002
Effective search space: 369152206
Effective search space used: 369152206
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 54 (24.7 bits)