BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= gi|254780953|ref|YP_003065366.1| OmpA/MotB [Candidatus
Liberibacter asiaticus str. psy62]
         (190 letters)

Database: las_proteome 
           1233 sequences; 328,796 total letters

Searching...................................................done



>gi|254780953|ref|YP_003065366.1| OmpA/MotB [Candidatus Liberibacter asiaticus str. psy62]
          Length = 190

 Score =  389 bits (999), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 190/190 (100%), Positives = 190/190 (100%)

Query: 1   MIKELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQD 60
           MIKELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQD
Sbjct: 1   MIKELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQD 60

Query: 61  TGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSI 120
           TGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSI
Sbjct: 61  TGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSI 120

Query: 121 GTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEI 180
           GTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEI
Sbjct: 121 GTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEI 180

Query: 181 QIFPRGNIKK 190
           QIFPRGNIKK
Sbjct: 181 QIFPRGNIKK 190


>gi|254780529|ref|YP_003064942.1| flagellar motor protein MotB [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 343

 Score = 34.7 bits (78), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 37/68 (54%), Gaps = 4/68 (5%)

Query: 95  MLQLIATILNKFPSTVIAIQSHTDSI---GTLKNNLLISQERADVIKSYLIQRGVSSNRF 151
           +LQ I  +L    + VI+I+ HTD+       ++N  +S +RA      L++ GVS +R 
Sbjct: 251 VLQKIGEVL-AHSTEVISIRGHTDASPFRNIARDNWRLSLDRAYSAYQVLMKSGVSEDRI 309

Query: 152 ISVRGFAY 159
             + GFA+
Sbjct: 310 SKISGFAH 317


>gi|254780547|ref|YP_003064960.1| OmpA/MotB [Candidatus Liberibacter asiaticus str. psy62]
          Length = 160

 Score = 31.6 bits (70), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 11/38 (28%), Positives = 24/38 (63%)

Query: 113 IQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNR 150
           I+ H D +G+  +++ +   RA  + +Y + RG+S++R
Sbjct: 85  IEGHADELGSRNSSIALGLRRAYAVFNYFVARGISASR 122


>gi|254780143|ref|YP_003064556.1| DNA-directed RNA polymerase subunit beta [Candidatus Liberibacter
            asiaticus str. psy62]
          Length = 1386

 Score = 24.6 bits (52), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 11/27 (40%), Positives = 14/27 (51%)

Query: 158  AYKYPIDTNDTKVGRQNNQRIEIQIFP 184
            A K PI + D   GR  N+ I  +I P
Sbjct: 1079 AMKRPIQSGDKMAGRHGNKGIVSRILP 1105


>gi|254781061|ref|YP_003065474.1| putative iron-sulfur cluster assembly protein [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 428

 Score = 23.1 bits (48), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 17/30 (56%), Gaps = 2/30 (6%)

Query: 140 YLIQRGVSSNRFISVRGFAYKYPI--DTND 167
           YL+ RG+S N+  S+   A+   I  D ND
Sbjct: 374 YLMARGISKNQACSMLSHAFMSEIVEDLND 403


>gi|254781206|ref|YP_003065619.1| hypothetical protein CLIBASIA_05565 [Candidatus Liberibacter
            asiaticus str. psy62]
          Length = 1246

 Score = 22.7 bits (47), Expect = 4.1,   Method: Composition-based stats.
 Identities = 9/30 (30%), Positives = 18/30 (60%)

Query: 30   LHKSNDTDIVNKRFGSSLDKAEDEFQMQLQ 59
            +H   ++DI  + F  SL   EDE +++++
Sbjct: 1086 MHADTESDIYFEEFKRSLSSWEDEPRIEVE 1115


>537021.9.peg.410_1 
          Length = 952

 Score = 21.9 bits (45), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 10/25 (40%), Positives = 14/25 (56%)

Query: 81  SFVSEVFLEKKFLPMLQLIATILNK 105
           S +S  FL +KF P   +I   +NK
Sbjct: 67  SLLSSFFLTQKFTPQKNIITQEINK 91


>gi|254780382|ref|YP_003064795.1| ATP dependent RNA helicase protein [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 465

 Score = 21.9 bits (45), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 15/68 (22%), Positives = 34/68 (50%)

Query: 69  GDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLL 128
           G ++   I + V   ++  L+  F+P +Q I +++     T++   + TD +  +  N L
Sbjct: 140 GKLLMNNIEILVIDEADRMLDMGFIPYIQNITSLVPFTRQTLLFSATMTDELQKVSENFL 199

Query: 129 ISQERADV 136
            + +R +V
Sbjct: 200 QNPKRIEV 207


  Database: las_proteome
    Posted date:  Jun 5, 2011  6:30 PM
  Number of letters in database: 328,796
  Number of sequences in database:  1233
  
Lambda     K      H
   0.322    0.137    0.380 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 118,518
Number of Sequences: 1233
Number of extensions: 4575
Number of successful extensions: 19
Number of sequences better than 100.0: 10
Number of HSP's better than 100.0 without gapping: 9
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 10
Number of HSP's gapped (non-prelim): 10
length of query: 190
length of database: 328,796
effective HSP length: 69
effective length of query: 121
effective length of database: 243,719
effective search space: 29489999
effective search space used: 29489999
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 36 (18.5 bits)